Spermidine synthase

Overview
NameSpermidine synthase
Smed IDSMED30026524
Length (bp)1129
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spermidine synthase (SMED30026524) t-SNE clustered cells

Violin plots show distribution of expression levels for Spermidine synthase (SMED30026524) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spermidine synthase (SMED30026524) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spermidine synthase (SMED30026524) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026524

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026524SMESG000031473.1 SmedASXL_019444SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30026524SMESG000031473.1 dd_Smed_v4_7292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026524SMESG000031473.1 dd_Smed_v4_7292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30026524SMESG000031473.1 dd_Smed_v4_7292_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026524SMESG000031473.1 dd_Smed_v6_7292_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30026524SMESG000031473.1 OX_Smed_1.0.11639ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026524SMESG000031473.1 dd_Smed_v4_7292_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spermidine synthase vs. Ensembl Human
Match: SRM (spermidine synthase [Source:HGNC Symbol;Acc:HGNC:11296])

HSP 1 Score: 334.339 bits (856), Expect = 1.623e-113
Identity = 151/276 (54.71%), Postives = 209/276 (75.72%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIET---NLPFQDKLRHYTPEVHRASFALP 862
            I   WF E    W GQA+SL+V++++  + +++QD+L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+ +SKK L  MA+GY S K  L + DGFEF+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +LK DG++C QG+  WL LD+IK + + C+S+FPVV YA  ++PTY +GQIG++LCSKN +TNF+EP++        Q +L++Y  +VHRA+F LP
Sbjct:   16 IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLP 291          
BLAST of Spermidine synthase vs. Ensembl Human
Match: SRM (spermidine synthase [Source:HGNC Symbol;Acc:HGNC:11296])

HSP 1 Score: 132.88 bits (333), Expect = 1.489e-37
Identity = 62/101 (61.39%), Postives = 77/101 (76.24%), Query Frame = 2
Query:  128 KTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGY 430
            + T+  D     S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+ +SKK L  MA+GY
Sbjct:   18 QRTQVPDCHSARSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGY 118          
BLAST of Spermidine synthase vs. Ensembl Human
Match: SRM (spermidine synthase [Source:HGNC Symbol;Acc:HGNC:11296])

HSP 1 Score: 118.242 bits (295), Expect = 8.620e-32
Identity = 59/133 (44.36%), Postives = 80/133 (60.15%), Query Frame = 2
Query:  308 DGGVMRDVAKHHKVKKIVQCEIDE------------------------------EVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQ 616
            DGGV+R+V KH  V+ +VQCEIDE                              +V+ +SKK L  MA+GY S K  L + DGFEF+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +LK DG++C Q
Sbjct:    2 DGGVLREVVKHPSVESVVQCEIDEVSAGVEPGLSPGSPSGQLCPEMAAHPRARQDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQ 134          
BLAST of Spermidine synthase vs. Ensembl Human
Match: SRM (spermidine synthase [Source:HGNC Symbol;Acc:HGNC:11296])

HSP 1 Score: 54.6842 bits (130), Expect = 4.243e-9
Identity = 24/49 (48.98%), Postives = 36/49 (73.47%), Query Frame = 2
Query:  725 NGQIGYVLCSKNRNTNFKEPIE---TNLPFQDKLRHYTPEVHRASFALP 862
            +GQIG++LCSKN +TNF+EP++        Q +L++Y  +VHRA+F LP
Sbjct:    2 SGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLP 50          
BLAST of Spermidine synthase vs. Ensembl Celegans
Match: spds-1 (SPermiDine Synthase [Source:UniProtKB/TrEMBL;Acc:B4E3X6])

HSP 1 Score: 276.174 bits (705), Expect = 5.464e-91
Identity = 148/306 (48.37%), Postives = 202/306 (66.01%), Query Frame = 2
Query:   35 MNYIINDWFTEYS---------------------DG------WAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDK---LRHYTPEVHRASFALP 862
            MN +   WFTE+S                     DG      W GQA SL+VK+++  + +K+QD+L+FEST +G VLVLDGI+Q TE+DEF YQEM++ LP+ +HP+P+ VLIIGGGDGG++R+V KH  V+K+  CEIDE V++++KK L  M+ G+   K  L   DGFEFLK HKNEFDVIITDS+DP GP E LF  +Y++L+ ++LK DGI+ SQG+++WL L +I +L+   + IFP V YA   V TY +G +GY++C+KN N +   P  T    Q K   LR Y  EVH+A+F LP
Sbjct:    1 MNKLHKGWFTEFSPDDLEKMNGASDEEPTKVLKSDGQEMGGAWPGQAFSLQVKKVLFHEKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQEMLAHLPMFAHPDPKRVLIIGGGDGGILREVLKHESVEKVTMCEIDEMVIDVAKKFLPGMSCGFSHPKLDLFCGDGFEFLKNHKNEFDVIITDSSDPVGPAESLFGQSYYELLRDALKEDGILSSQGESVWLHLPLIAHLVAFNRKIFPAVTYAQSIVSTYPSGSMGYLICAKNANRDVTTPARTLTAEQIKALNLRFYNSEVHKAAFVLP 306          
BLAST of Spermidine synthase vs. Ensembl Celegans
Match: spds-1 (SPermiDine Synthase [Source:UniProtKB/TrEMBL;Acc:B4E3X6])

HSP 1 Score: 276.174 bits (705), Expect = 5.464e-91
Identity = 148/306 (48.37%), Postives = 202/306 (66.01%), Query Frame = 2
Query:   35 MNYIINDWFTEYS---------------------DG------WAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDK---LRHYTPEVHRASFALP 862
            MN +   WFTE+S                     DG      W GQA SL+VK+++  + +K+QD+L+FEST +G VLVLDGI+Q TE+DEF YQEM++ LP+ +HP+P+ VLIIGGGDGG++R+V KH  V+K+  CEIDE V++++KK L  M+ G+   K  L   DGFEFLK HKNEFDVIITDS+DP GP E LF  +Y++L+ ++LK DGI+ SQG+++WL L +I +L+   + IFP V YA   V TY +G +GY++C+KN N +   P  T    Q K   LR Y  EVH+A+F LP
Sbjct:    1 MNKLHKGWFTEFSPDDLEKMNGASDEEPTKVLKSDGQEMGGAWPGQAFSLQVKKVLFHEKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQEMLAHLPMFAHPDPKRVLIIGGGDGGILREVLKHESVEKVTMCEIDEMVIDVAKKFLPGMSCGFSHPKLDLFCGDGFEFLKNHKNEFDVIITDSSDPVGPAESLFGQSYYELLRDALKEDGILSSQGESVWLHLPLIAHLVAFNRKIFPAVTYAQSIVSTYPSGSMGYLICAKNANRDVTTPARTLTAEQIKALNLRFYNSEVHKAAFVLP 306          
BLAST of Spermidine synthase vs. Ensembl Celegans
Match: spds-1 (SPermiDine Synthase [Source:UniProtKB/TrEMBL;Acc:B4E3X6])

HSP 1 Score: 264.618 bits (675), Expect = 1.066e-85
Identity = 140/298 (46.98%), Postives = 200/298 (67.11%), Query Frame = 2
Query:   35 MNYIINDWFTEYS---------------------DG------WAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRA 847
            MN +   WFTE+S                     DG      W GQA SL+VK+++  + +K+QD+L+FEST +G VLVLDGI+Q TE+DEF YQEM++ LP+ +HP+P+ VLIIGGGDGG++R+V KH  V+K+  CEIDE V++++KK L  M+ G+   K  L   DGFEFLK HKNEFDVIITDS+DP GP E LF  +Y++L+ ++LK DGI+ SQG+  WL++ +I  ++ + + +FPV +YA GSVPTYT+G +GY+LC+K++  N  E +  +LP    L  +  ++  A
Sbjct:    1 MNKLHKGWFTEFSPDDLEKMNGASDEEPTKVLKSDGQEMGGAWPGQAFSLQVKKVLFHEKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQEMLAHLPMFAHPDPKRVLIIGGGDGGILREVLKHESVEKVTMCEIDEMVIDVAKKFLPGMSCGFSHPKLDLFCGDGFEFLKNHKNEFDVIITDSSDPVGPAESLFGQSYYELLRDALKEDGILSSQGECPWLDMKLISTVIHSARDLFPVAKYAVGSVPTYTSGLMGYILCAKDK-VNTGESVWLHLPLIAHLVAFNRKIFPA 297          
BLAST of Spermidine synthase vs. Ensembl Celegans
Match: spds-1 (SPermiDine Synthase [Source:UniProtKB/TrEMBL;Acc:B4E3X6])

HSP 1 Score: 264.618 bits (675), Expect = 1.066e-85
Identity = 140/298 (46.98%), Postives = 200/298 (67.11%), Query Frame = 2
Query:   35 MNYIINDWFTEYS---------------------DG------WAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRA 847
            MN +   WFTE+S                     DG      W GQA SL+VK+++  + +K+QD+L+FEST +G VLVLDGI+Q TE+DEF YQEM++ LP+ +HP+P+ VLIIGGGDGG++R+V KH  V+K+  CEIDE V++++KK L  M+ G+   K  L   DGFEFLK HKNEFDVIITDS+DP GP E LF  +Y++L+ ++LK DGI+ SQG+  WL++ +I  ++ + + +FPV +YA GSVPTYT+G +GY+LC+K++  N  E +  +LP    L  +  ++  A
Sbjct:    1 MNKLHKGWFTEFSPDDLEKMNGASDEEPTKVLKSDGQEMGGAWPGQAFSLQVKKVLFHEKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQEMLAHLPMFAHPDPKRVLIIGGGDGGILREVLKHESVEKVTMCEIDEMVIDVAKKFLPGMSCGFSHPKLDLFCGDGFEFLKNHKNEFDVIITDSSDPVGPAESLFGQSYYELLRDALKEDGILSSQGECPWLDMKLISTVIHSARDLFPVAKYAVGSVPTYTSGLMGYILCAKDK-VNTGESVWLHLPLIAHLVAFNRKIFPA 297          
BLAST of Spermidine synthase vs. Ensembl Fly
Match: SpdS (gene:FBgn0037723 transcript:FBtr0082078)

HSP 1 Score: 303.523 bits (776), Expect = 6.472e-102
Identity = 148/278 (53.24%), Postives = 198/278 (71.22%), Query Frame = 2
Query:   35 MNYIINDWFTEY-SDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQD-KLRHYTPEVHRASFALP 862
            M+ + N WF+E  +D W GQ+ SLKVKE+I  + ++FQD+ I E+  +G+ L+LDGIIQ T +DEF YQEMIS LPL +HPNP+ VLI+GGGDGGV R+V KH  V+++ Q EID+ VV LSK++L  MA G+ ++K  LTI DGF+++K+HKNEFDVIITDS+DP GP   LFQ +Y++L+  +LK DGI+CSQG + WL+LD IK  +  CK  F  V YA  SVP+Y  G IG+V+ S N+N +F  P           LR+Y+ EVH A+FALP
Sbjct:    1 MDSLNNGWFSELQADLWPGQSFSLKVKEVIHKEKSRFQDIQIVETETYGRCLILDGIIQCTARDEFSYQEMISFLPLCAHPNPKKVLIVGGGDGGVAREVVKHPLVEEVHQVEIDDRVVELSKQYLPAMACGFANEKLKLTIGDGFDYMKKHKNEFDVIITDSSDPIGPAVSLFQESYYELMKHALKDDGIVCSQGGSFWLDLDYIKKTMSGCKEHFAKVAYAVTSVPSYPCGHIGFVMGSLNKNQDFATPKLGKSEIDSIDLRYYSSEVHSAAFALP 278          
BLAST of Spermidine synthase vs. Ensembl Fly
Match: SpdS (gene:FBgn0037723 transcript:FBtr0306007)

HSP 1 Score: 303.523 bits (776), Expect = 6.472e-102
Identity = 148/278 (53.24%), Postives = 198/278 (71.22%), Query Frame = 2
Query:   35 MNYIINDWFTEY-SDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQD-KLRHYTPEVHRASFALP 862
            M+ + N WF+E  +D W GQ+ SLKVKE+I  + ++FQD+ I E+  +G+ L+LDGIIQ T +DEF YQEMIS LPL +HPNP+ VLI+GGGDGGV R+V KH  V+++ Q EID+ VV LSK++L  MA G+ ++K  LTI DGF+++K+HKNEFDVIITDS+DP GP   LFQ +Y++L+  +LK DGI+CSQG + WL+LD IK  +  CK  F  V YA  SVP+Y  G IG+V+ S N+N +F  P           LR+Y+ EVH A+FALP
Sbjct:    1 MDSLNNGWFSELQADLWPGQSFSLKVKEVIHKEKSRFQDIQIVETETYGRCLILDGIIQCTARDEFSYQEMISFLPLCAHPNPKKVLIVGGGDGGVAREVVKHPLVEEVHQVEIDDRVVELSKQYLPAMACGFANEKLKLTIGDGFDYMKKHKNEFDVIITDSSDPIGPAVSLFQESYYELMKHALKDDGIVCSQGGSFWLDLDYIKKTMSGCKEHFAKVAYAVTSVPSYPCGHIGFVMGSLNKNQDFATPKLGKSEIDSIDLRYYSSEVHSAAFALP 278          
BLAST of Spermidine synthase vs. Ensembl Fly
Match: SpdS (gene:FBgn0037723 transcript:FBtr0082079)

HSP 1 Score: 229.565 bits (584), Expect = 5.966e-74
Identity = 112/208 (53.85%), Postives = 147/208 (70.67%), Query Frame = 2
Query:  242 MISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQD-KLRHYTPEVHRASFALP 862
            MIS LPL +HPNP+ VLI+GGGDGGV R+V KH  V+++ Q EID+ VV LSK++L  MA G+ ++K  LTI DGF+++K+HKNEFDVIITDS+DP GP   LFQ +Y++L+  +LK DGI+CSQG + WL+LD IK  +  CK  F  V YA  SVP+Y  G IG+V+ S N+N +F  P           LR+Y+ EVH A+FALP
Sbjct:    1 MISFLPLCAHPNPKKVLIVGGGDGGVAREVVKHPLVEEVHQVEIDDRVVELSKQYLPAMACGFANEKLKLTIGDGFDYMKKHKNEFDVIITDSSDPIGPAVSLFQESYYELMKHALKDDGIVCSQGGSFWLDLDYIKKTMSGCKEHFAKVAYAVTSVPSYPCGHIGFVMGSLNKNQDFATPKLGKSEIDSIDLRYYSSEVHSAAFALP 208          
BLAST of Spermidine synthase vs. Ensembl Fly
Match: Sms (gene:FBgn0036272 transcript:FBtr0076010)

HSP 1 Score: 55.0694 bits (131), Expect = 4.759e-8
Identity = 50/183 (27.32%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  107 VKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMA----VGYDSDKAILTISDGFEFLKQHKNE---FDVIITDSTD---PQGP-GEVL-FQSNYFQLIFESLKSDGIMCSQG 619
            + +++    + FQ + I  S   G +L+LD +  + E D  +Y E +    + ++   + + I+GGGDG ++ ++ K +  K +V  EIDE V+    K+L+ +          D+  + + D  E+LK+   E   FD +  D TD      P GE   F    F+  F+ LK DG   + G
Sbjct:  140 IDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESD-LIYTETLMCRGVENYEG-KEICILGGGDGALLYELLKENP-KHVVMLEIDELVMQTCNKYLNVICGDVLEKRKGDQYEIIVGDCVEYLKKFIAEGRKFDYVFGDLTDIPITDAPEGETWDFIRTIFEHSFKVLKPDGKYLTHG 319          
BLAST of Spermidine synthase vs. Ensembl Fly
Match: Sms (gene:FBgn0036272 transcript:FBtr0076009)

HSP 1 Score: 54.6842 bits (130), Expect = 5.128e-8
Identity = 50/183 (27.32%), Postives = 87/183 (47.54%), Query Frame = 2
Query:  107 VKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMA----VGYDSDKAILTISDGFEFLKQHKNE---FDVIITDSTD---PQGP-GEVL-FQSNYFQLIFESLKSDGIMCSQG 619
            + +++    + FQ + I  S   G +L+LD +  + E D  +Y E +    + ++   + + I+GGGDG ++ ++ K +  K +V  EIDE V+    K+L+ +          D+  + + D  E+LK+   E   FD +  D TD      P GE   F    F+  F+ LK DG   + G
Sbjct:  141 IDKVVFEARSPFQKIQIMHSKTLGNMLLLDELQNIAESD-LIYTETLMCRGVENYEG-KEICILGGGDGALLYELLKENP-KHVVMLEIDELVMQTCNKYLNVICGDVLEKRKGDQYEIIVGDCVEYLKKFIAEGRKFDYVFGDLTDIPITDAPEGETWDFIRTIFEHSFKVLKPDGKYLTHG 320          
BLAST of Spermidine synthase vs. Ensembl Zebrafish
Match: srm (spermidine synthase [Source:ZFIN;Acc:ZDB-GENE-040426-1183])

HSP 1 Score: 325.865 bits (834), Expect = 1.456e-110
Identity = 151/279 (54.12%), Postives = 209/279 (74.91%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIE--TNLPFQD-KLRHYTPEVHRASFALP 862
            M+ I + WFTE    W GQAMSL+V+E++  K +KFQD+++F+S  +G VL+LDG+IQ TE+DEF YQEMI+ LPL  HP P+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+N+SKK+L  MA G+ S K  L + DGFEF+K++++ FD+IITDS+DP GP E LF+ +Y+QL+  +L   GI+C QG+  WL L++IK +   CK++FPVV YA  ++PTY +GQIG++LCSKN  TNF+EP+   T    +   L++Y PE+HRA+F LP
Sbjct:    1 MDNIKDGWFTETCTLWPGQAMSLQVEEVLYHKKSKFQDVMVFKSKTYGNVLILDGVIQCTERDEFSYQEMIANLPLCCHPCPKKVLIIGGGDGGVLREVVKHPLVESVVQCEIDEDVINVSKKYLPGMAKGFFSPKLTLHVGDGFEFMKKNQDAFDIIITDSSDPVGPAESLFKESYYQLMKTALCEGGILCCQGECQWLHLELIKEMRTFCKTLFPVVDYAYCTIPTYPSGQIGFMLCSKNSKTNFREPLRELTRDEIESMSLKYYNPEIHRAAFILP 279          
BLAST of Spermidine synthase vs. Ensembl Xenopus
Match: hypk (huntingtin interacting protein K [Source:Xenbase;Acc:XB-GENE-999052])

HSP 1 Score: 332.028 bits (850), Expect = 1.242e-112
Identity = 154/274 (56.20%), Postives = 210/274 (76.64%), Query Frame = 2
Query:   50 NDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQ-DK--LRHYTPEVHRASFALP 862
            + WF E    W GQAMSL+V+E++  K + FQ++L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDEEV+N+SKK+L  MA+GY S K  L + DGF+F+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +L+  GI+C QG+  WL LD+IK + + CK++FPVV+YA  ++PTY +GQIG++LCSK+ +TNFKEP++     Q DK  LR+Y   +H+A+F LP
Sbjct:   17 DGWFRETCSLWPGQAMSLEVEEVLYHKQSSFQEILVFRSKTYGNVLVLDGLIQCTERDEFSYQEMIANLPLYSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEEVINVSKKYLPGMAIGYSSPKLTLHVGDGFQFMKQNQDAFDVIITDSSDPVGPAESLFKESYYQLMKTALREGGILCCQGECQWLHLDLIKEMHQFCKTLFPVVEYAYCTIPTYPSGQIGFMLCSKDPSTNFKEPVQQLSQEQVDKMNLRYYNSRIHQAAFVLP 290          
BLAST of Spermidine synthase vs. Ensembl Xenopus
Match: hypk (huntingtin interacting protein K [Source:Xenbase;Acc:XB-GENE-999052])

HSP 1 Score: 331.643 bits (849), Expect = 2.126e-112
Identity = 154/274 (56.20%), Postives = 210/274 (76.64%), Query Frame = 2
Query:   50 NDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQ-DK--LRHYTPEVHRASFALP 862
            + WF E    W GQAMSL+V+E++  K + FQ++L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDEEV+N+SKK+L  MA+GY S K  L + DGF+F+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +L+  GI+C QG+  WL LD+IK + + CK++FPVV+YA  ++PTY +GQIG++LCSK+ +TNFKEP++     Q DK  LR+Y   +H+A+F LP
Sbjct:   13 DGWFRETCSLWPGQAMSLEVEEVLYHKQSSFQEILVFRSKTYGNVLVLDGLIQCTERDEFSYQEMIANLPLYSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEEVINVSKKYLPGMAIGYSSPKLTLHVGDGFQFMKQNQDAFDVIITDSSDPVGPAESLFKESYYQLMKTALREGGILCCQGECQWLHLDLIKEMHQFCKTLFPVVEYAYCTIPTYPSGQIGFMLCSKDPSTNFKEPVQQLSQEQVDKMNLRYYNSRIHQAAFVLP 286          
BLAST of Spermidine synthase vs. Ensembl Mouse
Match: Srm (spermidine synthase [Source:MGI Symbol;Acc:MGI:102690])

HSP 1 Score: 333.569 bits (854), Expect = 2.006e-113
Identity = 153/276 (55.43%), Postives = 208/276 (75.36%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPF---QDKLRHYTPEVHRASFALP 862
            I   WF E    W GQA+SL+V++++  + +++QD+L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+ +SKK L  MAVG+ S K  L + DGFEF+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +LK DGI+C QG+  WL LD+IK +   CKS+FPVV YA  S+PTY +GQIG++LCSKN +TNF+EP++        Q +L++Y  ++HRA+F LP
Sbjct:   16 IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVSKKFLPGMAVGFSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVDYAYCSIPTYPSGQIGFMLCSKNPSTNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLP 291          
BLAST of Spermidine synthase vs. UniProt/SwissProt
Match: sp|P19623|SPEE_HUMAN (Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM PE=1 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 7.792e-113
Identity = 151/276 (54.71%), Postives = 209/276 (75.72%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIET---NLPFQDKLRHYTPEVHRASFALP 862
            I   WF E    W GQA+SL+V++++  + +++QD+L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+ +SKK L  MA+GY S K  L + DGFEF+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +LK DG++C QG+  WL LD+IK + + C+S+FPVV YA  ++PTY +GQIG++LCSKN +TNF+EP++        Q +L++Y  +VHRA+F LP
Sbjct:   16 IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQSLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLP 291          
BLAST of Spermidine synthase vs. UniProt/SwissProt
Match: sp|Q64674|SPEE_MOUSE (Spermidine synthase OS=Mus musculus OX=10090 GN=Srm PE=1 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 1.404e-112
Identity = 153/276 (55.43%), Postives = 208/276 (75.36%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPF---QDKLRHYTPEVHRASFALP 862
            I   WF E    W GQA+SL+V++++  + +++QD+L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+ +SKK L  MAVG+ S K  L + DGFEF+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +LK DGI+C QG+  WL LD+IK +   CKS+FPVV YA  S+PTY +GQIG++LCSKN +TNF+EP++        Q +L++Y  ++HRA+F LP
Sbjct:   16 IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIEVSKKFLPGMAVGFSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRHFCKSLFPVVDYAYCSIPTYPSGQIGFMLCSKNPSTNFREPVQQLTQAQVEQMQLKYYNSDMHRAAFVLP 291          
BLAST of Spermidine synthase vs. UniProt/SwissProt
Match: sp|Q9Y8H7|SPEE_NEUCR (Spermidine synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=spe-3 PE=3 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 1.718e-102
Identity = 142/275 (51.64%), Postives = 204/275 (74.18%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIET-NLPFQDKL-RHYTPEVHRASFALP 862
            I + WF E S+ W GQAM+LKV++++  + + +QD+LIF+ST+HG VLVLD +IQ TE+DEF YQEMI+ L +NSHPNP+ VL+IGGGDGGV+R+V KH  V++ + C+IDE V+ LSK+ L  M+ G++  K  + + DGF+FL+  KN FDVIITDS+DP+GP E LFQ  YFQL+ ++L+  G++ +Q +N WL L +I  L K CK +FPV +YA  ++PTY +GQIG+++CSK+ N N K P+ + +   ++KL R+Y  E+H+ASF LP
Sbjct:    9 IQDGWFREISNMWPGQAMTLKVEKVLHHEKSLYQDVLIFKSTDHGNVLVLDNVIQCTERDEFSYQEMITHLAMNSHPNPKKVLVIGGGDGGVLREVVKHDCVEEAILCDIDEAVIRLSKQFLPHMSAGFEHPKVKVHVGDGFKFLEDFKNTFDVIITDSSDPEGPAESLFQKPYFQLLHDALREGGVITTQAENQWLHLPLITKLKKDCKEVFPVAEYAYTTIPTYPSGQIGFMVCSKDPNANVKVPLRSWSQEEEEKLCRYYNSEIHKASFILP 283          
BLAST of Spermidine synthase vs. UniProt/SwissProt
Match: sp|Q12074|SPEE_YEAST (Spermidine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE3 PE=3 SV=1)

HSP 1 Score: 302.368 bits (773), Expect = 2.405e-100
Identity = 138/276 (50.00%), Postives = 198/276 (71.74%), Query Frame = 2
Query:   44 IINDWFTEYSDG-WAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIE--TNLPFQDKLRHYTPEVHRASFALP 862
            I++ WF E SD  W GQAM+LKV++++  + +K+QD+LIF+ST +G VLVLD +IQ TE+DEF YQEMI+ L LNSHPNP+ VL+IGGGDGGV+R+V KH  V++   C+IDE V+ LSK++L  MA  Y   K    I DGF+FL+ ++N FDVIITDS+DP+GP E LFQ  YFQL+  +L   G++ +Q +++W+ L IIK+L K C  +FPV +Y+  ++PTY  G IG+++CSK++  N K+P+   ++    +  R+Y  ++H ASF LP
Sbjct:   10 IVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVLDNVIQATERDEFAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHDSVEEAWLCDIDEAVIRLSKEYLPEMAASYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLFQKEYFQLLNSALTEKGVITTQAESMWIHLPIIKDLKKACSEVFPVAEYSFVTIPTYPTGTIGFMVCSKDKTCNVKKPLREISDEKEAELYRYYNKKIHEASFVLP 285          
BLAST of Spermidine synthase vs. UniProt/SwissProt
Match: sp|Q09741|SPEE_SCHPO (Spermidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC12C2.07c PE=3 SV=1)

HSP 1 Score: 295.819 bits (756), Expect = 1.112e-97
Identity = 133/275 (48.36%), Postives = 200/275 (72.73%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDK--LRHYTPEVHRASFALP 862
            I + WF E ++ W GQAM+LKVK+++ +  +K+QD+L+FES  +G VLVLDG IQ TE+DEF YQEMI+ L LNSHPNP+ VL+IGGGDGGV+R+V KH  V++ + C+IDE+V+ +SK++L  M+ G++  K  + I DGF+FL+ ++N FDVIITDS+DP GP E LFQ  YFQL+ ++L+  G++ +Q + +W+ L +I N+L   K++FP V+YA  ++PTY +G IG+V+ SK+ + +  +P+    P ++    ++Y  E+H ASF LP
Sbjct:   11 IKDGWFREINNMWPGQAMTLKVKKVLYAGKSKYQDVLVFESETYGHVLVLDGAIQATERDEFSYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHECVEEAILCDIDEDVIKVSKQYLPEMSAGFNHPKVKVHIGDGFKFLQDYQNTFDVIITDSSDPDGPAEALFQKPYFQLLSDALRGGGVITTQAECMWIHLGVISNVLTAVKTVFPNVRYAYTTIPTYPSGSIGFVVASKDASIDLSKPLRKWSPEEENKLCKYYNSEIHAASFVLP 285          
BLAST of Spermidine synthase vs. TrEMBL
Match: A0A5E4BG91 (PABS domain-containing protein OS=Marmota monax OX=9995 GN=MONAX_5E034667 PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 3.577e-113
Identity = 157/276 (56.88%), Postives = 208/276 (75.36%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDK---LRHYTPEVHRASFALP 862
            I   WF E    W GQA+SL+V++++  + +++QD+L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+ +SKK L  MAVGY S K  L + DGFEF+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +LK DGI+C QG+  WL LD+IK + + CKS+FPVV YA  S+PTY +GQIG++LCSKN +TNF+EP     P Q +   LR+Y  +VHRA+F LP
Sbjct:   11 IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPSMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVAYAYCSIPTYPSGQIGFMLCSKNPSTNFREPARPLSPAQVEHMALRYYNADVHRAAFVLP 286          
BLAST of Spermidine synthase vs. TrEMBL
Match: I3MZT0 (Spermidine synthase OS=Ictidomys tridecemlineatus OX=43179 GN=SRM PE=3 SV=1)

HSP 1 Score: 341.273 bits (874), Expect = 3.577e-113
Identity = 157/276 (56.88%), Postives = 208/276 (75.36%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDK---LRHYTPEVHRASFALP 862
            I   WF E    W GQA+SL+V++++  + +++QD+L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+ +SKK L  MAVGY S K  L + DGFEF+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +LK DGI+C QG+  WL LD+IK + + CKS+FPVV YA  S+PTY +GQIG++LCSKN +TNF+EP     P Q +   LR+Y  +VHRA+F LP
Sbjct:   11 IREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPSMAVGYSSSKLTLHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVAYAYCSIPTYPSGQIGFMLCSKNPSTNFREPARPLSPAQVEHMALRYYNADVHRAAFVLP 286          
BLAST of Spermidine synthase vs. TrEMBL
Match: H0VMU1 (Spermidine synthase OS=Cavia porcellus OX=10141 GN=SRM PE=3 SV=2)

HSP 1 Score: 340.887 bits (873), Expect = 5.392e-113
Identity = 154/276 (55.80%), Postives = 210/276 (76.09%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPF---QDKLRHYTPEVHRASFALP 862
            I   WF E    W GQA+SL+V++++  + +++QD+L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHPNP+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+ +SKK L  MAVGY S K  L + DGFEF+KQ+++ FD+IITDS+DP GP E LF+ +Y+QL+  +LK DG++C QG+  WL LD+IK++ + C+S+FPVV YA  ++PTY +GQIG++LCSKN NTNF+EP++        Q +LR+Y  EVHRA+F LP
Sbjct:   16 IREGWFRETCSLWPGQALSLQVEQLLHHQRSRYQDILVFRSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPSMAVGYSSPKLTLHVGDGFEFMKQNRDAFDIIITDSSDPVGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKSMRQFCRSLFPVVSYAYCTIPTYPSGQIGFMLCSKNPNTNFREPVQQLTQAQVEQRQLRYYNAEVHRAAFVLP 291          
BLAST of Spermidine synthase vs. TrEMBL
Match: Q4RVM5 (Chromosome 9 SCAF14991, whole genome shotgun sequence OS=Tetraodon nigroviridis OX=99883 GN=GSTENG00028264001 PE=3 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 2.183e-112
Identity = 163/284 (57.39%), Postives = 212/284 (74.65%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEP--------IETNLPFQDKLRHYTPEVHRASFALP 862
            M++I   WF E S  W GQAMSL+VKE++ +K +KFQD+L+F S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHP+P+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+N+SKK L  MA G+ S K  L + DGFEF+KQ+ N FDVIITDS+DP GP E LF+ +YFQL+  +L+  GI+CSQG+  WL L++IK +   CK++FPVV+YA  ++PTY +GQIG++LCSK+  TNFKEP        IET       L++Y PE+HRASF LP
Sbjct:    1 MDHIKEGWFMEKSALWPGQAMSLRVKEVLYNKKSKFQDVLLFASETYGNVLVLDGVIQCTERDEFAYQEMIANLPLCSHPSPKKVLIIGGGDGGVLREVVKHPLVESVVQCEIDEDVINVSKKFLPGMAKGFFSPKLTLHVGDGFEFMKQNNNAFDVIITDSSDPVGPAESLFKESYFQLMKSALRDGGILCSQGECQWLHLELIKEMRIFCKTLFPVVEYAYSTIPTYPSGQIGFMLCSKDPKTNFKEPAKALSKEEIETM-----DLKYYNPEIHRASFILP 279          
BLAST of Spermidine synthase vs. TrEMBL
Match: A0A218UHP3 (Spermidine synthase OS=Lonchura striata domestica OX=299123 GN=SRM PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 4.875e-112
Identity = 154/276 (55.80%), Postives = 210/276 (76.09%), Query Frame = 2
Query:   44 IINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQ---DKLRHYTPEVHRASFALP 862
            I   WF E    W GQAMSL+V+E++  + +++Q++L+F ST +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHP+P+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+ +SKK+L  MAVGY S K  L + DGFEF+KQ++  FDVIITDS+DP GP E LF+ +Y+QL+  +L+ DGI+C QG+  WL LD+IK + + CKS+FPVV+YA  ++PTY +GQIG++LCSKN NTNF+EP++     Q     L++Y  ++HRA+F LP
Sbjct:    9 IREGWFRETCRLWPGQAMSLQVEELLHHQRSRYQEILVFRSTTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPDPRKVLIIGGGDGGVLREVVKHPTVESVVQCEIDEDVIQVSKKYLPGMAVGYSSAKLTLHVGDGFEFMKQNQEAFDVIITDSSDPMGPAESLFKESYYQLMKTALREDGILCCQGECQWLHLDLIKEMRQFCKSLFPVVEYAYCTIPTYPSGQIGFMLCSKNPNTNFREPVQQLSQQQVEERSLKYYNSDIHRAAFILP 284          
BLAST of Spermidine synthase vs. Ensembl Cavefish
Match: srm (spermidine synthase [Source:ZFIN;Acc:ZDB-GENE-040426-1183])

HSP 1 Score: 333.569 bits (854), Expect = 2.019e-113
Identity = 156/280 (55.71%), Postives = 211/280 (75.36%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQD----KLRHYTPEVHRASFALP 862
            M+ I   WFTE    W GQAMSL+V+E++  K ++FQD+++F+S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHP P+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDE+V+N+SKK+L  MA G+ S K  L + DGFEF+KQ+++ FDVIITDS+DP GP E LF+ +Y+QL+  +L+  GI+C QG+  WL L++IK +   CK++FPVV YA  ++PTY +GQIG++LCSKN  TNF+EP+  +L   D     L++Y PE+HRASF LP
Sbjct:    1 MDRIKEGWFTETCTLWPGQAMSLQVEEVLYHKKSQFQDVMVFKSKTYGNVLVLDGVIQCTERDEFSYQEMIANLPLCSHPCPKKVLIIGGGDGGVLREVVKHPVVESVVQCEIDEDVINVSKKYLPGMAKGFFSPKLTLNVGDGFEFMKQNQDAFDVIITDSSDPVGPAESLFKESYYQLMKTALRDGGILCCQGECQWLHLELIKEMRTFCKTLFPVVDYAYCTIPTYPSGQIGFMLCSKNSQTNFREPVR-DLSRDDIESMSLKYYNPEIHRASFILP 279          
BLAST of Spermidine synthase vs. Ensembl Sea Lamprey
Match: srm (spermidine synthase [Source:ZFIN;Acc:ZDB-GENE-040426-1183])

HSP 1 Score: 283.493 bits (724), Expect = 3.225e-95
Identity = 133/243 (54.73%), Postives = 180/243 (74.07%), Query Frame = 2
Query:  143 QDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIE--TNLP-FQDKLRHYTPEVHRASFALP 862
            Q  ++  S ++G VLVLDG IQ TE+DEF YQEMI++LPLNSHP+P+ VLIIGGGDGGV+R+V KH  V+ +VQCEIDEEV+ +SK+ L  M++G+ S K  L + DGF+F+K++K+ FDVIITDS+DP GP E LFQ +YFQL+  +LK  GI+C+QG+  W+ L +IK +   C+S+FP V YA  ++PTY  GQIG+ LCSKN++T F+ P+   TN      KLR+Y   +HRA+F LP
Sbjct:    1 QSCVVALSKSYGTVLVLDGCIQCTERDEFAYQEMIALLPLNSHPDPKRVLIIGGGDGGVLREVIKHPAVESVVQCEIDEEVIEVSKRFLPGMSLGFASPKLSLHVGDGFKFMKENKDSFDVIITDSSDPIGPAESLFQESYFQLMKTALKEGGILCTQGECQWIHLPLIKKVTGFCRSLFPTVAYAYCTIPTYPCGQIGFTLCSKNKDTCFRNPLREFTNEEVVAMKLRYYNSTMHRAAFVLP 243          
BLAST of Spermidine synthase vs. Ensembl Yeast
Match: SPE3 (Spermidine synthase; involved in biosynthesis of spermidine and also in biosynthesis of pantothenic acid; spermidine is required for growth of wild-type cells [Source:SGD;Acc:S000006273])

HSP 1 Score: 302.368 bits (773), Expect = 3.463e-102
Identity = 138/276 (50.00%), Postives = 198/276 (71.74%), Query Frame = 2
Query:   44 IINDWFTEYSDG-WAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIE--TNLPFQDKLRHYTPEVHRASFALP 862
            I++ WF E SD  W GQAM+LKV++++  + +K+QD+LIF+ST +G VLVLD +IQ TE+DEF YQEMI+ L LNSHPNP+ VL+IGGGDGGV+R+V KH  V++   C+IDE V+ LSK++L  MA  Y   K    I DGF+FL+ ++N FDVIITDS+DP+GP E LFQ  YFQL+  +L   G++ +Q +++W+ L IIK+L K C  +FPV +Y+  ++PTY  G IG+++CSK++  N K+P+   ++    +  R+Y  ++H ASF LP
Sbjct:   10 IVDGWFREISDTMWPGQAMTLKVEKVLHHEKSKYQDVLIFKSTTYGNVLVLDNVIQATERDEFAYQEMIAHLALNSHPNPKKVLVIGGGDGGVLREVVKHDSVEEAWLCDIDEAVIRLSKEYLPEMAASYSHPKVKTHIGDGFQFLRDYQNTFDVIITDSSDPEGPAETLFQKEYFQLLNSALTEKGVITTQAESMWIHLPIIKDLKKACSEVFPVAEYSFVTIPTYPTGTIGFMVCSKDKTCNVKKPLREISDEKEAELYRYYNKKIHEASFVLP 285          
BLAST of Spermidine synthase vs. Ensembl Yeast
Match: SPE4 (Spermine synthase; required for the biosynthesis of spermine and also involved in biosynthesis of pantothenic acid [Source:SGD;Acc:S000004136])

HSP 1 Score: 246.899 bits (629), Expect = 1.979e-80
Identity = 128/284 (45.07%), Postives = 185/284 (65.14%), Query Frame = 2
Query:   41 YIINDWFTEYSD-GWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVG-YDSDKAILTISDGFEFLKQ------HKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQ-GQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEP-IETNLPFQDKLRHYTPEVHRASFALP 862
            YI + WF E +D  + GQA ++ V  I+    ++FQD+LIF +  +G VLVLDGI+Q TE DEF YQEMI+ + + +H NP+ VLIIGGGDGGV+R+VAKH  V+ I   EID  V+ LS+K L  ++ G +D ++  L + DGF+FL+       HK +FDVIITDS+DP+GP E  FQ  YF+L+ ++L  +G++  Q  +N WL L  + +L  T K +FP  +Y    VPTYT+GQ+G ++CS N N     P  + +   Q KL++Y P++H ++F LP
Sbjct:    9 YIKDGWFREINDKSFPGQAFTMTVDSILYEARSEFQDILIFRNKVYGTVLVLDGIVQCTEFDEFAYQEMITHIAMFAHSNPKRVLIIGGGDGGVLREVAKHSCVEDITMVEIDSSVIELSRKFLPTLSNGAFDDERLDLKLCDGFKFLQDIGASDVHK-KFDVIITDSSDPEGPAEAFFQERYFELLKDALNPNGVVIMQSSENFWLNLKYLHDLKNTAKKVFPNTEYCYTMVPTYTSGQLGLIVCSNNANIPLNIPQRKISEQEQGKLKYYNPQIHSSAFVLP 291          
BLAST of Spermidine synthase vs. Ensembl Nematostella
Match: EDO42360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1R0])

HSP 1 Score: 313.923 bits (803), Expect = 1.945e-106
Identity = 152/279 (54.48%), Postives = 214/279 (76.70%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEP--IETNLPFQD-KLRHYTPEVHRASFALP 862
            M+ I N WF+E +  W GQAMS++V+E+I    +KFQ++L+F+S + G VLVLDG+IQ T++DEF YQEMISMLPLNSHPNP+ VL+IGGGDGGV+R+ +KH  V+ IVQCEIDE+V+N+SKK+L  MAVGY S K    I DGFE++K H+NEFDVIITDS+DP GP E LFQ +Y++L+  +LK DG++C QG+  W+ L +IK++++ CK++F VV Y   ++PTY  GQIG++LCSK++NT F+ P  + ++   +D   R+Y  ++H+A+F LP
Sbjct:    1 MDRIHNGWFSEINKQWPGQAMSIEVEEVIYEGKSKFQEILVFKSKSFGTVLVLDGVIQCTDRDEFSYQEMISMLPLNSHPNPKKVLVIGGGDGGVIREASKHPSVESIVQCEIDEDVINISKKYLPNMAVGYTSPKLTQHIGDGFEYMKNHENEFDVIITDSSDPVGPAEALFQQSYYELMKRALKPDGLLCCQGECQWIHLPLIKSMVEFCKTLFSVVSYGYTTIPTYPCGQIGFMLCSKDKNTRFENPKIVLSDQQVEDLGFRYYNSDIHKAAFVLP 279          
BLAST of Spermidine synthase vs. Ensembl Nematostella
Match: EDO25680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVS9])

HSP 1 Score: 116.316 bits (290), Expect = 2.071e-31
Identity = 67/150 (44.67%), Postives = 103/150 (68.67%), Query Frame = 2
Query:   98 SLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVG-YDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGE 544
            S ++ E++  + T    L+IF +   G V+ LDGIIQ TE+DEF+Y EM++  PL +H   + VLIIGGGDGG++R+V KH +V+ + Q EID+ V+++ K +L   + G +D  +A + I+DG E++ +  ++FDVII+D TDP GPGE
Sbjct:   15 SFEIGEVLFEQQTDSWHLIIFRNEEFGTVMALDGIIQTTERDEFIYHEMLTHTPLFAHGAAKRVLIIGGGDGGILREVLKHPEVEHVTQVEIDQSVIDMCKTYLPNHSNGAFDDPRANIVIADGIEYVCETXDKFDVIISDCTDPVGPGE 164          
BLAST of Spermidine synthase vs. Ensembl Medaka
Match: srm (spermidine synthase [Source:NCBI gene;Acc:101173057])

HSP 1 Score: 332.798 bits (852), Expect = 2.134e-113
Identity = 155/280 (55.36%), Postives = 215/280 (76.79%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQD----KLRHYTPEVHRASFALP 862
            M++I + WFTE    W GQAMSL+V+E++ +K +KFQD+++F+S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHP P+ VL+IGGGDGGV+R+V KH  V+ +V CEIDE+V+N+SKK L  MA G+ S K  L + DGFEF+KQ+++ FD+IITDS+DP GP E LF+ +Y+QL+  +L+S GI+CSQG+  WL L++IK +   CK++FPVV YA G++PTY +GQIGY+LCSKN  TNF+EP++  L  ++     L++Y  E+H+ASF LP
Sbjct:    1 MDHIKDGWFTESCALWPGQAMSLQVEEVLYNKKSKFQDVMVFKSKTYGNVLVLDGVIQCTERDEFAYQEMIANLPLCSHPCPKKVLVIGGGDGGVLREVVKHPLVESVVLCEIDEDVINVSKKFLPGMAKGFFSPKLTLHVGDGFEFMKQNQDAFDIIITDSSDPVGPAESLFKESYYQLMKAALRSGGILCSQGECQWLHLELIKEMRTFCKTLFPVVDYAYGTIPTYPSGQIGYMLCSKNPETNFREPVKA-LSKEEMETMNLQYYNTEIHKASFVLP 279          
BLAST of Spermidine synthase vs. Ensembl Medaka
Match: srm (spermidine synthase [Source:NCBI gene;Acc:101173057])

HSP 1 Score: 332.798 bits (852), Expect = 2.920e-113
Identity = 155/280 (55.36%), Postives = 215/280 (76.79%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQD----KLRHYTPEVHRASFALP 862
            M++I + WFTE    W GQAMSL+V+E++ +K +KFQD+++F+S  +G VLVLDG+IQ TE+DEF YQEMI+ LPL SHP P+ VL+IGGGDGGV+R+V KH  V+ +V CEIDE+V+N+SKK L  MA G+ S K  L + DGFEF+KQ+++ FD+IITDS+DP GP E LF+ +Y+QL+  +L+S GI+CSQG+  WL L++IK +   CK++FPVV YA G++PTY +GQIGY+LCSKN  TNF+EP++  L  ++     L++Y  E+H+ASF LP
Sbjct:    1 MDHIKDGWFTESCALWPGQAMSLQVEEVLYNKKSKFQDVMVFKSKTYGNVLVLDGVIQCTERDEFAYQEMIANLPLCSHPCPKKVLVIGGGDGGVLREVVKHPLVESVVLCEIDEDVINVSKKFLPGMAKGFFSPKLTLHVGDGFEFMKQNQDAFDIIITDSSDPVGPAESLFKESYYQLMKAALRSGGILCSQGECQWLHLELIKEMRTFCKTLFPVVDYAYGTIPTYPSGQIGYMLCSKNPETNFREPVKA-LSKEEMETMNLQYYNTEIHKASFVLP 279          
BLAST of Spermidine synthase vs. Planmine SMEST
Match: SMESG000031473.1 (SMESG000031473.1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 278/278 (100.00%), Postives = 278/278 (100.00%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRASFALPYC 868
            MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRASFALPYC
Sbjct:    1 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRASFALPYC 278          
BLAST of Spermidine synthase vs. Planmine SMEST
Match: SMESG000031473.1 (SMESG000031473.1)

HSP 1 Score: 561.992 bits (1447), Expect = 0.000e+0
Identity = 278/311 (89.39%), Postives = 278/311 (89.39%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCS---------------------------------QGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRASFALPYC 868
            MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCS                                 QGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRASFALPYC
Sbjct:    1 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQVQLPIILELFSIALSRFRNPNQVQGNILPTSHQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRASFALPYC 311          
BLAST of Spermidine synthase vs. Planmine SMEST
Match: SMESG000078476.1 (SMESG000078476.1)

HSP 1 Score: 333.183 bits (853), Expect = 1.141e-113
Identity = 156/278 (56.12%), Postives = 205/278 (73.74%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRASFALPYC 868
            M+ I   WF+E SD   G ++SLKVKEI+    TK+Q LLIFES+NHG+V+VLDG+IQLTE+DEF+YQEMI+MLPL  H NP+ VLIIGGGDGGV R+V KH  V++IVQCE+DE+VV +SKK+L F A  Y ++K  L I DG E++    ++FD+IITDSTDP GP   LF+ NYF+ I  +LK  GIMCSQG+++WL   +++ L+   + +FPVV+Y+ GSVPTY  GQIGY+LCSKN   +F +PI      QD+ R+Y+ E+H ASF LP C
Sbjct:    1 MDLIKKGWFSEISDFIPGHSLSLKVKEILCCMQTKYQQLLIFESSNHGRVMVLDGMIQLTERDEFMYQEMIAMLPLMCHSNPEQVLIIGGGDGGVAREVLKHPNVQRIVQCELDEDVVEMSKKYLPFTAKSYSNEKVSLIIGDGVEYMLNCASKFDIIITDSTDPIGPASQLFEINYFEQIKNALKPGGIMCSQGESLWLARSVVEELVAKARKVFPVVKYSYGSVPTYPLGQIGYLLCSKNEKIDFCKPIYDVSTIQDQFRYYSKEIHTASFVLPNC 278          
BLAST of Spermidine synthase vs. Planmine SMEST
Match: SMESG000078476.1 (SMESG000078476.1)

HSP 1 Score: 332.798 bits (852), Expect = 1.916e-113
Identity = 156/278 (56.12%), Postives = 205/278 (73.74%), Query Frame = 2
Query:   35 MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKVLVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVAKHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQHKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWLELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEPIETNLPFQDKLRHYTPEVHRASFALPYC 868
            M+ I   WF+E SD   G ++SLKVKEI+    TK+Q LLIFES+NHG+V+VLDG+IQLTE+DEF+YQEMI+MLPL  H NP+ VLIIGGGDGGV R+V KH  V++IVQCE+DE+VV +SKK+L F A  Y ++K  L I DG E++    ++FD+IITDSTDP GP   LF+ NYF+ I  +LK  GIMCSQG+++WL   +++ L+   + +FPVV+Y+ GSVPTY  GQIGY+LCSKN   +F +PI      QD+ R+Y+ E+H ASF LP C
Sbjct:    1 MDLIKKGWFSEISDFIPGHSLSLKVKEILCCMQTKYQQLLIFESSNHGRVMVLDGMIQLTERDEFMYQEMIAMLPLMCHSNPEQVLIIGGGDGGVAREVLKHPNVQRIVQCELDEDVVEMSKKYLPFTAKSYSNEKVSLIIGDGVEYMLNCASKFDIIITDSTDPIGPASQLFEINYFEQIKNALKPGGIMCSQGESLWLARSVVEELVAKARKVFPVVKYSYGSVPTYPLGQIGYLLCSKNEKIDFCKPIYDVSTIQDQFRYYSKEIHTASFVLPNC 278          
The following BLAST results are available for this feature:
BLAST of Spermidine synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SRM1.623e-11354.71spermidine synthase [Source:HGNC Symbol;Acc:HGNC:1... [more]
SRM1.489e-3761.39spermidine synthase [Source:HGNC Symbol;Acc:HGNC:1... [more]
SRM8.620e-3244.36spermidine synthase [Source:HGNC Symbol;Acc:HGNC:1... [more]
SRM4.243e-948.98spermidine synthase [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of Spermidine synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
spds-15.464e-9148.37SPermiDine Synthase [Source:UniProtKB/TrEMBL;Acc:... [more]
spds-15.464e-9148.37SPermiDine Synthase [Source:UniProtKB/TrEMBL;Acc:... [more]
spds-11.066e-8546.98SPermiDine Synthase [Source:UniProtKB/TrEMBL;Acc:... [more]
spds-11.066e-8546.98SPermiDine Synthase [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Spermidine synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SpdS6.472e-10253.24gene:FBgn0037723 transcript:FBtr0082078[more]
SpdS6.472e-10253.24gene:FBgn0037723 transcript:FBtr0306007[more]
SpdS5.966e-7453.85gene:FBgn0037723 transcript:FBtr0082079[more]
Sms4.759e-827.32gene:FBgn0036272 transcript:FBtr0076010[more]
Sms5.128e-827.32gene:FBgn0036272 transcript:FBtr0076009[more]
back to top
BLAST of Spermidine synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
srm1.456e-11054.12spermidine synthase [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
back to top
BLAST of Spermidine synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hypk1.242e-11256.20huntingtin interacting protein K [Source:Xenbase;A... [more]
hypk2.126e-11256.20huntingtin interacting protein K [Source:Xenbase;A... [more]
back to top
BLAST of Spermidine synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Srm2.006e-11355.43spermidine synthase [Source:MGI Symbol;Acc:MGI:102... [more]
back to top
BLAST of Spermidine synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19623|SPEE_HUMAN7.792e-11354.71Spermidine synthase OS=Homo sapiens OX=9606 GN=SRM... [more]
sp|Q64674|SPEE_MOUSE1.404e-11255.43Spermidine synthase OS=Mus musculus OX=10090 GN=Sr... [more]
sp|Q9Y8H7|SPEE_NEUCR1.718e-10251.64Spermidine synthase OS=Neurospora crassa (strain A... [more]
sp|Q12074|SPEE_YEAST2.405e-10050.00Spermidine synthase OS=Saccharomyces cerevisiae (s... [more]
sp|Q09741|SPEE_SCHPO1.112e-9748.36Spermidine synthase OS=Schizosaccharomyces pombe (... [more]
back to top
BLAST of Spermidine synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5E4BG913.577e-11356.88PABS domain-containing protein OS=Marmota monax OX... [more]
I3MZT03.577e-11356.88Spermidine synthase OS=Ictidomys tridecemlineatus ... [more]
H0VMU15.392e-11355.80Spermidine synthase OS=Cavia porcellus OX=10141 GN... [more]
Q4RVM52.183e-11257.39Chromosome 9 SCAF14991, whole genome shotgun seque... [more]
A0A218UHP34.875e-11255.80Spermidine synthase OS=Lonchura striata domestica ... [more]
back to top
BLAST of Spermidine synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
srm2.019e-11355.71spermidine synthase [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
back to top
BLAST of Spermidine synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
srm3.225e-9554.73spermidine synthase [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
back to top
BLAST of Spermidine synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SPE33.463e-10250.00Spermidine synthase; involved in biosynthesis of s... [more]
SPE41.979e-8045.07Spermine synthase; required for the biosynthesis o... [more]
back to top
BLAST of Spermidine synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO423601.945e-10654.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO256802.071e-3144.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of Spermidine synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
srm2.134e-11355.36spermidine synthase [Source:NCBI gene;Acc:10117305... [more]
srm2.920e-11355.36spermidine synthase [Source:NCBI gene;Acc:10117305... [more]
back to top
BLAST of Spermidine synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000031473.10.000e+0100.00SMESG000031473.1[more]
SMESG000031473.10.000e+089.39SMESG000031473.1[more]
SMESG000078476.11.141e-11356.12SMESG000078476.1[more]
SMESG000078476.11.916e-11356.12SMESG000078476.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026524 ID=SMED30026524|Name=Spermidine synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1129bp
ATATATAATTTTATTATTTTAATAATAATTGATTATGAATTATATTATCA
ATGATTGGTTCACTGAATATTCCGATGGATGGGCTGGACAAGCTATGAGT
CTGAAAGTAAAAGAAATCATAGAAAGTAAAACCACCAAATTCCAGGATTT
ATTAATTTTTGAAAGCACAAATCATGGAAAAGTTCTAGTATTAGATGGCA
TTATTCAATTAACAGAAAAAGATGAATTTTTATATCAGGAAATGATATCA
ATGTTGCCGCTGAATTCTCATCCAAATCCCCAAAATGTATTAATAATCGG
TGGTGGTGACGGCGGAGTAATGCGCGATGTAGCTAAGCATCATAAAGTTA
AAAAAATTGTCCAATGTGAAATCGACGAAGAAGTCGTTAATTTGAGTAAG
AAACATTTGTCATTCATGGCAGTTGGATATGATAGTGACAAAGCAATTTT
GACAATTTCTGACGGTTTCGAATTTCTCAAACAACACAAAAATGAATTTG
ATGTCATCATAACTGACAGTACTGACCCGCAAGGCCCAGGTGAAGTCCTT
TTTCAATCGAATTATTTTCAGCTGATTTTCGAATCTCTGAAATCCGATGG
AATTATGTGTTCTCAAGGTCAAAATATTTGGTTGGAACTAGATATTATTA
AAAATCTTCTGAAAACATGTAAATCCATTTTTCCTGTAGTTCAGTATGCT
AATGGTTCGGTTCCTACTTATACAAATGGTCAAATCGGATATGTCTTATG
CAGTAAAAATCGAAATACAAATTTCAAAGAGCCCATTGAAACAAACTTGC
CATTTCAAGATAAATTAAGGCATTACACGCCCGAAGTCCATAGAGCCTCA
TTTGCACTGCCATATTGCATTAAAAAAGAGTTGGAACTAATTATTGAATA
GTTTTTATTTATTTATATTTAAAGTTTAATAAAGTTCTCATGAAATGTTG
TTTGACCATTGAATGCGGGATTTTTATTATTTTTTTATATTAGATAAACA
ATTTTCTATAAATAATTTTGCCGGTCTTAGAATTCATTTAGATAAAAGGA
TTTGAATTTGTTTACAATTATCTATTTGTGATTATTAATTGACATATTTT
TCGGGTAAATCGATTAATTATAAATTGCA
back to top

protein sequence of SMED30026524-orf-1

>SMED30026524-orf-1 ID=SMED30026524-orf-1|Name=SMED30026524-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=289bp
MNYIINDWFTEYSDGWAGQAMSLKVKEIIESKTTKFQDLLIFESTNHGKV
LVLDGIIQLTEKDEFLYQEMISMLPLNSHPNPQNVLIIGGGDGGVMRDVA
KHHKVKKIVQCEIDEEVVNLSKKHLSFMAVGYDSDKAILTISDGFEFLKQ
HKNEFDVIITDSTDPQGPGEVLFQSNYFQLIFESLKSDGIMCSQGQNIWL
ELDIIKNLLKTCKSIFPVVQYANGSVPTYTNGQIGYVLCSKNRNTNFKEP
IETNLPFQDKLRHYTPEVHRASFALPYCIKKELELIIE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001045Spermi_synthase
IPR035246Spermidine_synt_N
IPR037163Spermidine_synt_N_sf
IPR029063SAM-dependent_MTases
IPR030374PABS
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0004766spermidine synthase activity
GO:0016740transferase activity
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
Vocabulary: biological process
TermDefinition
GO:0006595polyamine metabolic process
GO:0006596polyamine biosynthetic process
GO:0008295spermidine biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 280..288
NoneNo IPR availablePFAMPF01564Spermine_synthcoord: 64..248
e-value: 2.4E-61
score: 206.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 61..286
e-value: 8.4E-71
score: 240.1
NoneNo IPR availablePANTHERPTHR11558SPERMIDINE/SPERMINE SYNTHASEcoord: 1..284
NoneNo IPR availableCDDcd02440AdoMet_MTasescoord: 84..194
e-value: 1.33862E-8
score: 49.7359
IPR001045Spermidine/spermine synthasesTIGRFAMTIGR00417TIGR00417coord: 8..276
e-value: 1.6E-101
score: 337.1
IPR035246Spermidine synthase, tetramerisation domainPFAMPF17284Spermine_synt_Ncoord: 8..61
e-value: 8.2E-18
score: 64.0
IPR037163Spermidine synthase, tetramerisation domain superfamilyGENE3DG3DSA:2.30.140.10coord: 5..60
e-value: 8.7E-25
score: 88.6
IPR030374Polyamine biosynthesis domainPROSITEPS51006PABS_2coord: 6..241
score: 86.807
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 5..283