FYVE-type domain-containing protein

Overview
NameFYVE-type domain-containing protein
Smed IDSMED30026522
Uniprot Best hitPH, RCC1 and FYVE domains-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PRAF1 PE=1 SV=1 (E=5.31414e-21)
Length (bp)2116
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FYVE-type domain-containing protein (SMED30026522) t-SNE clustered cells

Violin plots show distribution of expression levels for FYVE-type domain-containing protein (SMED30026522) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FYVE-type domain-containing protein (SMED30026522) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FYVE-type domain-containing protein (SMED30026522) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026522

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30026522SMESG000064746.1 dd_Smed_v4_16647_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026522SMESG000064746.1 dd_Smed_v4_16647_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FYVE-type domain-containing protein vs. Ensembl Human
Match: HERC4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:HGNC Symbol;Acc:HGNC:24521])

HSP 1 Score: 94.7449 bits (234), Expect = 2.793e-19
Identity = 80/282 (28.37%), Postives = 122/282 (43.26%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G           I         K +F  +  ++++ CG   T+F        T  CN + + G       P   + L   A +I  +SCG+ H + L   GQV  +G +  GQ+G     L  S E +  PR + S    +++++A G YH+L L + +++FCWG   YG L  G        P  +  +   P + +  G  HS  LT S  IF  G N FGQ   N        P  +K     K+  I C   ++AA T++  V+ +G
Sbjct:    4 WGNASFGQLGLG----------GIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALD--AQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLG-----LVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND-RYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 75.0998 bits (183), Expect = 2.839e-13
Identity = 77/342 (22.51%), Postives = 148/342 (43.27%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCC-NHYSAAKTEKDEVYMWG 1135
            +  WG+    Q  L   ++ I ++   ++   I++ ++ + CG  H+V +  +G VY  G N+  QLG   ++  KP ++               +D+  I  +SCG   T+       +  +G      +G       + +P    S+S     +++CG  H + L  + +V C+G+N YGQ+G     L +  +  ++P+++ S      +++A G  H+  L     IF WG     G +  +     ++P +      + I+ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + VT I C   H SA       +Y +G
Sbjct:    1 MLCWGNASFGQLGLGGIDEEIVLE-PRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR-KKPEQVVA-------------LDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLG-----LGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRN-KFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEIN-PRKVFELMGSIVTEIACGRQHTSAFVPSSGRIYSFG 320          
BLAST of FYVE-type domain-containing protein vs. Ensembl Human
Match: HERC4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:HGNC Symbol;Acc:HGNC:24521])

HSP 1 Score: 94.3597 bits (233), Expect = 3.108e-19
Identity = 80/282 (28.37%), Postives = 122/282 (43.26%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G           I         K +F  +  ++++ CG   T+F        T  CN + + G       P   + L   A +I  +SCG+ H + L   GQV  +G +  GQ+G     L  S E +  PR + S    +++++A G YH+L L + +++FCWG   YG L  G        P  +  +   P + +  G  HS  LT S  IF  G N FGQ   N        P  +K     K+  I C   ++AA T++  V+ +G
Sbjct:    4 WGNASFGQLGLG----------GIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALD--AQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLG-----LVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND-RYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 75.0998 bits (183), Expect = 2.933e-13
Identity = 77/342 (22.51%), Postives = 148/342 (43.27%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCC-NHYSAAKTEKDEVYMWG 1135
            +  WG+    Q  L   ++ I ++   ++   I++ ++ + CG  H+V +  +G VY  G N+  QLG   ++  KP ++               +D+  I  +SCG   T+       +  +G      +G       + +P    S+S     +++CG  H + L  + +V C+G+N YGQ+G     L +  +  ++P+++ S      +++A G  H+  L     IF WG     G +  +     ++P +      + I+ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + VT I C   H SA       +Y +G
Sbjct:    1 MLCWGNASFGQLGLGGIDEEIVLE-PRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR-KKPEQVVA-------------LDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLG-----LGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRN-KFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEIN-PRKVFELMGSIVTEIACGRQHTSAFVPSSGRIYSFG 320          
BLAST of FYVE-type domain-containing protein vs. Ensembl Human
Match: HERC4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:HGNC Symbol;Acc:HGNC:24521])

HSP 1 Score: 94.3597 bits (233), Expect = 3.176e-19
Identity = 80/282 (28.37%), Postives = 122/282 (43.26%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G           I         K +F  +  ++++ CG   T+F        T  CN + + G       P   + L   A +I  +SCG+ H + L   GQV  +G +  GQ+G     L  S E +  PR + S    +++++A G YH+L L + +++FCWG   YG L  G        P  +  +   P + +  G  HS  LT S  IF  G N FGQ   N        P  +K     K+  I C   ++AA T++  V+ +G
Sbjct:    4 WGNASFGQLGLG----------GIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALD--AQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLG-----LVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND-RYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 75.0998 bits (183), Expect = 3.052e-13
Identity = 77/342 (22.51%), Postives = 148/342 (43.27%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN-HYSAAKTEKDEVYMWG 1135
            +  WG+    Q  L   ++ I ++   ++   I++ ++ + CG  H+V +  +G VY  G N+  QLG   ++  KP ++               +D+  I  +SCG   T+       +  +G      +G       + +P    S+S     +++CG  H + L  + +V C+G+N YGQ+G     L +  +  ++P+++ S      +++A G  H+  L     IF WG     G +  +     ++P +      + I+ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + VT I C   H SA       +Y +G
Sbjct:    1 MLCWGNASFGQLGLGGIDEEIVLE-PRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR-KKPEQVVA-------------LDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLG-----LGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRN-KFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEIN-PRKVFELMGSIVTEIACGRQHTSAFVPSSGRIYSFG 320          
BLAST of FYVE-type domain-containing protein vs. Ensembl Human
Match: HERC4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:HGNC Symbol;Acc:HGNC:24521])

HSP 1 Score: 89.7373 bits (221), Expect = 2.170e-18
Identity = 72/249 (28.92%), Postives = 113/249 (45.38%), Query Frame = 2
Query:  428 KLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            K +F  +  ++++ CG   T+F        T  CN + + G       P   + L   A +I  +SCG+ H + L   GQV  +G +  GQ+G     L  S E +  PR + S    +++++A G YH+L L + +++FCWG   YG L  G        P  +  +   P + +  G  HS  LT S  IF  G N FGQ   N        P  +K     K+  I C   ++AA T++  V+ +G
Sbjct:   24 KSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALD--AQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLG-----LVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDENDRY-VPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFG 264          

HSP 2 Score: 74.3294 bits (181), Expect = 2.137e-13
Identity = 81/355 (22.82%), Postives = 151/355 (42.54%), Query Frame = 2
Query:  251 IDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN-HYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINNMISDNYGINSLQFGSWHVV 1270
            I++ ++ + CG  H+V +  +G VY  G N+  QLG   ++              K   ++  +D+  I  +SCG   T+       +  +G      +G       + +P    S+S     +++CG  H + L  + +V C+G+N YGQ+G     L +  +  ++P+++ S      +++A G  H+  L     IF WG     G +  +     ++P +      + I+ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + VT I C   H SA       +Y +G   +       TS+  K PF +  N    +   +  ++  S HVV
Sbjct:   29 INKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR--------------KKPEQVVALDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLG-----LGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRN-KFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEIN-PRKVFELMGSIVTEIACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSN-RKSPFTVKGNWYPYNGQCLPDIEARSCHVV 361          
BLAST of FYVE-type domain-containing protein vs. Ensembl Human
Match: RCBTB1 (RCC1 and BTB domain containing protein 1 [Source:HGNC Symbol;Acc:HGNC:18243])

HSP 1 Score: 85.1149 bits (209), Expect = 1.238e-16
Identity = 92/338 (27.22%), Postives = 145/338 (42.90%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVML-TREGHVYGWGNNNQNQLGEGY-NKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHF-AHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIID-LDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN--HYSAAKTEKDEVYMWGK 1138
            +F +G N  N CL   +N++  +    E      + IK +  GS   V+L T +G VY WG+N  +QLG G  N+ I P ++     CT L          LIK +                                          +++CG  H + L + G+V  +G N  GQ+G        S     TPR VT+     RV+ IA G   ++ + +  +++ WGY     L  G  NG+ + P  +  ++   ++ +  G  H+L LT+   ++A G+N +GQ         L SP  I   ++ +V  I  C+  H SAAKT+   VYMWG+
Sbjct:   43 VFVFGLNYSN-CLGTGDNQSTLVPKKLEGLC--GKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPVQV-----CTNL----------LIKQVV-----------------------------------------EVACGSHHSMALAADGEVFAWGYNNCGQVG------SGSTANQPTPRKVTNCLHIKRVVGIACGQTSSMAVLDNGEVYGWGYNGNGQLGLGN-NGNQLTPVRVAALHSVCVNQIVCGYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLL-SPAHIM-VEKERVVEIAACHSAHTSAAKTQGGHVYMWGQ 312          
BLAST of FYVE-type domain-containing protein vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 74.7146 bits (182), Expect = 1.676e-13
Identity = 66/321 (20.56%), Postives = 133/321 (41.43%), Query Frame = 2
Query:  245 VPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS-----IIGDTNPNFKLDL--PCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---------------YGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVE-IKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            +P   +IK +    +H+++LT +  ++G+G+N+  QLG G    ++  R+            +E +    I+++  G  F++       ++ +G+     +  D   + K  L       +I  I CG  HVV +L SG+   +G N YGQ+G+P      ++E    P  +      +++    G   T+ L +   +   G               +       N ++ +P+ + G  E ++D   GS HS  +  S ++   G N   +             V+ +K    +  T++ C + ++   T + E+Y WG+
Sbjct:  425 LPSRISIKQVALSKTHTMVLTNDNELFGFGDNSCGQLGFGKFSKMENGRL------------VESLKGRDIQSVGVGNYFSVICCDRGTLLTFGTAKNLGLGKDAKDSAKPMLLEQLLRENIKDIYCGHDHVVAVLESGECLGWGSNQYGQLGLP------TLEHFFAPTKIPMPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKLNLTQRVGFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELGLGNSQKMAVRCVKPVKSLLHHACTHVLCGDGFTLVSTTEQELYFWGR 727          
BLAST of FYVE-type domain-containing protein vs. Ensembl Celegans
Match: nekl-1 (NEK (NEver in mitosis Kinase) Like [Source:UniProtKB/TrEMBL;Acc:A0A061AD48])

HSP 1 Score: 74.3294 bits (181), Expect = 1.907e-13
Identity = 66/321 (20.56%), Postives = 133/321 (41.43%), Query Frame = 2
Query:  245 VPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS-----IIGDTNPNFKLDL--PCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---------------YGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVE-IKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            +P   +IK +    +H+++LT +  ++G+G+N+  QLG G    ++  R+            +E +    I+++  G  F++       ++ +G+     +  D   + K  L       +I  I CG  HVV +L SG+   +G N YGQ+G+P      ++E    P  +      +++    G   T+ L +   +   G               +       N ++ +P+ + G  E ++D   GS HS  +  S ++   G N   +             V+ +K    +  T++ C + ++   T + E+Y WG+
Sbjct:  463 LPSRISIKQVALSKTHTMVLTNDNELFGFGDNSCGQLGFGKFSKMENGRL------------VESLKGRDIQSVGVGNYFSVICCDRGTLLTFGTAKNLGLGKDAKDSAKPMLLEQLLRENIKDIYCGHDHVVAVLESGECLGWGSNQYGQLGLP------TLEHFFAPTKIPMPSNKKIVYGKAGKDATMLLSDDGSLIAMGSNKHNKLNLTQRVGFFTKEKKTPNDYVNKPTILQGFPERVVDFSVGSYHSGVILESGQVMIFGRNDNTELGLGNSQKMAVRCVKPVKSLLHHACTHVLCGDGFTLVSTTEQELYFWGR 765          
BLAST of FYVE-type domain-containing protein vs. Ensembl Celegans
Match: glo-4 (X-linked retinitis pigmentosa GTPase regulator homolog [Source:UniProtKB/Swiss-Prot;Acc:Q5DX34])

HSP 1 Score: 71.633 bits (174), Expect = 1.601e-12
Identity = 85/345 (24.64%), Postives = 134/345 (38.84%), Query Frame = 2
Query:  266 KYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSII------GDTNPNFKLDLPCFAGSISK---ISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGY--------------------------GLPCGVINGHIMQ-----PSHMP----GIYEPIIDLDG-------GSNHSLFLTNSRKIFAIGSNV---FGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            + I CG+ H ++L+  G +  WG N   Q G G++      RI   H            D   I+ I+CG   + F      +  +G  +      G  N + +L      G I K   I+CG+ H V+L  +G+V   G   YGQ+G+   D D       TP  +      RV  IAT  YH++C+ E N++F WG                             P    NG   +     P+ +P    G+ E    LDG       G +HS  +T+   ++  G  +    G    N        P ++ + +  K  N+   N+++ A T+   V+ WGK
Sbjct:  773 RAIACGAEHILVLSSSGQLSAWGGNRFGQCGVGHS-----FRIANLHQVDG--------DWPAIEKIACGQFHSAFICSDGSLWTFGWGVWGQLGHGGRNNSNQLVPTRVNGLICKVTQIACGRAHTVVLTDTGRVLVCGSGSYGQMGV---DDDIKKVFAFTPLPLG---PLRVRDIATHYYHSICITEDNRVFEWGRNPQELKMRMFVMKKIRSAQLKNTEDPSSPSPSTNGSTPRVNLNLPAEIPREDLGLREVKHFLDGNIVSVACGLSHSALITSEGTLYTWGKGLDYQLGHGNKNERM----EPHQVFEPNGAKWVNVSLGNNHTIASTDDGSVFAWGK 1094          
BLAST of FYVE-type domain-containing protein vs. Ensembl Celegans
Match: herc-1 (HECT and RCC domain E3 ubiquitin ligase [Source:UniProtKB/TrEMBL;Acc:W6RY72])

HSP 1 Score: 71.2478 bits (173), Expect = 1.608e-12
Identity = 68/292 (23.29%), Postives = 117/292 (40.07%), Query Frame = 2
Query:  263 IKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQP-SHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            +  + CG  H+V LT++G ++  G+N   QLG G                    S+ E             G+F+I+        K                      I +IS G+ H V +   G+V  +G N +GQ+G     ++S      TPR V     + ++++A+G+ H + LDE  ++F WG       I  H  +P   + G+  PI+ +  G+ H L L+ S  +F  G N  G+   +   P   S   + + D   V    C ++++   T     + +G
Sbjct:   43 VTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRG--------------------SRTE-------------GSFSIYPVSWTSSAK----------------------IIQISAGRSHTVSVTDDGRVFAWGSNEHGQLG-----MESKFTWQGTPRRVQE--INDIVQVASGSNHCIALDEGGRVFVWGEQADGRCI--HRPEPVEQLSGV--PIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRP-QTSVQHVHQMDGLGVVEAACGDNHTVLLTHCGRTFSFG 267          

HSP 2 Score: 56.6102 bits (135), Expect = 6.637e-8
Identity = 42/190 (22.11%), Postives = 85/190 (44.74%), Query Frame = 2
Query:  584 SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YGLPCGVINGHIMQ--PSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            +++ ++CG+ H V L   G++   G NM GQ+G       S  E   +   V+   + ++I+I+ G  HT+ + +  ++F WG   +G   G+ +    Q  P  +  I + I+ +  GSNH + L    ++F  G    G+         ++ P  +++     +  +     +  A +    V+ WG+
Sbjct:   42 AVTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLG-----RGSRTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHG-QLGMESKFTWQGTPRRVQEIND-IVQVASGSNHCIALDEGGRVFVWGEQADGRC--------IHRPEPVEQLSGVPIVRVLAGARHCLALSASGAVFTWGQ 216          
BLAST of FYVE-type domain-containing protein vs. Ensembl Celegans
Match: herc-1 (HECT and RCC domain E3 ubiquitin ligase [Source:UniProtKB/TrEMBL;Acc:W6RY72])

HSP 1 Score: 71.2478 bits (173), Expect = 1.608e-12
Identity = 68/292 (23.29%), Postives = 117/292 (40.07%), Query Frame = 2
Query:  263 IKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQP-SHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            +  + CG  H+V LT++G ++  G+N   QLG G                    S+ E             G+F+I+        K                      I +IS G+ H V +   G+V  +G N +GQ+G     ++S      TPR V     + ++++A+G+ H + LDE  ++F WG       I  H  +P   + G+  PI+ +  G+ H L L+ S  +F  G N  G+   +   P   S   + + D   V    C ++++   T     + +G
Sbjct:   43 VTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLGRG--------------------SRTE-------------GSFSIYPVSWTSSAK----------------------IIQISAGRSHTVSVTDDGRVFAWGSNEHGQLG-----MESKFTWQGTPRRVQE--INDIVQVASGSNHCIALDEGGRVFVWGEQADGRCI--HRPEPVEQLSGV--PIVRVLAGARHCLALSASGAVFTWGQNNSGELGIDDLRP-QTSVQHVHQMDGLGVVEAACGDNHTVLLTHCGRTFSFG 267          

HSP 2 Score: 56.6102 bits (135), Expect = 6.637e-8
Identity = 42/190 (22.11%), Postives = 85/190 (44.74%), Query Frame = 2
Query:  584 SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YGLPCGVINGHIMQ--PSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            +++ ++CG+ H V L   G++   G NM GQ+G       S  E   +   V+   + ++I+I+ G  HT+ + +  ++F WG   +G   G+ +    Q  P  +  I + I+ +  GSNH + L    ++F  G    G+         ++ P  +++     +  +     +  A +    V+ WG+
Sbjct:   42 AVTSVTCGEQHTVFLTKDGKMWSVGSNMDGQLG-----RGSRTEGSFSIYPVSWTSSAKIIQISAGRSHTVSVTDDGRVFAWGSNEHG-QLGMESKFTWQGTPRRVQEIND-IVQVASGSNHCIALDEGGRVFVWGEQADGRC--------IHRPEPVEQLSGVPIVRVLAGARHCLALSASGAVFTWGQ 216          
BLAST of FYVE-type domain-containing protein vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0072670)

HSP 1 Score: 84.3445 bits (207), Expect = 2.089e-16
Identity = 82/348 (23.56%), Postives = 150/348 (43.10%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLD--DNNKTISMKLGFENRVPI--DQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTR--INIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIGDTNPNFKLDLP-----CFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLD-----GGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKT-EKDEVYMWG 1135
            L+ WGS  H Q  L   ++ + ++      +++P   D  ++ + CG  H++ LT  G VY  G+N+ +QLG        PT+  + IP          E  D V+I+ I CG   ++  +    ++ +G      +G       + LP         ++ +I+CG  H + L S G++  +G N+YGQ+G+   +    +   + P  +T+     +  IA G  H+  + +   +F WG    CG +  +       P   + +  L       G   S+FLTN   +F  G+  +GQ    F    +  P  + +   + +T + C N ++ A    +  VY +G
Sbjct:    7 LYCWGSTSHGQLGLGGIEDEQILT-----PSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDL-----PTKRPLLIP----------ELQDYVIIQ-ICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPN---DLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRN-NCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEM-LPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFG 328          

HSP 2 Score: 78.1814 bits (191), Expect = 1.796e-14
Identity = 80/296 (27.03%), Postives = 130/296 (43.92%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS-IIGD---------TNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSR-KIFAIGSNVFGQ 994
            ++A GSN+++Q   D   K   +    ++ V I      I CGS HS+ L+  G V  WG+N+  QLG   +K I    + +P    +L +K        +  I+CG   ++  T C  +  +GS I G          T+ N+ L L    G  ++ I+CG  H  L+  SG V  +G+N  GQ+G+  +   S    + T R +   F      +A G   ++ L     +F  G G    L  G  +  ++    M  +   I  +  G+ H+L L  SR +++A G    GQ
Sbjct:   61 VYACGSNDYSQLGHDLPTKRPLLIPELQDYVIIQ-----ICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEI----VQLPKVVRQLVTK-------TVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRF------VACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQ 334          

HSP 3 Score: 73.559 bits (179), Expect = 4.281e-13
Identity = 50/196 (25.51%), Postives = 94/196 (47.96%), Query Frame = 2
Query:  584 SISKISCGQCHVVLLLSSGQVACFGKNMYGQIG--IPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPS--HMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFL--NSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            ++ +++CG  H + L ++G+V   G N Y Q+G  +P K           P ++     + +I+I  G+ H+L L +  Q+  WG    CG + GH        +P +      + ++ +  G+NHSL LT+  ++++ GSN++GQ   N P      N P+ +       +  I C  ++S   ++   V+ WG+
Sbjct:   41 AVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTK----------RPLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDN-DCGQL-GHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGR 224          

HSP 4 Score: 70.4774 bits (171), Expect = 4.284e-12
Identity = 50/204 (24.51%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS-IIGDTNPNF-------KLDLPCFAGSISKISCGQCHVVLLL-SSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVV 739
            L++WGSN + Q  ++  N              +   +  I CG +HS ++++ G V+GWG NN  QLG     +   T  + P       ++L+ + ++ ++ ++CG  F++F T+   +   G+   G     F       ++ +     +I++++CG  H + L+ S G+V  FG    GQ+G        S +++  P+VV
Sbjct:  164 LYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLG-----LNDETNRSYP-------TQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGT------RSTKSLMLPQVV 349          

HSP 5 Score: 52.7582 bits (125), Expect = 1.327e-6
Identity = 46/178 (25.84%), Postives = 80/178 (44.94%), Query Frame = 2
Query:  626 LLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVIN----GHIM---QPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            + S  ++ C+G   +GQ+G+   +     E + TP  +       V ++A G  HTL L    +++       CG  +    GH +   +P  +P + +  II +  GS HSL L++  ++ + G N  GQ         +  P  +++     V  I C N++S A T   E+Y WG
Sbjct:    1 MASGKELYCWGSTSHGQLGLGGIE----DEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYA------CGSNDYSQLGHDLPTKRPLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWG 168          
BLAST of FYVE-type domain-containing protein vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0072671)

HSP 1 Score: 84.3445 bits (207), Expect = 2.089e-16
Identity = 82/348 (23.56%), Postives = 150/348 (43.10%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLD--DNNKTISMKLGFENRVPI--DQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTR--INIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIGDTNPNFKLDLP-----CFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLD-----GGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKT-EKDEVYMWG 1135
            L+ WGS  H Q  L   ++ + ++      +++P   D  ++ + CG  H++ LT  G VY  G+N+ +QLG        PT+  + IP          E  D V+I+ I CG   ++  +    ++ +G      +G       + LP         ++ +I+CG  H + L S G++  +G N+YGQ+G+   +    +   + P  +T+     +  IA G  H+  + +   +F WG    CG +  +       P   + +  L       G   S+FLTN   +F  G+  +GQ    F    +  P  + +   + +T + C N ++ A    +  VY +G
Sbjct:    7 LYCWGSTSHGQLGLGGIEDEQILT-----PSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDL-----PTKRPLLIP----------ELQDYVIIQ-ICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPN---DLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRN-NCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEM-LPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFG 328          

HSP 2 Score: 78.1814 bits (191), Expect = 1.796e-14
Identity = 80/296 (27.03%), Postives = 130/296 (43.92%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS-IIGD---------TNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSR-KIFAIGSNVFGQ 994
            ++A GSN+++Q   D   K   +    ++ V I      I CGS HS+ L+  G V  WG+N+  QLG   +K I    + +P    +L +K        +  I+CG   ++  T C  +  +GS I G          T+ N+ L L    G  ++ I+CG  H  L+  SG V  +G+N  GQ+G+  +   S    + T R +   F      +A G   ++ L     +F  G G    L  G  +  ++    M  +   I  +  G+ H+L L  SR +++A G    GQ
Sbjct:   61 VYACGSNDYSQLGHDLPTKRPLLIPELQDYVIIQ-----ICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEI----VQLPKVVRQLVTK-------TVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRF------VACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQ 334          

HSP 3 Score: 73.559 bits (179), Expect = 4.281e-13
Identity = 50/196 (25.51%), Postives = 94/196 (47.96%), Query Frame = 2
Query:  584 SISKISCGQCHVVLLLSSGQVACFGKNMYGQIG--IPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPS--HMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFL--NSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            ++ +++CG  H + L ++G+V   G N Y Q+G  +P K           P ++     + +I+I  G+ H+L L +  Q+  WG    CG + GH        +P +      + ++ +  G+NHSL LT+  ++++ GSN++GQ   N P      N P+ +       +  I C  ++S   ++   V+ WG+
Sbjct:   41 AVQQVACGHRHTLFLTATGKVYACGSNDYSQLGHDLPTK----------RPLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDN-DCGQL-GHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGR 224          

HSP 4 Score: 70.4774 bits (171), Expect = 4.284e-12
Identity = 50/204 (24.51%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS-IIGDTNPNF-------KLDLPCFAGSISKISCGQCHVVLLL-SSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVV 739
            L++WGSN + Q  ++  N              +   +  I CG +HS ++++ G V+GWG NN  QLG     +   T  + P       ++L+ + ++ ++ ++CG  F++F T+   +   G+   G     F       ++ +     +I++++CG  H + L+ S G+V  FG    GQ+G        S +++  P+VV
Sbjct:  164 LYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLG-----LNDETNRSYP-------TQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGT------RSTKSLMLPQVV 349          

HSP 5 Score: 52.7582 bits (125), Expect = 1.327e-6
Identity = 46/178 (25.84%), Postives = 80/178 (44.94%), Query Frame = 2
Query:  626 LLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVIN----GHIM---QPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            + S  ++ C+G   +GQ+G+   +     E + TP  +       V ++A G  HTL L    +++       CG  +    GH +   +P  +P + +  II +  GS HSL L++  ++ + G N  GQ         +  P  +++     V  I C N++S A T   E+Y WG
Sbjct:    1 MASGKELYCWGSTSHGQLGLGGIE----DEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYA------CGSNDYSQLGHDLPTKRPLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWG 168          
BLAST of FYVE-type domain-containing protein vs. Ensembl Fly
Match: Herc4 (gene:FBgn0035207 transcript:FBtr0310555)

HSP 1 Score: 84.3445 bits (207), Expect = 2.241e-16
Identity = 80/349 (22.92%), Postives = 150/349 (42.98%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLD--DNNKTISMKLGFENRVPI--DQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKL---EFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIGDTNPNFKLDLP-----CFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLD-----GGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKT-EKDEVYMWG 1135
            L+ WGS  H Q  L   ++ + ++      +++P   D  ++ + CG  H++ LT  G VY  G+N+ +QLG            ++P    ++   L   E  D V+I+ I CG   ++  +    ++ +G      +G       + LP         ++ +I+CG  H + L S G++  +G N+YGQ+G+   +    +   + P  +T+     +  IA G  H+  + +   +F WG    CG +  +       P   + +  L       G   S+FLTN   +F  G+  +GQ    F    +  P  + +   + +T + C N ++ A    +  VY +G
Sbjct:    7 LYCWGSTSHGQLGLGGIEDEQILT-----PSQIPWTPDTAVQQVACGHRHTLFLTATGKVYACGSNDYSQLGH-----------DLPTKRPRMSPFLLIPELQDYVIIQ-ICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPN---DLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRN-NCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEM-LPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFG 333          

HSP 2 Score: 78.5666 bits (192), Expect = 1.182e-14
Identity = 81/296 (27.36%), Postives = 128/296 (43.24%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS-IIGD---------TNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSR-KIFAIGSNVFGQ 994
            ++A GSN+++Q   D   K   M          D  I  I CGS HS+ L+  G V  WG+N+  QLG   +K I    + +P    +L +K        +  I+CG   ++  T C  +  +GS I G          T+ N+ L L    G  ++ I+CG  H  L+  SG V  +G+N  GQ+G+  +   S    + T R +   F      +A G   ++ L     +F  G G    L  G  +  ++    M  +   I  +  G+ H+L L  SR +++A G    GQ
Sbjct:   61 VYACGSNDYSQLGHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEI----VQLPKVVRQLVTK-------TVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRF------VACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQ 339          

HSP 3 Score: 75.0998 bits (183), Expect = 1.444e-13
Identity = 50/194 (25.77%), Postives = 95/194 (48.97%), Query Frame = 2
Query:  584 SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPS--HMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFL--NSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            ++ +++CG  H + L ++G+V   G N Y Q+G    DL +    +S   ++     + +I+I  G+ H+L L +  Q+  WG    CG + GH        +P +      + ++ +  G+NHSL LT+  ++++ GSN++GQ   N P      N P+ +       +  I C  ++S   ++   V+ WG+
Sbjct:   41 AVQQVACGHRHTLFLTATGKVYACGSNDYSQLG---HDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDN-DCGQL-GHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGR 229          

HSP 4 Score: 70.4774 bits (171), Expect = 4.145e-12
Identity = 50/204 (24.51%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS-IIGDTNPNF-------KLDLPCFAGSISKISCGQCHVVLLL-SSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVV 739
            L++WGSN + Q  ++  N              +   +  I CG +HS ++++ G V+GWG NN  QLG     +   T  + P       ++L+ + ++ ++ ++CG  F++F T+   +   G+   G     F       ++ +     +I++++CG  H + L+ S G+V  FG    GQ+G        S +++  P+VV
Sbjct:  169 LYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVFGWGRNNCGQLG-----LNDETNRSYP-------TQLKTLRTLGVRFVACGDEFSVFLTNEGGVFTCGAGAYGQLGHGFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGT------RSTKSLMLPQVV 354          

HSP 5 Score: 52.373 bits (124), Expect = 1.422e-6
Identity = 47/183 (25.68%), Postives = 79/183 (43.17%), Query Frame = 2
Query:  626 LLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVIN----GHIM---QPSHMPGIYEP------IIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            + S  ++ C+G   +GQ+G+   +     E + TP  +       V ++A G  HTL L    +++       CG  +    GH +   +P   P +  P      II +  GS HSL L++  ++ + G N  GQ         +  P  +++     V  I C N++S A T   E+Y WG
Sbjct:    1 MASGKELYCWGSTSHGQLGLGGIE----DEQILTPSQIPWTPDTAVQQVACGHRHTLFLTATGKVYA------CGSNDYSQLGHDLPTKRPRMSPFLLIPELQDYVIIQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTKTVVQIACGNNHSLALTSCGELYSWG 173          
BLAST of FYVE-type domain-containing protein vs. Ensembl Fly
Match: HERC2 (gene:FBgn0031107 transcript:FBtr0301344)

HSP 1 Score: 64.3142 bits (155), Expect = 4.604e-10
Identity = 58/246 (23.58%), Postives = 98/246 (39.84%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQ----------NIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGG--TFTIFTTHCNCIIKYGS-------IIGDTNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG 832
            +F+WG  E               KLG  NR  +D+           I+ + CGSSHS  ++ +G +Y WG     +LG G N     T++  P   T L  +        +  ++CG     T+  T    +  +G          G    +   ++   +G  + +I CG    + L  +G+V  +GK  Y ++G          + V  P+ +      RVI +A G  H L + +  Q++ WG
Sbjct: 3094 VFSWGEGEDG-------------KLGHGNRTTLDKPRLVEALRAKKIRDVACGSSHSAAISSQGELYTWGLGEYGRLGHGDNT----TQLK-PKLVTALAGR-------RVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLGRGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTWGKGDYYRLG------HGGDQHVRKPQPIGGLRGRRVIHVAVGALHCLAVTDAGQVYAWG 3308          

HSP 2 Score: 63.929 bits (154), Expect = 5.644e-10
Identity = 72/325 (22.15%), Postives = 129/325 (39.69%), Query Frame = 2
Query:  221 MKLGFENRVPIDQNIKYIK----------CGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSII------------GDTNPNFKLDL-PCFAG-SISKISCGQ--CHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVING---HIMQPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLN-SPVEIKKFDENKVTNIYCCNHYSAA 1102
            + LG  + VP+   +  ++           G  H++ LT +G V+ WG     +LG G       T ++ P     L +K        I++++CG      ++H   I   G +             GD     K  L    AG  + +++CG      + L   G V  +G   +G++G          E   TP  +       V++I  G   +L L    +++ WG G    + +G   H+ +P  + G+    +I +  G+ H L +T++ +++A G N  GQ        F+N  P  +   D   V  + C + +S A
Sbjct: 3051 LGLGVTHNVPLPHQLPVLRQYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKLGHG-----NRTTLDKPRLVEALRAK-------KIRDVACG------SSHSAAISSQGELYTWGLGEYGRLGHGDNTTQLKPKLVTALAGRRVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLG------RGGSEGSDTPHEIERLSGIGVVQIECGAQFSLALTRAGEVWTWGKGDYYRLGHGGDQHVRKPQPIGGLRGRRVIHVAVGALHCLAVTDAGQVYAWGDNDHGQQGSG--NTFVNKKPALVIGLDAVFVNRVACGSSHSIA 3349          

HSP 3 Score: 63.5438 bits (153), Expect = 7.469e-10
Identity = 64/278 (23.02%), Postives = 101/278 (36.33%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQ----------NIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNK-IIKPTRIN-------IPHTC----------------------------------TKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCI----------IKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCL 802
            ++AWG  E               KLG  NR+  D+          ++  I CGS+HS  +T  GHV  WG     +LG G ++  ++P  +        I   C                                   KL  K+E +  + +  + CG  F++  T    +          + +GS+     P     L      I  I+ G  H V    SG+V  +G N  GQ+G      D +V  +  PR+V +     ++K+  G+ HTL L
Sbjct: 4157 VYAWGEGEDG-------------KLGHGNRMSYDRPKLVEHLNGMSVADIACGSAHSAAITASGHVLTWGKGRYGRLGHGDSEDQLRPKLVEALLGYRAIDIACGSGDAQTLCITDDDNVWSWGDGDYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWGKGDFHRLGHGSVDHVRRPKKVAALQ--GKKIISIATGSLHCVACSDSGEVYTWGDNDEGQLG------DGTVTAIQRPRLVAALQGKHIVKVTCGSAHTLAL 4413          

HSP 4 Score: 61.6178 bits (148), Expect = 2.601e-9
Identity = 47/191 (24.61%), Postives = 85/191 (44.50%), Query Frame = 2
Query:  584 SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGT--YHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEP-----IIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            S++ I+CG  H   + +SG V  +GK  YG++G          E    P++V +   +R I IA G+    TLC+ + + ++ WG G   G +         +P   E      ++ ++ GS  S+ LT S  ++  G   F +   +     +  P ++      K+ +I   + +  A ++  EVY WG
Sbjct: 4189 SVADIACGSAHSAAITASGHVLTWGKGRYGRLG------HGDSEDQLRPKLVEALLGYRAIDIACGSGDAQTLCITDDDNVWSWGDG-DYGKLGRGGSDGCKLPYKIESLAGLGVVKVECGSQFSVALTKSGAVYTWGKGDFHRLG-HGSVDHVRRPKKVAALQGKKIISIATGSLHCVACSDSGEVYTWG 4371          

HSP 5 Score: 53.9138 bits (128), Expect = 6.506e-7
Identity = 55/234 (23.50%), Postives = 99/234 (42.31%), Query Frame = 2
Query:  158 FAWGSNE-HNQCLLDDNNKTISMKLGFENRVPIDQN-IKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIGDTNPNFKLDLPCFAGSISKIS---CGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG 832
            ++WG+ E H     D + + +  K+       ++Q+ ++ + CG S+S  +T  G++  WG     +LG G          ++P     L   +  VD  L      G   ++  T    +  +G      +G+ N N  L  P    S+ ++     G    V L S GQ+  +GK       +  + ++ SV+  S PR+V+S    R++ +A    H L L    ++F WG
Sbjct:  638 YSWGTGEDHRLGHGDTHARAVPTKIA-----ALEQHCVQSVYCGCSYSAAITCGGNLLTWGRGTYARLGHG-----NSDDRSLPTLVVALSDHM-VVDVAL----GSGDAHSLALTSEGLVFAWGDGDYGKLGNGNCNGSLQ-PILVESLPRVQRVFAGSQFSVALSSEGQLYTWGK----ATCLGHQLVERSVQGCSVPRLVSSLQHKRIVDVAVSVAHCLALSSSGEVFGWG 851          
BLAST of FYVE-type domain-containing protein vs. Ensembl Fly
Match: CG6678 (gene:FBgn0038917 transcript:FBtr0084148)

HSP 1 Score: 56.6102 bits (135), Expect = 4.213e-8
Identity = 55/254 (21.65%), Postives = 112/254 (44.09%), Query Frame = 2
Query:  158 FAWGSNEHNQCLLDDN-NKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGD-TNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPC-GVINGHIMQPSHMPGIYEPII 910
             A+G     + LLDD  N+ ++++           NI+ +    SH ++L + G +Y      Q +L     ++    R N   T   +    +   S +I++I+CG    +  +  NC+    S +   +   F+         + ++ CG  H VLL ++G V  +G  + GQ+G+      + +    TP+++ +    ++ +IA G +H+  +     ++ W  GL C G +   +M+P  +  + EP +
Sbjct:   51 LAFGRKLCLRGLLDDGPNECVTLE--------ATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAELVA--VRLEAAPRSN-SGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQFR---------VKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGL------AELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTW--GLNCSGQLGLRVMKPGGV--LKEPTV 274          
BLAST of FYVE-type domain-containing protein vs. Ensembl Zebrafish
Match: herc4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:ZFIN;Acc:ZDB-GENE-070801-1])

HSP 1 Score: 90.1225 bits (222), Expect = 5.030e-18
Identity = 86/287 (29.97%), Postives = 122/287 (42.51%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVET-VSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQP---SHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQ--AAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G    I    +  P  C       EF +   ++++ CG   T+F        T  CN + + G       P   + L   A +I  +SCG+ H + L   GQV  +G    GQ+G+      S VE  +  PR V S     + ++A G +H+L L    +IF WG   YG L  G     +  P     + GI  P   +  G  HS  LT S  IF  G N FGQ     N    F   PV +K     +V  I C   ++AA T++  V+ +G
Sbjct:    4 WGNASFGQLGLGG---IDEEVLLEPRRC-------EFFEGKRVRDVGCGRRHTVFLLEDGTVYTCGCNDLGQLGHEKARKKPEQVVSLD--AQNIVAVSCGEAHTLALNDKGQVFAWGLGSDGQLGL------SIVEDCLRVPRTVKSLSEVHITQVACGYWHSLALARGGEIFSWGQNKYGQLGLGQQGACVCSPQVIQSLQGI--PFGQISAGGAHSFGLTLSGAIFGWGRNKFGQLGLGDNDDRRF---PVLLKTLRSQQVVYICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 66.6254 bits (161), Expect = 7.393e-11
Identity = 69/300 (23.00%), Postives = 125/300 (41.67%), Query Frame = 2
Query:  257 QNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG---------SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YGLPCGVINGHIMQPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAA 1102
            + ++ + CG  H+V L  +G VY  G N+  QLG                   K   ++  +D+  I  +SCG   T+       +  +G         SI+ D      L +P    S+S     +++CG  H + L   G++  +G+N YGQ+G+ ++        V +P+V+ S       +I+ G  H+  L     IF WG   +G      N     P  +  +  + ++ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + V+ I C   ++ A
Sbjct:   34 KRVRDVGCGRRHTVFLLEDGTVYTCGCNDLGQLGH--------------EKARKKPEQVVSLDAQNIVAVSCGEAHTLALNDKGQVFAWGLGSDGQLGLSIVEDC-----LRVPRTVKSLSEVHITQVACGYWHSLALARGGEIFSWGQNKYGQLGLGQQG-----ACVCSPQVIQSLQGIPFGQISAGGAHSFGLTLSGAIFGWGRNKFGQLGLGDNDDRRFPVLLKTLRSQQVVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEVN-PRKVFELMGSVVSQIACGRQHTLA 308          

HSP 3 Score: 63.1586 bits (152), Expect = 9.691e-10
Identity = 64/266 (24.06%), Postives = 113/266 (42.48%), Query Frame = 2
Query:  236 ENRVPID-QNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSI-----SKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCW---GYGLPCGVINGHIMQPSHMPGIYEPII-DLDGGSNHSL-FLTNSRKI--FAIGSN 982
            E  V +D QNI  + CG +H++ L  +G V+ WG  +  QLG           ++I   C ++   ++ +  V I  ++CG   ++       I  +G      +G       +  P    S+      +IS G  H   L  SG +  +G+N +GQ+G+   D          P ++ +  + +V+ I  G  HT  L +   +F +   GYG        H + P  +  +   ++  +  G  H+L F+ +S KI  F +G N
Sbjct:   76 EQVVSLDAQNIVAVSCGEAHTLALNDKGQVFAWGLGSDGQLG-----------LSIVEDCLRVPRTVKSLSEVHITQVACGYWHSLALARGGEIFSWGQNKYGQLGLGQQGACVCSPQVIQSLQGIPFGQISAGGAHSFGLTLSGAIFGWGRNKFGQLGLGDND------DRRFPVLLKTLRSQQVVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEVNPRKVFELMGSVVSQIACGRQHTLAFIPSSGKIDSFGLGGN 324          

HSP 4 Score: 62.7734 bits (151), Expect = 1.341e-9
Identity = 58/224 (25.89%), Postives = 85/224 (37.95%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCII-----KYGSI-IGDTNP-NFKLDLPCF-AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCL 802
            +FAWG     Q  L      + +    ++   +  +I  + CG  HS+ L R G ++ WG N   QLG G               C      ++ +  +    IS GG  +   T    I      K+G + +GD +   F + L    +  +  I CG+ H   L   G V  FG   YGQ+G       +S      PR V       V +IA G  HTL  
Sbjct:  105 VFAWGLGSDGQLGLSIVEDCLRVPRTVKSLSEV--HITQVACGYWHSLALARGGEIFSWGQNKYGQLGLGQQG-----------ACVCSPQVIQSLQGIPFGQISAGGAHSFGLTLSGAIFGWGRNKFGQLGLGDNDDRRFPVLLKTLRSQQVVYICCGEDHTAALTKEGGVFTFGAGGYGQLG------HNSTNHEVNPRKVFELMGSVVSQIACGRQHTLAF 309          

HSP 5 Score: 51.6026 bits (122), Expect = 3.224e-6
Identity = 43/173 (24.86%), Postives = 69/173 (39.88%), Query Frame = 2
Query:  650 CFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEP--IIDLDG--------GSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            C+G   +GQ+G+   D +  +E    PR        RV  +  G  HT+ L E   ++       CG     + Q  H     +P  ++ LD         G  H+L L +  ++FA G    GQ   +     L  P  +K   E  +T + C   +S A     E++ WG+
Sbjct:    3 CWGNASFGQLGLGGIDEEVLLE----PRRCEFFEGKRVRDVGCGRRHTVFLLEDGTVYT------CGC--NDLGQLGHEKARKKPEQVVSLDAQNIVAVSCGEAHTLALNDKGQVFAWGLGSDGQLGLSIVEDCLRVPRTVKSLSEVHITQVACGYWHSLALARGGEIFSWGQ 163          

HSP 6 Score: 51.2174 bits (121), Expect = 4.896e-6
Identity = 37/132 (28.03%), Postives = 56/132 (42.42%), Query Frame = 2
Query:  116 GLIYKFKNVMSEFLFAWGSNEHNQCLLDDNNKTISMKLGFENRVPI------DQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGE-GYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTI 490
            G  + F   +S  +F WG N+  Q  L DN+         + R P+       Q + YI CG  H+  LT+EG V+ +G     QLG    N  + P ++             E + SV +  I+CG   T+
Sbjct:  198 GGAHSFGLTLSGAIFGWGRNKFGQLGLGDND---------DRRFPVLLKTLRSQQVVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTNHEVNPRKV------------FELMGSV-VSQIACGRQHTL 307          
BLAST of FYVE-type domain-containing protein vs. Ensembl Zebrafish
Match: slc47a2.2 (solute carrier family 47 member 2.2 [Source:ZFIN;Acc:ZDB-GENE-070615-14])

HSP 1 Score: 85.8853 bits (211), Expect = 1.017e-16
Identity = 78/284 (27.46%), Postives = 116/284 (40.85%), Query Frame = 2
Query:  176 EHNQCLLDDNNKTISMKL--------GFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------IIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCL-DEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEP-------IIDLDGGSNHSLFL 946
            E    LL D+ K + M          G ENR  I      I CG  HS+ LT +G ++ WG N   QLG           +      T+    L+ +  + +  IS GG  +   +    +  +GS       +GDT   F   +P    S+S      ISCG  H   L   G V  FG   +GQ+G       +S++    PR+V   +  +V ++  G +HTL   D  NQI+ +G G+   + NG  ++ S    +  P       +  L  G NHS  L
Sbjct:   86 EAGAVLLADDGKVLVMDQSTVCRPLKGLENRQVIQ-----IACGDQHSMALTNDGQLFVWGENALGQLG-----------LRKEQAGTQSPQHLQSLCGIPVAQISAGGNHSFVLSLSGVVFGWGSNSAGQLGLGDTTDRF---IPTIVKSLSGKKTVSISCGGEHTATLSKGGTVFTFGSGGFGQLG------HNSLKDEHHPRLVAELWGSKVSQVTCGRHHTLVFEDSSNQIYSFGCGMQGQLGNGEQVKQSVPLPVLLPTECTEFTMEKLIAGENHSFAL 344          

HSP 2 Score: 61.6178 bits (148), Expect = 3.018e-9
Identity = 52/189 (27.51%), Postives = 80/189 (42.33%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENR--VPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----------SIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLL-SSGQVACFGKNMYGQIG 682
            LF WG N   Q  L             ++   +P+ Q    I  G +HS +L+  G V+GWG+N+  QLG G       T   IP     L  K          +ISCGG  T   +    +  +G          S+  + +P    +L  +   +S+++CG+ H ++   SS Q+  FG  M GQ+G
Sbjct:  137 LFVWGENALGQLGLRKEQAGTQSPQHLQSLCGIPVAQ----ISAGGNHSFVLSLSGVVFGWGSNSAGQLGLG-----DTTDRFIPTIVKSLSGKKTV-------SISCGGEHTATLSKGGTVFTFGSGGFGQLGHNSLKDEHHPRLVAEL--WGSKVSQVTCGRHHTLVFEDSSNQIYSFGCGMQGQLG 307          

HSP 3 Score: 53.9138 bits (128), Expect = 7.082e-7
Identity = 48/189 (25.40%), Postives = 76/189 (40.21%), Query Frame = 2
Query:  587 ISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQ-AAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            I  I CG+   VLL   G+V    ++    +  P K L++                 +VI+IA G  H++ L    Q+F WG      L           P H+  +   P+  +  G NHS  L+ S  +F  GSN  GQ    +    F+  P  +K     K  +I C   ++A  ++   V+ +G
Sbjct:   79 IRSIVCGEAGAVLLADDGKVLVMDQST---VCRPLKGLEN----------------RQVIQIACGDQHSMALTNDGQLFVWGENALGQLGLRKEQAGTQSPQHLQSLCGIPVAQISAGGNHSFVLSLSGVVFGWGSNSAGQLGLGDTTDRFI--PTIVKSLSGKKTVSISCGGEHTATLSKGGTVFTFG 246          
BLAST of FYVE-type domain-containing protein vs. Ensembl Zebrafish
Match: rcbtb1 (regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7951])

HSP 1 Score: 83.5741 bits (205), Expect = 2.866e-16
Identity = 74/292 (25.34%), Postives = 127/292 (43.49%), Query Frame = 2
Query:  290 HSVMLTREGHVYGWGNNNQNQLGEGY-NKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVI-KIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN--HYSAAKTEKDEVYMWGK 1138
            H +++T +G +Y WG+N  +QLG G  N+ + P  ++     T L+ K                                                    ++++SCG  H + L   G+V  +G N  GQ+G        S     TPR V++   ++VI  IA G   ++ + +  +++ WGY     L  G  NG+ + P  +  +    ++ +  G  HSL LT+   ++A G+N +GQ         L SPV++   ++ ++  I  C+  H SAAKT+  +VYMWG+
Sbjct:   86 HVLLVTEDGELYAWGHNGYSQLGNGTTNQGVSPILVS-----TNLQGK---------------------------------------------------RVTEVSCGSHHSLALTHEGEVFAWGYNNCGQVG------SGSTANQPTPRKVSNCLQNKVIVNIACGQTSSMAVTDNGEVYGWGYNGNGQLGLGN-NGNQLTPCRLIALQGFCVLQIASGYAHSLALTDEGLLYAWGANTYGQLGTGNKSNQL-SPVQVMT-EKERIVEIAACHSTHTSAAKTQSGQVYMWGQ 312          

HSP 2 Score: 70.4774 bits (171), Expect = 3.249e-12
Identity = 67/241 (27.80%), Postives = 108/241 (44.81%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDL--------PCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIAT--GTYHTLCLDEINQIFCWG 832
            L+AWG N ++Q      N+ +S  L   N     + +  + CGS HS+ LT EG V+ WG NN  Q+G G +   +PT   + +    L++K       +I NI+CG T ++  T    +  +G      N N +L L        PC   ++      +I+ G  H + L   G +  +G N YGQ+G   K    S   V T +        R+++IA    T+ +    +  Q++ WG
Sbjct:   96 LYAWGHNGYSQLGNGTTNQGVSPILVSTNLQ--GKRVTEVSCGSHHSLALTHEGEVFAWGYNNCGQVGSG-STANQPTPRKVSNC---LQNK-------VIVNIACGQTSSMAVTDNGEVYGWG-----YNGNGQLGLGNNGNQLTPCRLIALQGFCVLQIASGYAHSLALTDEGLLYAWGANTYGQLGTGNKSNQLSPVQVMTEK-------ERIVEIAACHSTHTSAAKTQSGQVYMWG 311          
BLAST of FYVE-type domain-containing protein vs. Ensembl Zebrafish
Match: rcbtb1 (regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7951])

HSP 1 Score: 83.5741 bits (205), Expect = 2.866e-16
Identity = 74/292 (25.34%), Postives = 127/292 (43.49%), Query Frame = 2
Query:  290 HSVMLTREGHVYGWGNNNQNQLGEGY-NKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVI-KIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN--HYSAAKTEKDEVYMWGK 1138
            H +++T +G +Y WG+N  +QLG G  N+ + P  ++     T L+ K                                                    ++++SCG  H + L   G+V  +G N  GQ+G        S     TPR V++   ++VI  IA G   ++ + +  +++ WGY     L  G  NG+ + P  +  +    ++ +  G  HSL LT+   ++A G+N +GQ         L SPV++   ++ ++  I  C+  H SAAKT+  +VYMWG+
Sbjct:   86 HVLLVTEDGELYAWGHNGYSQLGNGTTNQGVSPILVS-----TNLQGK---------------------------------------------------RVTEVSCGSHHSLALTHEGEVFAWGYNNCGQVG------SGSTANQPTPRKVSNCLQNKVIVNIACGQTSSMAVTDNGEVYGWGYNGNGQLGLGN-NGNQLTPCRLIALQGFCVLQIASGYAHSLALTDEGLLYAWGANTYGQLGTGNKSNQL-SPVQVMT-EKERIVEIAACHSTHTSAAKTQSGQVYMWGQ 312          

HSP 2 Score: 70.4774 bits (171), Expect = 3.249e-12
Identity = 67/241 (27.80%), Postives = 108/241 (44.81%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDL--------PCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIAT--GTYHTLCLDEINQIFCWG 832
            L+AWG N ++Q      N+ +S  L   N     + +  + CGS HS+ LT EG V+ WG NN  Q+G G +   +PT   + +    L++K       +I NI+CG T ++  T    +  +G      N N +L L        PC   ++      +I+ G  H + L   G +  +G N YGQ+G   K    S   V T +        R+++IA    T+ +    +  Q++ WG
Sbjct:   96 LYAWGHNGYSQLGNGTTNQGVSPILVSTNLQ--GKRVTEVSCGSHHSLALTHEGEVFAWGYNNCGQVGSG-STANQPTPRKVSNC---LQNK-------VIVNIACGQTSSMAVTDNGEVYGWG-----YNGNGQLGLGNNGNQLTPCRLIALQGFCVLQIASGYAHSLALTDEGLLYAWGANTYGQLGTGNKSNQLSPVQVMTEK-------ERIVEIAACHSTHTSAAKTQSGQVYMWG 311          
BLAST of FYVE-type domain-containing protein vs. Ensembl Zebrafish
Match: rpgrb (retinitis pigmentosa GTPase regulator b [Source:ZFIN;Acc:ZDB-GENE-081015-2])

HSP 1 Score: 79.337 bits (194), Expect = 6.914e-15
Identity = 80/323 (24.77%), Postives = 139/323 (43.03%), Query Frame = 2
Query:  224 KLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFT-IFTTHCNCIIKYGS-----IIGDTNPNFKLDLPCF---AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG------YGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISH 1147
            K   +N VP+      I CG  H+ ++T  G ++ +G+NN  QLG G       T +N P TC K       + S  +K  +CG T T +FT+  N     G+      +GD N      L  F    G I  ++ G      L   G++  +G N  GQIG+ ++          TP+ V+     RV  ++ G YH+  +     ++ +G       GL    +  H + P  +  I + ++ +  G  H++ LT + ++++ G   FGQ            P  ++ F + +V +  C  +++A  T+   +Y +G   H
Sbjct:   30 KFWLKNDVPL-----RISCGDEHTALVTENGKLFMFGSNNWGQLGLGTK-----TTVNKP-TCVKA------LKSERVKLTACGRTHTLVFTSRGNLYACGGNNEGQLGLGDCNDRTSFHLVEFFNKQGPIKMLAAGSNTSAALTQDGRLYMWGDNSEGQIGLGKE------SNALTPQEVS--VGKRVFWVSCGYYHSAFVTVDGALYTFGEKDSGKLGLSTEKLANHKV-PQQVTDIPDRVVQVACGGGHTVALTEN-EVYSFGLGQFGQLGHGTFIFESRLPRVVEHFRKGRVKHAACGENHTALITDNGLLYTFGDGRH 325          

HSP 2 Score: 63.1586 bits (152), Expect = 7.616e-10
Identity = 63/243 (25.93%), Postives = 100/243 (41.15%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKL--GFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEG-YNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------------IIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG 838
            L+A G N   Q  L D N   S  L   F  + PI    K +  GS+ S  LT++G +Y WG+N++ Q+G G  +  + P  +++         K  F        +SCG   + F T    +  +G             +     P    D+P     + +++CG  H V  L+  +V  FG   +GQ+G      +S +     PRVV      RV   A G  HT  + +   ++ +G G
Sbjct:  109 LYACGGNNEGQLGLGDCNDRTSFHLVEFFNKQGPI----KMLAAGSNTSAALTQDGRLYMWGDNSEGQIGLGKESNALTPQEVSV--------GKRVFW-------VSCGYYHSAFVTVDGALYTFGEKDSGKLGLSTEKLANHKVPQQVTDIP---DRVVQVACGGGHTV-ALTENEVYSFGLGQFGQLGHGTFIFESRL-----PRVVEHFRKGRVKHAACGENHTALITDNGLLYTFGDG 323          
BLAST of FYVE-type domain-containing protein vs. Ensembl Xenopus
Match: prxl2b (peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-968463])

HSP 1 Score: 96.6709 bits (239), Expect = 5.594e-20
Identity = 84/284 (29.58%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPN--FKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G    I    +  P  C       +F  +  ++++ CG   T+F        T  CN + + G       P     LD    A  I  +SCG+ H + L   GQV  +G  +YGQIG     L ++ E +  PR + S    +++++A G +H+L L + N IF WG   YG L  G+       P H+  +   P   +  G  HS  LT S  IF  G N FGQ          N P  +K     K+ +I C   ++AA T++  V+ +G
Sbjct:    4 WGNTSFGQLGLGG---IDEEVVLEPRRC-------DFFINKNVRDVGCGSRHTVFVLDDGTVYTCGCNDLGQLGHDKSRRKPEQVGALD----AQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIG-----LSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKGNDIFSWGQNQYGQLGLGLEIKKECAPRHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETD-RNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 62.7734 bits (151), Expect = 1.738e-9
Identity = 59/237 (24.89%), Postives = 93/237 (39.24%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG-------SIIGDTNPNFKLDLPCF-AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLC-LDEINQIFCWGYG 838
            +F+WG   + Q  L    + I +    ++    D  I  + CG  HS+ L++   ++ WG N   QLG G         + I   C      ++ +  +   +I+ GG  +   T    I  +G        +  +T+ N    L    +  I  I CG+ H   L   G V  FG   YGQ+G       +S      PR V       V +IA G  HTL  +    +I+ +G G
Sbjct:  105 VFSWGHAVYGQIGLSTAEEYIRVPRNIKSLS--DVQIVQVACGHHHSLALSKGNDIFSWGQNQYGQLGLG---------LEIKKECAP--RHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETDRNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFGAGGYGQLG------HNSTNHEVNPRKVFELMGSIVTQIACGRQHTLAFVPSSGRIYSFGLG 322          

HSP 3 Score: 54.6842 bits (130), Expect = 5.450e-7
Identity = 38/169 (22.49%), Postives = 78/169 (46.15%), Query Frame = 2
Query:  650 CFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVIN--GH---IMQPSHMPGI-YEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            C+G   +GQ+G+   D     E V  PR         V  +  G+ HT+ + +   ++  G    C  +   GH     +P  +  +  + I+ +  G  H+L L +  ++F+ G  V+GQ   +    ++  P  IK   + ++  + C +H+S A ++ ++++ WG+
Sbjct:    3 CWGNTSFGQLGLGGID----EEVVLEPRRCDFFINKNVRDVGCGSRHTVFVLDDGTVYTCG----CNDLGQLGHDKSRRKPEQVGALDAQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIGLSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKGNDIFSWGQ 163          
BLAST of FYVE-type domain-containing protein vs. Ensembl Xenopus
Match: prxl2b (peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-968463])

HSP 1 Score: 95.9005 bits (237), Expect = 1.089e-19
Identity = 83/284 (29.23%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPN--FKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G    I    +  P  C       +F  +  ++++ CG   T+F        T  CN + + G       P     LD    A  I  +SCG+ H + L   GQV  +G  +YGQIG     L ++ E +  PR + S    +++++A G +H+L L + + IF WG   YG L  G+       P H+  +   P   +  G  HS  LT S  IF  G N FGQ          N P  +K     K+ +I C   ++AA T++  V+ +G
Sbjct:    4 WGNTSFGQLGLGG---IDEEVVLEPRRC-------DFFINKNVRDVGCGSRHTVFVLDDGTVYTCGCNDLGQLGHDKSRRKPEQVGALD----AQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIG-----LSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKDSDIFSWGQNQYGQLGLGLEIKKECAPRHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETD-RNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 65.0846 bits (157), Expect = 3.118e-10
Identity = 59/237 (24.89%), Postives = 94/237 (39.66%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG-------SIIGDTNPNFKLDLPCF-AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLC-LDEINQIFCWGYG 838
            +F+WG   + Q  L    + I +    ++    D  I  + CG  HS+ L+++  ++ WG N   QLG G         + I   C      ++ +  +   +I+ GG  +   T    I  +G        +  +T+ N    L    +  I  I CG+ H   L   G V  FG   YGQ+G       +S      PR V       V +IA G  HTL  +    +I+ +G G
Sbjct:  105 VFSWGHAVYGQIGLSTAEEYIRVPRNIKSLS--DVQIVQVACGHHHSLALSKDSDIFSWGQNQYGQLGLG---------LEIKKECAP--RHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETDRNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFGAGGYGQLG------HNSTNHEVNPRKVFELMGSIVTQIACGRQHTLAFVPSSGRIYSFGLG 322          

HSP 3 Score: 54.6842 bits (130), Expect = 5.361e-7
Identity = 38/171 (22.22%), Postives = 78/171 (45.61%), Query Frame = 2
Query:  644 VACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVIN--GH---IMQPSHMPGI-YEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            + C+G   +GQ+G+   D     E V  PR         V  +  G+ HT+ + +   ++  G    C  +   GH     +P  +  +  + I+ +  G  H+L L +  ++F+ G  V+GQ   +    ++  P  IK   + ++  + C +H+S A ++  +++ WG+
Sbjct:    1 MLCWGNTSFGQLGLGGID----EEVVLEPRRCDFFINKNVRDVGCGSRHTVFVLDDGTVYTCG----CNDLGQLGHDKSRRKPEQVGALDAQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIGLSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKDSDIFSWGQ 163          
BLAST of FYVE-type domain-containing protein vs. Ensembl Xenopus
Match: prxl2b (peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-968463])

HSP 1 Score: 95.5153 bits (236), Expect = 1.393e-19
Identity = 83/284 (29.23%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPN--FKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G    I    +  P  C       +F  +  ++++ CG   T+F        T  CN + + G       P     LD    A  I  +SCG+ H + L   GQV  +G  +YGQIG     L ++ E +  PR + S    +++++A G +H+L L + + IF WG   YG L  G+       P H+  +   P   +  G  HS  LT S  IF  G N FGQ          N P  +K     K+ +I C   ++AA T++  V+ +G
Sbjct:    4 WGNTSFGQLGLGG---IDEEVVLEPRRC-------DFFINKNVRDVGCGSRHTVFVLDDGTVYTCGCNDLGQLGHDKSRRKPEQVGALD----AQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIG-----LSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKDSDIFSWGQNQYGQLGLGLEIKKECAPRHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETD-RNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 64.6994 bits (156), Expect = 4.237e-10
Identity = 59/237 (24.89%), Postives = 94/237 (39.66%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG-------SIIGDTNPNFKLDLPCF-AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLC-LDEINQIFCWGYG 838
            +F+WG   + Q  L    + I +    ++    D  I  + CG  HS+ L+++  ++ WG N   QLG G         + I   C      ++ +  +   +I+ GG  +   T    I  +G        +  +T+ N    L    +  I  I CG+ H   L   G V  FG   YGQ+G       +S      PR V       V +IA G  HTL  +    +I+ +G G
Sbjct:  105 VFSWGHAVYGQIGLSTAEEYIRVPRNIKSLS--DVQIVQVACGHHHSLALSKDSDIFSWGQNQYGQLGLG---------LEIKKECAP--RHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETDRNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFGAGGYGQLG------HNSTNHEVNPRKVFELMGSIVTQIACGRQHTLAFVPSSGRIYSFGLG 322          

HSP 3 Score: 54.6842 bits (130), Expect = 5.079e-7
Identity = 38/169 (22.49%), Postives = 77/169 (45.56%), Query Frame = 2
Query:  650 CFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVIN--GH---IMQPSHMPGI-YEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            C+G   +GQ+G+   D     E V  PR         V  +  G+ HT+ + +   ++  G    C  +   GH     +P  +  +  + I+ +  G  H+L L +  ++F+ G  V+GQ   +    ++  P  IK   + ++  + C +H+S A ++  +++ WG+
Sbjct:    3 CWGNTSFGQLGLGGID----EEVVLEPRRCDFFINKNVRDVGCGSRHTVFVLDDGTVYTCG----CNDLGQLGHDKSRRKPEQVGALDAQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIGLSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKDSDIFSWGQ 163          
BLAST of FYVE-type domain-containing protein vs. Ensembl Xenopus
Match: prxl2b (peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-968463])

HSP 1 Score: 95.1301 bits (235), Expect = 1.606e-19
Identity = 83/284 (29.23%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPN--FKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G    I    +  P  C       +F  +  ++++ CG   T+F        T  CN + + G       P     LD    A  I  +SCG+ H + L   GQV  +G  +YGQIG     L ++ E +  PR + S    +++++A G +H+L L + + IF WG   YG L  G+       P H+  +   P   +  G  HS  LT S  IF  G N FGQ          N P  +K     K+ +I C   ++AA T++  V+ +G
Sbjct:    4 WGNTSFGQLGLGG---IDEEVVLEPRRC-------DFFINKNVRDVGCGSRHTVFVLDDGTVYTCGCNDLGQLGHDKSRRKPEQVGALD----AQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIG-----LSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKDSDIFSWGQNQYGQLGLGLEIKKECAPRHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETD-RNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 64.6994 bits (156), Expect = 4.047e-10
Identity = 59/237 (24.89%), Postives = 94/237 (39.66%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG-------SIIGDTNPNFKLDLPCF-AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLC-LDEINQIFCWGYG 838
            +F+WG   + Q  L    + I +    ++    D  I  + CG  HS+ L+++  ++ WG N   QLG G         + I   C      ++ +  +   +I+ GG  +   T    I  +G        +  +T+ N    L    +  I  I CG+ H   L   G V  FG   YGQ+G       +S      PR V       V +IA G  HTL  +    +I+ +G G
Sbjct:  105 VFSWGHAVYGQIGLSTAEEYIRVPRNIKSLS--DVQIVQVACGHHHSLALSKDSDIFSWGQNQYGQLGLG---------LEIKKECAP--RHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETDRNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFGAGGYGQLG------HNSTNHEVNPRKVFELMGSIVTQIACGRQHTLAFVPSSGRIYSFGLG 322          

HSP 3 Score: 54.6842 bits (130), Expect = 6.337e-7
Identity = 38/169 (22.49%), Postives = 77/169 (45.56%), Query Frame = 2
Query:  650 CFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVIN--GH---IMQPSHMPGI-YEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            C+G   +GQ+G+   D     E V  PR         V  +  G+ HT+ + +   ++  G    C  +   GH     +P  +  +  + I+ +  G  H+L L +  ++F+ G  V+GQ   +    ++  P  IK   + ++  + C +H+S A ++  +++ WG+
Sbjct:    3 CWGNTSFGQLGLGGID----EEVVLEPRRCDFFINKNVRDVGCGSRHTVFVLDDGTVYTCG----CNDLGQLGHDKSRRKPEQVGALDAQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIGLSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKDSDIFSWGQ 163          
BLAST of FYVE-type domain-containing protein vs. Ensembl Xenopus
Match: prxl2b (peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-968463])

HSP 1 Score: 95.1301 bits (235), Expect = 1.769e-19
Identity = 83/284 (29.23%), Postives = 125/284 (44.01%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPN--FKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G    I    +  P  C       +F  +  ++++ CG   T+F        T  CN + + G       P     LD    A  I  +SCG+ H + L   GQV  +G  +YGQIG     L ++ E +  PR + S    +++++A G +H+L L + + IF WG   YG L  G+       P H+  +   P   +  G  HS  LT S  IF  G N FGQ          N P  +K     K+ +I C   ++AA T++  V+ +G
Sbjct:    4 WGNTSFGQLGLGG---IDEEVVLEPRRC-------DFFINKNVRDVGCGSRHTVFVLDDGTVYTCGCNDLGQLGHDKSRRKPEQVGALD----AQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIG-----LSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKDSDIFSWGQNQYGQLGLGLEIKKECAPRHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETD-RNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 65.0846 bits (157), Expect = 3.621e-10
Identity = 59/237 (24.89%), Postives = 94/237 (39.66%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG-------SIIGDTNPNFKLDLPCF-AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLC-LDEINQIFCWGYG 838
            +F+WG   + Q  L    + I +    ++    D  I  + CG  HS+ L+++  ++ WG N   QLG G         + I   C      ++ +  +   +I+ GG  +   T    I  +G        +  +T+ N    L    +  I  I CG+ H   L   G V  FG   YGQ+G       +S      PR V       V +IA G  HTL  +    +I+ +G G
Sbjct:  105 VFSWGHAVYGQIGLSTAEEYIRVPRNIKSLS--DVQIVQVACGHHHSLALSKDSDIFSWGQNQYGQLGLG---------LEIKKECAP--RHIKSLSGIPFAHIAAGGGHSFALTISGAIFGWGRNKFGQLGLTDETDRNVPALLKSLRSQKIIHICCGEDHTAALTKEGGVFTFGAGGYGQLG------HNSTNHEVNPRKVFELMGSIVTQIACGRQHTLAFVPSSGRIYSFGLG 322          

HSP 3 Score: 54.299 bits (129), Expect = 6.974e-7
Identity = 38/169 (22.49%), Postives = 77/169 (45.56%), Query Frame = 2
Query:  650 CFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVIN--GH---IMQPSHMPGI-YEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            C+G   +GQ+G+   D     E V  PR         V  +  G+ HT+ + +   ++  G    C  +   GH     +P  +  +  + I+ +  G  H+L L +  ++F+ G  V+GQ   +    ++  P  IK   + ++  + C +H+S A ++  +++ WG+
Sbjct:    3 CWGNTSFGQLGLGGID----EEVVLEPRRCDFFINKNVRDVGCGSRHTVFVLDDGTVYTCG----CNDLGQLGHDKSRRKPEQVGALDAQIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIGLSTAEEYIRVPRNIKSLSDVQIVQVACGHHHSLALSKDSDIFSWGQ 163          
BLAST of FYVE-type domain-containing protein vs. Ensembl Mouse
Match: Herc4 (hect domain and RLD 4 [Source:MGI Symbol;Acc:MGI:1914595])

HSP 1 Score: 95.1301 bits (235), Expect = 1.288e-19
Identity = 80/285 (28.07%), Postives = 127/285 (44.56%), Query Frame = 2
Query:  329 WGNNNQNQLGEG---YNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G      +++P R +             FV+   ++++ CG   T+F        T  CN + + G       P   + L   A +I  ++CG+ H + L   GQV  +G +  GQ+G     L  S E +  PR + S    +++++A G YH+L L + +++FCWG   YG L  G+       P  +  +   P + +  G  HS  LT S  IF  G N FGQ   N        P  +K     K+  I C   ++AA T++  V+ +G
Sbjct:    4 WGNASYGQLGLGGIDEEIVLEPRRSDF------------FVNKK-VRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALD--AQNIVAVACGEAHTLALNDKGQVYAWGLDSDGQLG-----LQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND-RYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 73.559 bits (179), Expect = 5.759e-13
Identity = 75/342 (21.93%), Postives = 149/342 (43.57%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN-HYSAAKTEKDEVYMWG 1135
            +  WG+  + Q  L   ++ I ++    +   +++ ++ + CG  H+V +  +G VY  G N+  QLG   ++  KP ++               +D+  I  ++CG   T+       +  +G      +G       + +P    S+S     +++CG  H + L  + +V C+G+N YGQ+G+    +D   +T  +P+++ S      +++A G  H+  L     IF WG     G +  +     ++P +      + I+ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + VT + C   H SA       +Y +G
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVLE-PRRSDFFVNKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR-KKPEQVVA-------------LDAQNIVAVACGEAHTLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGL---GIDCQKQT--SPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRN-KFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEIN-PRKVFELMGSIVTQVACGRQHTSAFVPSSGRIYSFG 320          
BLAST of FYVE-type domain-containing protein vs. Ensembl Mouse
Match: Herc4 (hect domain and RLD 4 [Source:MGI Symbol;Acc:MGI:1914595])

HSP 1 Score: 95.1301 bits (235), Expect = 1.399e-19
Identity = 80/285 (28.07%), Postives = 127/285 (44.56%), Query Frame = 2
Query:  329 WGNNNQNQLGEG---YNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G      +++P R +             FV+   ++++ CG   T+F        T  CN + + G       P   + L   A +I  ++CG+ H + L   GQV  +G +  GQ+G     L  S E +  PR + S    +++++A G YH+L L + +++FCWG   YG L  G+       P  +  +   P + +  G  HS  LT S  IF  G N FGQ   N        P  +K     K+  I C   ++AA T++  V+ +G
Sbjct:    4 WGNASYGQLGLGGIDEEIVLEPRRSDF------------FVNKK-VRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALD--AQNIVAVACGEAHTLALNDKGQVYAWGLDSDGQLG-----LQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND-RYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 73.559 bits (179), Expect = 6.624e-13
Identity = 75/342 (21.93%), Postives = 149/342 (43.57%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN-HYSAAKTEKDEVYMWG 1135
            +  WG+  + Q  L   ++ I ++    +   +++ ++ + CG  H+V +  +G VY  G N+  QLG   ++  KP ++               +D+  I  ++CG   T+       +  +G      +G       + +P    S+S     +++CG  H + L  + +V C+G+N YGQ+G+    +D   +T  +P+++ S      +++A G  H+  L     IF WG     G +  +     ++P +      + I+ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + VT + C   H SA       +Y +G
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVLE-PRRSDFFVNKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR-KKPEQVVA-------------LDAQNIVAVACGEAHTLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGL---GIDCQKQT--SPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRN-KFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEIN-PRKVFELMGSIVTQVACGRQHTSAFVPSSGRIYSFG 320          
BLAST of FYVE-type domain-containing protein vs. Ensembl Mouse
Match: Sergef (secretion regulating guanine nucleotide exchange factor [Source:MGI Symbol;Acc:MGI:1351630])

HSP 1 Score: 87.4261 bits (215), Expect = 7.230e-18
Identity = 73/296 (24.66%), Postives = 128/296 (43.24%), Query Frame = 2
Query:  320 VYGWGNNNQNQLGEGYNK-IIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCII-----KYGSI-IGDTNPNFKLDL--PCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLP------CGVINGHIM----QPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISH 1147
            ++ WG N+  QLG G+ + +  P +++            +F  +  IK+++ GG  +   T    +      K G + +G T    +  +  P     I +++CG    ++L   GQV   G N +GQ+G+P       V     P+ +      +V+ +A G  H L       +F WG GL       C   N  +     +PS + G+     +    GS+HS  LT++ +++  G N  GQ A    +  L   +E   F + KVT ++    +  AKTE  +V+ WG+  +
Sbjct:   17 LFAWGANSYGQLGLGHKEDVFLPQQLS------------DFCQAGCIKSVTGGGGHSAVVTDGGDLFVCGLNKDGQLGLGHTEEVLRFTICKPLRGCPIRQVACGWDFTIMLTEKGQVLSCGSNAFGQLGVPHGPRKCVV-----PQAIEC-LREKVVCVAAGLRHALATTATGSVFQWGTGLASSGRRLCPGQNLPLFLTAKEPSRVTGLENSTAVCAVAGSDHSASLTDTGELYVWGRNKHGQLASRAVFLPLPQRIEAHYFQDEKVTAVWSGWTHLVAKTETGKVFTWGRADY 294          
BLAST of FYVE-type domain-containing protein vs. Ensembl Mouse
Match: Sergef (secretion regulating guanine nucleotide exchange factor [Source:MGI Symbol;Acc:MGI:1351630])

HSP 1 Score: 87.0409 bits (214), Expect = 1.626e-17
Identity = 74/296 (25.00%), Postives = 128/296 (43.24%), Query Frame = 2
Query:  320 VYGWGNNNQNQLGEGYNK-IIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCII-----KYGSI-IGDTNP--NFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLP------CGVINGHIM----QPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISH 1147
            ++ WG N+  QLG G+ + +  P +++            +F  +  IK+++ GG  +   T    +      K G + +G T     F +  P     I +++CG    ++L   GQV   G N +GQ+G+P       V     P+ +      +V+ +A G  H L       +F WG GL       C   N  +     +PS + G+     +    GS+HS  LT++ +++  G N  GQ A    +  L   +E   F + KVT ++    +  AKTE  +V+ WG+  +
Sbjct:   17 LFAWGANSYGQLGLGHKEDVFLPQQLS------------DFCQAGCIKSVTGGGGHSAVVTDGGDLFVCGLNKDGQLGLGHTEEVLRFTICKPLRGCPIRQVACGWDFTIMLTEKGQVLSCGSNAFGQLGVPHGPRKCVV-----PQAIEC-LREKVVCVAAGLRHALATTATGSVFQWGTGLASSGRRLCPGQNLPLFLTAKEPSRVTGLENSTAVCAVAGSDHSASLTDTGELYVWGRNKHGQLASRAVFLPLPQRIEAHYFQDEKVTAVWSGWTHLVAKTETGKVFTWGRADY 294          
BLAST of FYVE-type domain-containing protein vs. Ensembl Mouse
Match: Rpgr (retinitis pigmentosa GTPase regulator [Source:MGI Symbol;Acc:MGI:1344037])

HSP 1 Score: 87.8113 bits (216), Expect = 2.643e-17
Identity = 86/327 (26.30%), Postives = 139/327 (42.51%), Query Frame = 2
Query:  215 ISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYN-KIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------IIGDTNPNFKLDLPCF---AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG------YGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISH 1147
            I  K  F+N +PI      + CG  H+ ++T    +Y +G+NN  QLG G    IIKP       TC K       +    +K  +CG   T+ +T    +   G        +GDT+         F   A +I ++S G      L   G++  +G N  GQIG+  K        V  P  VT      +  I+ G YH+  +    +++ +G       GLP  ++  H   P  + GI E +I +  G  H++ LT  + ++A G   FGQ          + P  I++  + K+ +I C  +++A  TE   +Y +G   H
Sbjct:   64 IPSKFWFKNDIPI-----CLSCGDEHTAIVTGNNKLYMFGSNNWGQLGLGSKAAIIKP-------TCIKA------LKPEKVKLAACGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTEDGKLFMWGDNSEGQIGLEDKS------NVCIPHEVT--VGKPISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNH-RSPQRVLGIPERVIQVACGGGHTVVLTE-KVVYAFGLGQFGQLGLGTFLFETSEPKIIERIKDQKICHISCGENHTALMTELGLLYTFGDGRH 362          

HSP 2 Score: 65.4698 bits (158), Expect = 2.111e-10
Identity = 57/238 (23.95%), Postives = 105/238 (44.12%), Query Frame = 2
Query:  161 AWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------------IIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG 838
            A G+NE    L D +++    ++ F    P D  IK +  G++ S  LT +G ++ WG+N++ Q+G     +   + + IPH  T  +          I  ISCG   + F T    +  +G             ++   +P   L +P     + +++CG  H V +L+   V  FG   +GQ+G     L + +   S P+++      ++  I+ G  HT  + E+  ++ +G G
Sbjct:  149 AGGNNEGQLGLGDTDDRDTFHQIVF--FTPAD-TIKQLSAGANTSAALTEDGKLFMWGDNSEGQIG-----LEDKSNVCIPHEVTVGKP---------ISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSPQRVLGIP---ERVIQVACGGGHTV-VLTEKVVYAFGLGQFGQLG-----LGTFLFETSEPKIIERIKDQKICHISCGENHTALMTELGLLYTFGDG 360          

HSP 3 Score: 55.4546 bits (132), Expect = 2.591e-7
Identity = 53/229 (23.14%), Postives = 88/229 (38.43%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKII---KPTRI-NIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSISK-----ISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCL 802
            LF WG N   Q  L+D +          + V + + I +I CG  HS  +T +G +Y +G     +LG     ++    P R+  IP    +               ++CGG  T+  T    +  +G      +G     F+   P     I       ISCG+ H  L+   G +  FG   +G++G+  ++  +       P + ++     V  IA G  H L  
Sbjct:  199 LFMWGDNSEGQIGLEDKSNVC-----IPHEVTVGKPISWISCGYYHSAFVTMDGELYTFGEPENGKLGLPNELLMNHRSPQRVLGIPERVIQ---------------VACGGGHTVVLTE-KVVYAFGLGQFGQLGLGTFLFETSEPKIIERIKDQKICHISCGENHTALMTELGLLYTFGDGRHGKLGLGMENFTNQF----FPTLCSNFLRFAVQLIACGGCHMLVF 402          
BLAST of FYVE-type domain-containing protein vs. UniProt
Match: sp|Q947D2|PRAF1_ARATH (PH, RCC1 and FYVE domains-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PRAF1 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 5.314e-21
Identity = 94/327 (28.75%), Postives = 142/327 (43.43%), Query Frame = 2
Query:  248 PIDQNI----KYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFT----THCNCIIKYGSIIGDTNPNFKLDLPCFAGS-----ISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEI------------NQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIID-----LDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            P++ NI      I CG  H+  +TR+G ++ WG  +  +LG G  K +   R+    T T   S ++FV        +      ++T    TH   ++ +GS I    P         AGS     ++ +SCG  H  L+ S G++  FG   +G +G   K      ETV  PR V S    R I ++ G +HT  + EI             ++F WG G    + +G    P   P     +ID     +  G + ++ LT S ++F +GS V+GQ         L   VE K   E  V  I C  ++ AA T ++EVY WGK
Sbjct:  274 PLESNIVLDVHQIACGVRHAAFVTRQGEIFTWGEESGGRLGHGIGKDVFHPRLVESLTAT---SSVDFVACGEFHTCAVTLAGELYTWGDGTHNVGLLGHGSDISHWIPKR------IAGSLEGLHVASVSCGPWHTALITSYGRLFTFGDGTFGVLGHGDK------ETVQYPREVESLSGLRTIAVSCGVWHTAAVVEIIVTQSNSSSVSSGKLFTWGDGDKNRLGHGD-KDPRLKPTCVPALIDYNFHKIACGHSLTVGLTTSGQVFTMGSTVYGQLGNLQTDGKLPCLVEDKLASEF-VEEISCGAYHVAALTSRNEVYTWGK 583          

HSP 2 Score: 63.1586 bits (152), Expect = 8.508e-9
Identity = 66/279 (23.66%), Postives = 111/279 (39.78%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLL---DDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFT------IFTTHCNCIIKYGSII------------GDTNPNFKLDLPCFAGSIS----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIK-IATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIID 913
            L+ WG   HN  LL    D +  I  ++          ++  + CG  H+ ++T  G ++ +G+     LG G  + ++  R            ++E +  +    +SCG   T      I T   +  +  G +             GD +P  +L   C    I     KI+CG    V L +SGQV   G  +YGQ+G  + D          P +V    A   ++ I+ G YH   L   N+++ WG G    + +G  ++   +P I E + D
Sbjct:  355 LYTWGDGTHNVGLLGHGSDISHWIPKRIAGSLE---GLHVASVSCGPWHTALITSYGRLFTFGDGTFGVLGHGDKETVQYPR------------EVESLSGLRTIAVSCGVWHTAAVVEIIVTQSNSSSVSSGKLFTWGDGDKNRLGHGDKDP--RLKPTCVPALIDYNFHKIACGHSLTVGLTTSGQVFTMGSTVYGQLGNLQTD-------GKLPCLVEDKLASEFVEEISCGAYHVAALTSRNEVYTWGKGANGRLGHGD-LEDRKVPTIVEALKD 608          

HSP 3 Score: 53.1434 bits (126), Expect = 8.767e-6
Identity = 47/174 (27.01%), Postives = 73/174 (41.95%), Query Frame = 2
Query:  314 GHVYGWGNNNQNQLGEG-YNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLD--LPCFAGS------ISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHT--LCL 802
            G ++ WG+ ++N+LG G  +  +KPT       C        F        I+CG + T+  T    +   GS +     N + D  LPC          + +ISCG  HV  L S  +V  +GK   G++G         +E    P +V +     V  IA G+ +T  +CL
Sbjct:  472 GKLFTWGDGDKNRLGHGDKDPRLKPT-------CVPALIDYNF------HKIACGHSLTVGLTTSGQVFTMGSTVYGQLGNLQTDGKLPCLVEDKLASEFVEEISCGAYHVAALTSRNEVYTWGKGANGRLG------HGDLEDRKVPTIVEALKDRHVKYIACGSNYTAAICL 626          
BLAST of FYVE-type domain-containing protein vs. UniProt
Match: sp|Q5PQN1|HERC4_RAT (Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus OX=10116 GN=Herc4 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 3.445e-19
Identity = 80/282 (28.37%), Postives = 123/282 (43.62%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G           I         K +F  +  ++++ CG   T+F        T  CN + + G       P   + L   A +I  +SCG+ H + L   GQV  +G +  GQ+G     L  S E +  PR + S    +++++A G YH+L L + +++FCWG   YG L  G+       P  +  +   P + +  G  HS  LT S  IF  G N FGQ   N        P  +K     K+  I C   ++AA T++  V+ +G
Sbjct:    4 WGNASYGQLGLG----------GIDEEIVLEPRKSDFFVNKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALD--AQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLG-----LQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIECQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND-RYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 75.0998 bits (183), Expect = 1.615e-12
Identity = 76/342 (22.22%), Postives = 148/342 (43.27%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN-HYSAAKTEKDEVYMWG 1135
            +  WG+  + Q  L   ++ I ++   ++   +++ ++ + CG  H+V +  +G VY  G N+  QLG   ++  KP ++               +D+  I  +SCG   T+       +  +G      +G       + +P    S+S     +++CG  H + L  + +V C+G+N YGQ+G     L    +  ++P+++ S      +++A G  H+  L     IF WG     G +  +     ++P +      + I+ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + VT I C   H SA       +Y +G
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVLE-PRKSDFFVNKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR-KKPEQVVA-------------LDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLG-----LGIECQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRN-KFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEIN-PRKVFELMGSIVTQIACGRQHTSAFVPSSGRIYSFG 320          
BLAST of FYVE-type domain-containing protein vs. UniProt
Match: sp|Q6PAV2|HERC4_MOUSE (Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 9.783e-19
Identity = 80/285 (28.07%), Postives = 127/285 (44.56%), Query Frame = 2
Query:  329 WGNNNQNQLGEG---YNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G      +++P R +             FV+   ++++ CG   T+F        T  CN + + G       P   + L   A +I  ++CG+ H + L   GQV  +G +  GQ+G     L  S E +  PR + S    +++++A G YH+L L + +++FCWG   YG L  G+       P  +  +   P + +  G  HS  LT S  IF  G N FGQ   N        P  +K     K+  I C   ++AA T++  V+ +G
Sbjct:    4 WGNASYGQLGLGGIDEEIVLEPRRSDF------------FVNKK-VRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALD--AQNIVAVACGEAHTLALNDKGQVYAWGLDSDGQLG-----LQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND-RYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 73.559 bits (179), Expect = 4.634e-12
Identity = 75/342 (21.93%), Postives = 149/342 (43.57%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN-HYSAAKTEKDEVYMWG 1135
            +  WG+  + Q  L   ++ I ++    +   +++ ++ + CG  H+V +  +G VY  G N+  QLG   ++  KP ++               +D+  I  ++CG   T+       +  +G      +G       + +P    S+S     +++CG  H + L  + +V C+G+N YGQ+G+    +D   +T  +P+++ S      +++A G  H+  L     IF WG     G +  +     ++P +      + I+ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + VT + C   H SA       +Y +G
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVLE-PRRSDFFVNKKVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR-KKPEQVVA-------------LDAQNIVAVACGEAHTLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGL---GIDCQKQT--SPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRN-KFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEIN-PRKVFELMGSIVTQVACGRQHTSAFVPSSGRIYSFG 320          
BLAST of FYVE-type domain-containing protein vs. UniProt
Match: sp|Q5GLZ8|HERC4_HUMAN (Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.493e-18
Identity = 80/282 (28.37%), Postives = 122/282 (43.26%), Query Frame = 2
Query:  329 WGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF--------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YG-LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            WGN +  QLG G           I         K +F  +  ++++ CG   T+F        T  CN + + G       P   + L   A +I  +SCG+ H + L   GQV  +G +  GQ+G     L  S E +  PR + S    +++++A G YH+L L + +++FCWG   YG L  G        P  +  +   P + +  G  HS  LT S  IF  G N FGQ   N        P  +K     K+  I C   ++AA T++  V+ +G
Sbjct:    4 WGNASFGQLGLG----------GIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALD--AQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLG-----LVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGLNDEND-RYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFG 267          

HSP 2 Score: 75.0998 bits (183), Expect = 1.409e-12
Identity = 77/342 (22.51%), Postives = 148/342 (43.27%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIY-----EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCC-NHYSAAKTEKDEVYMWG 1135
            +  WG+    Q  L   ++ I ++   ++   I++ ++ + CG  H+V +  +G VY  G N+  QLG   ++  KP ++               +D+  I  +SCG   T+       +  +G      +G       + +P    S+S     +++CG  H + L  + +V C+G+N YGQ+G     L +  +  ++P+++ S      +++A G  H+  L     IF WG     G +  +     ++P +      + I+ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   + VT I C   H SA       +Y +G
Sbjct:    1 MLCWGNASFGQLGLGGIDEEIVLE-PRKSDFFINKRVRDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSR-KKPEQVVA-------------LDAQNIVAVSCGEAHTLALNDKGQVYAWGLDSDGQLGLVGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLG-----LGTDCKKQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRN-KFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSHEIN-PRKVFELMGSIVTEIACGRQHTSAFVPSSGRIYSFG 320          
BLAST of FYVE-type domain-containing protein vs. UniProt
Match: sp|Q9FN03|UVR8_ARATH (Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 3.163e-17
Identity = 76/308 (24.68%), Postives = 133/308 (43.18%), Query Frame = 2
Query:  260 NIKYIKCGSSHSVMLTREG-HVYGWGNNNQNQLGEG-YNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------IIGDTNPNF-KLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPII-DLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
             I  + CG+ H+V  ++ G  VY WG  +  +LG G  + +  P  I   H              + IK I+CG +  +  T    +  +G        +GDT  +     +  F G  I  ++ G  H   +   G +  +G   YG +G+  +  D  V     P  VTS    ++  +A G  HT+ +     ++ +G+     L  G +  H++ P  +  +    I  + GG  H++ LT+  K++  G N FGQ           SPV+++  D+ KV  + C   ++ A TE++ V+ WG+
Sbjct:   68 QIVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALH-------------GIRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGDR-TDRLV-----PERVTSTGGEKMSMVACGWRHTISVSYSGALYTYGWSKYGQLGHGDLEDHLI-PHKLEALSNSFISQISGGWRHTMALTSDGKLYGWGWNKFGQVGVGNNLDQC-SPVQVRFPDDQKVVQVSCGWRHTLAVTERNNVFAWGR 354          

HSP 2 Score: 69.3218 bits (168), Expect = 4.792e-11
Identity = 65/269 (24.16%), Postives = 112/269 (41.64%), Query Frame = 2
Query:  260 NIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCII-----KYGSI-IGDTNPNFKLDLPCFAGS--ISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEP----IIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAA------PNFP 1012
             IK I CG SH + +T EG V  WG N   QLG G  +             + +  K++  + + IK ++ G   T   T    +      +YG++ +GD       +     G   +S ++CG  H + +  SG +  +G + YGQ+G    DL+  +     P  + +     + +I+ G  HT+ L    +++ WG+     V  G+ +       +  P    ++ +  G  H+L +T    +FA G    GQ         NFP
Sbjct:  121 RIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGLGDTED------------SLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGALYTYGWSKYGQLG--HGDLEDHL----IPHKLEALSNSFISQISGGWRHTMALTSDGKLYGWGWNKFGQVGVGNNLDQCSPVQVRFPDDQKVVQVSCGWRHTLAVTERNNVFAWGRGTNGQLGIGESVDRNFP 371          

HSP 3 Score: 67.781 bits (164), Expect = 1.285e-10
Identity = 65/306 (21.24%), Postives = 124/306 (40.52%), Query Frame = 2
Query:  257 QNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCII------KYGSIIGDTNPNFKLDLPCFAG---SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            + +  I  G+SHSV L     V  WG     QLG G +   +P+            ++L  +D   I +++CG   T+  +     +       +G +    + +    LP  A     I +I+CG  H + +   G+V  +G+N  GQ+G+         E    P+ + +    R+  +A G  HT  + E   ++ WG+G    L  G     ++         E +  +  G  H++ ++ S  ++  G + +GQ         L  P +++    + ++ I     ++ A T   ++Y WG
Sbjct:   15 RKVLIISAGASHSVALLSGDIVCSWGRGEDGQLGHG-DAEDRPS-----------PTQLSALDGHQIVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHCLAVTMEGEVQSWGRNQNGQLGL------GDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGALYTYGWSKYGQLGHGDLEDHL-IPHKLEALSNSFISQISGGWRHTMALTSDGKLYGWG 301          
BLAST of FYVE-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23894741 (tr|K1S4M2|K1S4M2_CRAGI X-linked retinitis pigmentosa GTPase regulator OS=Crassostrea gigas OX=29159 GN=CGI_10018272 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 3.168e-32
Identity = 107/403 (26.55%), Postives = 178/403 (44.17%), Query Frame = 2
Query:  155 LFAWGSNEHNQ----CLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKI-IKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGS--------------------ISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFD-ENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINNMISDNYGINSLQ---FGSWHVVGV 1276
            + +WG  E  Q    C  D     ++  +G    + +   +K++ CG+SH++++     +Y WGN N  QLG    ++  +P R+++        + +   D   +  ++CGG  ++       +  +G+       NF   L     S                    + +ISCG+ H +     G +AC G N  GQIG      + ++E V+ P +V    A  V  +A+G  H L +     +F WGYG  CG  N  I+ P  +P +   ++++ GG+ HSL L+ S  I+  GS + GQ        F + P ++K  +    V  I    +YS A TE   +++WGK SH+I  D  ++  F  PF I        N G+  +Q    GSWH V +
Sbjct:   17 VISWGCGEFGQHCHRCKED-----VAFSIGLLKEI-LPGQVKFVACGASHTILVNDSNEIYSWGNGNSGQLGTNVKELQWQPERVHLYDN-----NPVTLPD---VAGVACGGRHSMVWLSNGNVFSFGN-------NFHAQLGYDYRSKNYKENQVKPHLLKILIHRPVVQISCGEKHSLFRFQDGTIACVGSNANGQIG------NGTLEEVTVPVLV--EIADPVKYVASGANHNLAITCQGDVFMWGYGKGCGNKNKDILSPEKVP-LKRKVVEVSGGATHSLALSGSGNIYVWGSGLDGQLGLGNSNTFQSFPKKLKHPELRRSVVKIQAGEYYSTAITESGSLFIWGKNSHVIRPDKPSNAKFWLPFHI--------NKGLGPIQKVFCGSWHAVAI 381          
BLAST of FYVE-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20331662 (tr|A0A1S3I914|A0A1S3I914_LINUN uncharacterized protein LOC106162140 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106162140 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 6.158e-32
Identity = 111/400 (27.75%), Postives = 181/400 (45.25%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFEN--RVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINI------PHTCTKLESKLEFVDSVLIKNISCGGTFT--------IFTTHCNCIIKYGSII-------GDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHM--PGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKK-FDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINNMISDNYGINSLQFGSWHVVGV 1276
            L  WG  E  Q       + +S + G  +  R  +  N+K + CG+SH+V++T    +Y WGN +  QLG G NK  +PT   I      P   T+  S        +++ ++CG   T        +F+   N   + G  +           P+F   L      +++++CG+ H + L  +G VA  G N+ GQIG      +S +E +     + +      ++IA G+ H+L LD    +F WG G PCG   G I+ P+ +  P     I+ + GGS HSL LT    +++ G+   GQ        FL+ P  +++   +  V +I     YSAA T    ++MWGK +H IT D   +  F +P  +           I+ ++ G+WH V +
Sbjct:  185 LICWGCGEFGQ-HGHTQKEDVSSQSGLLDVFRGDVSMNVKAMACGASHTVVVTNSNAIYVWGNGSSGQLGTG-NKESQPTPTKITLHITPPAPATRSTS--------VVQGVACGARHTFIWLENGQVFSFGNNFFAQLGYDVRVKGYKDNQVRPHFIRALSYRV--VTQVACGEKHTLFLFETGAVAAVGANLSGQIGN-----NSRMEAIVP---IVNEDIDNAVQIAAGSNHSLVLDANGAVFVWGAGKPCGKKKGDILVPTQIQFPNC-RTIVQVSGGSMHSLALTAGGYVYSWGAGTDGQLGHGKGVTFLDIPKRLQEPVLQACVVHIAASEVYSAAVTGDGSLFMWGKNNHTITCDEHPAMRFFQPTHVDPGGQ-----SISQVELGAWHAVAM 558          
BLAST of FYVE-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|16991619 (tr|A0A1S3IBF0|A0A1S3IBF0_LINUN uncharacterized protein LOC106162140 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106162140 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 7.429e-32
Identity = 112/403 (27.79%), Postives = 182/403 (45.16%), Query Frame = 2
Query:  155 LFAWGSNE---HNQCLLDDNNKTISMKLGFEN--RVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINI------PHTCTKLESKLEFVDSVLIKNISCGGTFT--------IFTTHCNCIIKYGSII-------GDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHM--PGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKK-FDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINNMISDNYGINSLQFGSWHVVGV 1276
            L  WG  E   H     +D    +S + G  +  R  +  N+K + CG+SH+V++T    +Y WGN +  QLG G NK  +PT   I      P   T+  S        +++ ++CG   T        +F+   N   + G  +           P+F   L      +++++CG+ H + L  +G VA  G N+ GQIG      +S +E +     + +      ++IA G+ H+L LD    +F WG G PCG   G I+ P+ +  P     I+ + GGS HSL LT    +++ G+   GQ        FL+ P  +++   +  V +I     YSAA T    ++MWGK +H IT D   +  F +P  +           I+ ++ G+WH V +
Sbjct:  185 LICWGCGEFGQHGHTQKED----VSSQSGLLDVFRGDVSMNVKAMACGASHTVVVTNSNAIYVWGNGSSGQLGTG-NKESQPTPTKITLHITPPAPATRSTS--------VVQGVACGARHTFIWLENGQVFSFGNNFFAQLGYDVRVKGYKDNQVRPHFIRALSYRV--VTQVACGEKHTLFLFETGAVAAVGANLSGQIGN-----NSRMEAIVP---IVNEDIDNAVQIAAGSNHSLVLDANGAVFVWGAGKPCGKKKGDILVPTQIQFPNCRT-IVQVSGGSMHSLALTAGGYVYSWGAGTDGQLGHGKGVTFLDIPKRLQEPVLQACVVHIAASEVYSAAVTGDGSLFMWGKNNHTITCDEHPAMRFFQPTHVDPGGQ-----SISQVELGAWHAVAM 558          
BLAST of FYVE-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|174579168 (tr|A0A3Q2VBD2|A0A3Q2VBD2_HAPBU Uncharacterized protein OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.953e-31
Identity = 101/359 (28.13%), Postives = 162/359 (45.13%), Query Frame = 2
Query:  260 NIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIK-PTRINIPHTCTKLESKLE--FVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGD--TNPNFKLD--LPCF------AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSD---IFKEPFKISINNMISDNYGINSLQFGSWHVVGV 1276
            ++K + CGSSHSV++T +  ++ WGN    QLG G   + K P  + +P       S L+  F + V    I+CG   +   T    +  +G    + +G      +FK +   PC       +  IS+++CG+ H +  L  G VA  G+N YGQIG        S E    PR V       V K+  G  H L L    ++F WG G  CG   G+I+ P  +     P+ D+ GG  HSL LT+   +F+ G    GQ         +++P  +     ++V+ I   + YSAA T   ++ +WG+I  +    Y          +PF ++   +I       S+  G+WH++ +
Sbjct:   60 SVKLLACGSSHSVVVTVDNKIFAWGNGTSGQLGNGERAVKKQPVEVKLPQELNVRGSHLDGNFANVV---GIACGSRHSFIWTETGQVYSFGNNFYAQLGYDFQRADFKENQLAPCLFQNLPSSLKISQVACGERHTLFALEDGSVAACGQNDYGQIG------SGSNENAVVPRFVER--VDHVSKVTCGANHNLALTGDGKLFQWGCGRSCGSTKGNILSPEEVTLPDSPVKDIAGGCWHSLLLTDGGNVFSWGMGQEGQLGLGEDRLHVSTPSLLNSSQLSEVSQIRAGDSYSAAVTAGGDLLLWGQIPCVSRVTYHAGPKGLWTPQPFPLAGRKVI-------SVACGAWHIMAL 400          
BLAST of FYVE-type domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|176190714 (tr|A0A3P8NX31|A0A3P8NX31_ASTCA Uncharacterized protein OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.513e-31
Identity = 101/359 (28.13%), Postives = 162/359 (45.13%), Query Frame = 2
Query:  260 NIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIK-PTRINIPHTCTKLESKLE--FVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGD--TNPNFKLD--LPCF------AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSD---IFKEPFKISINNMISDNYGINSLQFGSWHVVGV 1276
            ++K + CGSSHSV++T +  ++ WGN    QLG G   + K P  + +P       S L+  F + V    I+CG   +   T    +  +G    + +G      +FK +   PC       +  IS+++CG+ H +  L  G VA  G+N YGQIG        S E    PR V       V K+  G  H L L    ++F WG G  CG   G+I+ P  +     P+ D+ GG  HSL LT+   +F+ G    GQ         +++P  +     ++V+ I   + YSAA T   ++ +WG+I  +    Y          +PF ++   +I       S+  G+WH++ +
Sbjct:   60 SVKLLACGSSHSVVVTVDNKIFAWGNGTSGQLGNGERAVKKQPVEVKLPQELNVRGSHLDGNFANVV---GIACGSRHSFIWTETGQVYSFGNNFYAQLGYDFQRADFKENQLAPCLFQNLPSSLKISQVACGERHTLFALEDGSVAACGQNDYGQIG------SGSNENAVVPRFVER--VDHVSKVTCGANHNLALTGDGKLFQWGCGRSCGSTKGNILSPEEVTLPDSPVKDIAGGCWHSLLLTDGGNVFSWGMGQEGQLGLGEDRLHVSTPSLLNSSQLSEVSQIRAGDSYSAAVTAGGDLLLWGQIPCVSRVTYHAGPKGLSTPQPFPLAGRKVI-------SVACGAWHIMAL 400          
BLAST of FYVE-type domain-containing protein vs. Ensembl Cavefish
Match: rpgrb (X-linked retinitis pigmentosa GTPase regulator-like [Source:NCBI gene;Acc:103026867])

HSP 1 Score: 92.0485 bits (227), Expect = 1.049e-18
Identity = 81/323 (25.08%), Postives = 144/323 (44.58%), Query Frame = 2
Query:  224 KLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFT-IFTTHCNCIIKYGSIIG-------DTNPNFKL-DLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG------YGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISH 1147
            K   +N +P+      + CG  H+ ++T  G ++ +G++N  QLG G       T +N P TC K       + S  +K ++CG T T ++T+  N     G+  G       +   +F L D     G I  ++ G      L+  G++  +G N  GQIG+ ++         +TPR ++     RV  ++ G YH+  +     +F +G       GL    +  H + P H+ GI + ++ +  G  H++ LT    +++ G   FGQ            P E++ F + +V +I C  +++A  TE   +Y +G   H
Sbjct:   30 KFWLKNDIPL-----KVACGDEHTALITESGKLFMFGSSNWGQLGLGIK-----TSVNKP-TCVKA------LKSEKVKLVACGRTHTLVYTSRGNLYAAGGNDEGQLGLGHYEERTSFHLVDFFTKLGPIKMLAAGSNTSAALMQDGKLYVWGDNSEGQIGLGKE------AGAATPRDLS--VGRRVAWVSCGYYHSAFVTVDGALFTFGERDSGKLGLSPAQLPNHKV-PQHVEGISDRVLQVACGGGHTVALTEDY-LYSFGLGQFGQLGHGTFIFEARLPREVEHFRKGRVKHITCGENHTAVITESGVLYTFGDGRH 325          

HSP 2 Score: 64.6994 bits (156), Expect = 3.020e-10
Identity = 75/329 (22.80%), Postives = 138/329 (41.95%), Query Frame = 2
Query:  257 QNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLES-KLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIG-----IPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYE-----PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQ---AAPNFPYPFLNSPVEIKKFDENKVTNIYC--CNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPF 1195
            + +K + CG +H+++ T  G++Y  G N++ QLG G+ +  + T  ++    TKL   K+    S     +   G   ++  +    I  G   G   P    DL      ++ +SCG  H   +   G +  FG+   G++G     +P   +   VE +S           RV+++A G  HT+ L E + ++ +G G    + +G  +  + +P   E      +  +  G NH+  +T S  ++  G    G+      NF   F   P    +F +  V ++ C  C+    AK       + G    I+ +D  T D F++ +
Sbjct:   88 EKVKLVACGRTHTLVYTSRGNLYAAGGNDEGQLGLGHYE--ERTSFHLVDFFTKLGPIKMLAAGSNTSAALMQDGKLYVWGDNSEGQIGLGKEAGAATPR---DL-SVGRRVAWVSCGYYHSAFVTVDGALFTFGERDSGKLGLSPAQLPNHKVPQHVEGIS----------DRVLQVACGGGHTVALTE-DYLYSFGLGQFGQLGHGTFIFEARLPREVEHFRKGRVKHITCGENHTAVITESGVLYTFGDGRHGKLGLGEENFTNQF--RPTLCPRFLKYNVQSVTCGGCHMLVLAKP-----RLKGSEDIILEDDDITEDYFEKTY 392          
BLAST of FYVE-type domain-containing protein vs. Ensembl Cavefish
Match: rcbtb1 (regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-7951])

HSP 1 Score: 80.4925 bits (197), Expect = 2.334e-15
Identity = 73/292 (25.00%), Postives = 126/292 (43.15%), Query Frame = 2
Query:  290 HSVMLTREGHVYGWGNNNQNQLGEGY-NKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHR-VIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEP-IIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN--HYSAAKTEKDEVYMWGK 1138
            H ++ T EG +Y WG+N  +QLG G  N+ + P  ++     T L++K                                                    + +++CG  H + L   G+V  +G N  GQ+G        S     TPR V++   ++ V+ IA G   ++ + +  +++ WGY     L  G  NG+ + P  +  +    ++ +  G  HSL LT+   ++A G+N +GQ         L SPV++   ++ ++  I  C+  H SAAKT+  +VYMWG+
Sbjct:  146 HVLLATEEGDMYAWGHNGYSQLGNGTTNQGVCPVLVS-----TNLQNK---------------------------------------------------RVIEVACGSHHSLALTHDGEVFAWGYNNCGQVG------SGSTANQPTPRKVSNCLQNKAVVSIACGQTSSMAVSDNGEVYGWGYNGNGQLGLGN-NGNQLTPCRLAALQGLCVLQIASGYAHSLALTDEGLLYAWGANTYGQLGTGNKSNQL-SPVQVMA-EKERIVEIAACHSTHTSAAKTQSGQVYMWGQ 372          

HSP 2 Score: 62.003 bits (149), Expect = 1.476e-9
Identity = 60/241 (24.90%), Postives = 106/241 (43.98%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDL--------PCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIAT--GTYHTLCLDEINQIFCWG 832
            ++AWG N ++Q      N+ +   L   N    ++ +  + CGS HS+ LT +G V+ WG NN  Q+G G +   +PT   + +    L++K        + +I+CG T ++  +    +  +G      N N +L L        PC   ++      +I+ G  H + L   G +  +G N YGQ+G   K    S   V   +        R+++IA    T+ +    +  Q++ WG
Sbjct:  156 MYAWGHNGYSQLGNGTTNQGVCPVLVSTNLQ--NKRVIEVACGSHHSLALTHDGEVFAWGYNNCGQVGSG-STANQPTPRKVSNC---LQNK-------AVVSIACGQTSSMAVSDNGEVYGWG-----YNGNGQLGLGNNGNQLTPCRLAALQGLCVLQIASGYAHSLALTDEGLLYAWGANTYGQLGTGNKSNQLSPVQVMAEK-------ERIVEIAACHSTHTSAAKTQSGQVYMWG 371          
BLAST of FYVE-type domain-containing protein vs. Ensembl Cavefish
Match: RPGR (retinitis pigmentosa GTPase regulator [Source:HGNC Symbol;Acc:HGNC:10295])

HSP 1 Score: 76.6406 bits (187), Expect = 4.652e-14
Identity = 78/325 (24.00%), Postives = 140/325 (43.08%), Query Frame = 2
Query:  212 TISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLG-EGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIG----DTNPNFKLDLP-CFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG------YGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQ-AAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            ++  K   +N  P+      I CG SHS  +T  G ++ +G+N+  QLG E    I KP        C K       +    ++  +CG   T+ +T    I   G      +G    +   +F+   P C    + ++S G      L   G++  +G N  GQ+G+  ++L    + +   R VT         I+ G  H+  + +I  ++ +G       GL    +  H  QP  + G  E ++ +  G  H+L LT + +++A G   FGQ     F +   +SP  +  F + +VT++ C  +++A  T+   +Y +G
Sbjct:   53 SVPSKFWLKNDKPV-----LISCGHSHSAFVTEHGRLFVFGSNSSGQLGLESKGPITKP-------VCVKA------LKHERVRFTACGTNHTLVSTSRGEIFAAGRNSEGQLGLGHCEERTSFQQLHPFCDGAPLKQLSAGCNTSAALTEDGRLFMWGDNSVGQLGLGSENLVLFPKLLKVDRSVTG--------ISCGLNHSALITDIGDVYTFGEAADGRLGLSADQLANH-RQPQRV-GSLEGVLQVSCGGTHTLALTEN-ELYAFGHGEFGQLGLGTFDFQ-ADSPAPVGHFRKGRVTHVTCGENHTALITDGGLLYTFG 347          

HSP 2 Score: 73.1738 bits (178), Expect = 5.028e-13
Identity = 74/323 (22.91%), Postives = 134/323 (41.49%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPID----------QNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------IIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAA---PNFPYPFLNSPVEIKKF 1051
            LF +GSN   Q             LG E++ PI           + +++  CG++H+++ T  G ++  G N++ QLG G+ +             T  +    F D   +K +S G   +   T    +  +G        +G  N      L     S++ ISCG  H  L+   G V  FG+   G++G+    L +  +    P+ V S     V++++ G  HTL L E N+++ +G+G    L  G  +     P+ +    +  +  +  G NH+  +T+   ++  G   +G+      NF   F  +P   ++F
Sbjct:   84 LFVFGSNSSGQ-------------LGLESKGPITKPVCVKALKHERVRFTACGTNHTLVSTSRGEIFAAGRNSEGQLGLGHCE-----------ERTSFQQLHPFCDGAPLKQLSAGCNTSAALTEDGRLFMWGDNSVGQLGLGSENLVLFPKLLKVDRSVTGISCGLNHSALITDIGDVYTFGEAADGRLGLSADQLANHRQ----PQRVGS--LEGVLQVSCGGTHTLALTE-NELYAFGHGEFGQLGLGTFDFQADSPAPVGHFRKGRVTHVTCGENHTALITDGGLLYTFGDGRYGKLGLGDENFTNQF--TPTVCQRF 373          

HSP 3 Score: 72.0182 bits (175), Expect = 1.414e-12
Identity = 57/215 (26.51%), Postives = 93/215 (43.26%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPC-----FAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKI 772
            LF WG N   Q  L   N  +  KL     + +D+++  I CG +HS ++T  G VY +G     +LG   +++    +   P     LE  L+         +SCGGT T+  T  N +  +G      +G    +F+ D P        G ++ ++CG+ H  L+   G +  FG   YG++G+     D +     TP V      + VI +
Sbjct:  189 LFMWGDNSVGQLGLGSENLVLFPKL-----LKVDRSVTGISCGLNHSALITDIGDVYTFGEAADGRLGLSADQLANHRQ---PQRVGSLEGVLQ---------VSCGGTHTLALTE-NELYAFGHGEFGQLGLGTFDFQADSPAPVGHFRKGRVTHVTCGENHTALITDGGLLYTFGDGRYGKLGLG----DENFTNQFTPTVCQRFLDYTVIAV 381          
BLAST of FYVE-type domain-containing protein vs. Ensembl Cavefish
Match: herc4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:NCBI gene;Acc:103028096])

HSP 1 Score: 73.9442 bits (180), Expect = 3.481e-13
Identity = 80/332 (24.10%), Postives = 142/332 (42.77%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISM---KLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSI----IGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YGLPCGVINGHIMQPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAA 1102
            +  WG+  + Q  L   ++ I +   K  F N     + +  + CG  H+V L  +G VY  G N+  QLG       + TR        K   ++  +D+  I  +SCG + T+       +  +G      +G  N    + +P    S+S     +++CG  H + L   GQ+  +G+N YGQ+G+ ++       +V TP++V S       +I+ G  H+  L     +F WG   +G      N     P  +  +  + ++ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   N VT I C   ++ A
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVVEPRKCSFFN----GKLVWDVGCGRRHTVFLLGDGTVYTCGCNDLGQLGH------EKTR--------KKPEQVVALDAQNIVAVSCGESHTLALNDKGQVFAWGQASEGQLGLANMEDCVRVPRNIKSLSEVHIVQVTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEG-----PSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLGLNDNSDRCAPCLLKTLRSQRVVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNTTNHEIN-PRKVFELMGNVVTQISCGRQHTMA 308          

HSP 2 Score: 69.3218 bits (168), Expect = 9.250e-12
Identity = 68/266 (25.56%), Postives = 118/266 (44.36%), Query Frame = 2
Query:  236 ENRVPID-QNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCII-----KYGSI-IGDTNPNF---KLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCW---GYGLPCGVINGHIMQPSHMPGIYEPII-DLDGGSNHSL-FLTNSRKI--FAIGSN 982
            E  V +D QNI  + CG SH++ L  +G V+ WG  ++ QLG           +     C ++   ++ +  V I  ++CG   ++  +    I      KYG + +G   P+    +L         ++IS G  H   L  SG V  +G+N +GQ+G+     D+S      P ++ +  + RV+ I  G  HT  L +   +F +   GYG        H + P  +  +   ++  +  G  H++ F+ +S KI  F +G N
Sbjct:   76 EQVVALDAQNIVAVSCGESHTLALNDKGQVFAWGQASEGQLG-----------LANMEDCVRVPRNIKSLSEVHIVQVTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEGPSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLGLN----DNSDRC--APCLLKTLRSQRVVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNTTNHEINPRKVFELMGNVVTQISCGRQHTMAFIPSSGKIDSFGLGGN 324          

HSP 3 Score: 67.781 bits (164), Expect = 3.118e-11
Identity = 49/189 (25.93%), Postives = 80/189 (42.33%), Query Frame = 2
Query:  587 ISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEP-IIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            +  + CG+ H V LL  G V   G N  GQ+G  +        T   P  V +  A  ++ ++ G  HTL L++  Q+F WG      L    +   +  P ++  + E  I+ +  G  HSL L+   +IF+ G N +GQ       P + +P  ++         I     +S   T    V+ WG+
Sbjct:   36 VWDVGCGRRHTVFLLGDGTVYTCGCNDLGQLGHEK--------TRKKPEQVVALDAQNIVAVSCGESHTLALNDKGQVFAWGQASEGQLGLANMEDCVRVPRNIKSLSEVHIVQVTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEGPSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGR 216          
BLAST of FYVE-type domain-containing protein vs. Ensembl Cavefish
Match: herc4 (HECT and RLD domain containing E3 ubiquitin protein ligase 4 [Source:NCBI gene;Acc:103028096])

HSP 1 Score: 73.9442 bits (180), Expect = 3.778e-13
Identity = 80/332 (24.10%), Postives = 142/332 (42.77%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISM---KLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSI----IGDTNPNFKLDLPCFAGSIS-----KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YGLPCGVINGHIMQPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAA 1102
            +  WG+  + Q  L   ++ I +   K  F N     + +  + CG  H+V L  +G VY  G N+  QLG       + TR        K   ++  +D+  I  +SCG + T+       +  +G      +G  N    + +P    S+S     +++CG  H + L   GQ+  +G+N YGQ+G+ ++       +V TP++V S       +I+ G  H+  L     +F WG   +G      N     P  +  +  + ++ +  G +H+  LT    +F  G+  +GQ   N     +N P ++ +   N VT I C   ++ A
Sbjct:    1 MLCWGNASYGQLGLGGIDEEIVVEPRKCSFFN----GKLVWDVGCGRRHTVFLLGDGTVYTCGCNDLGQLGH------EKTR--------KKPEQVVALDAQNIVAVSCGESHTLALNDKGQVFAWGQASEGQLGLANMEDCVRVPRNIKSLSEVHIVQVTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEG-----PSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLGLNDNSDRCAPCLLKTLRSQRVVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNTTNHEIN-PRKVFELMGNVVTQISCGRQHTMA 308          

HSP 2 Score: 69.707 bits (169), Expect = 9.054e-12
Identity = 68/266 (25.56%), Postives = 118/266 (44.36%), Query Frame = 2
Query:  236 ENRVPID-QNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCII-----KYGSI-IGDTNPNF---KLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCW---GYGLPCGVINGHIMQPSHMPGIYEPII-DLDGGSNHSL-FLTNSRKI--FAIGSN 982
            E  V +D QNI  + CG SH++ L  +G V+ WG  ++ QLG           +     C ++   ++ +  V I  ++CG   ++  +    I      KYG + +G   P+    +L         ++IS G  H   L  SG V  +G+N +GQ+G+     D+S      P ++ +  + RV+ I  G  HT  L +   +F +   GYG        H + P  +  +   ++  +  G  H++ F+ +S KI  F +G N
Sbjct:   76 EQVVALDAQNIVAVSCGESHTLALNDKGQVFAWGQASEGQLG-----------LANMEDCVRVPRNIKSLSEVHIVQVTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEGPSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGRNKFGQLGLN----DNSDRC--APCLLKTLRSQRVVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNTTNHEINPRKVFELMGNVVTQISCGRQHTMAFIPSSGKIDSFGLGGN 324          

HSP 3 Score: 67.781 bits (164), Expect = 3.440e-11
Identity = 49/189 (25.93%), Postives = 80/189 (42.33%), Query Frame = 2
Query:  587 ISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEP-IIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            +  + CG+ H V LL  G V   G N  GQ+G  +        T   P  V +  A  ++ ++ G  HTL L++  Q+F WG      L    +   +  P ++  + E  I+ +  G  HSL L+   +IF+ G N +GQ       P + +P  ++         I     +S   T    V+ WG+
Sbjct:   36 VWDVGCGRRHTVFLLGDGTVYTCGCNDLGQLGHEK--------TRKKPEQVVALDAQNIVAVSCGESHTLALNDKGQVFAWGQASEGQLGLANMEDCVRVPRNIKSLSEVHIVQVTCGYRHSLALSRRGQIFSWGQNKYGQLGLGKEGPSVLTPQLVQSLLGIPFAQISAGGAHSFGLTLSGAVFGWGR 216          
BLAST of FYVE-type domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001275.1 (pep scaffold:Pmarinus_7.0:GL476529:184068:212443:-1 gene:ENSPMAG00000001140.1 transcript:ENSPMAT00000001275.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.0333 bits (201), Expect = 2.468e-16
Identity = 76/318 (23.90%), Postives = 136/318 (42.77%), Query Frame = 2
Query:  191 LLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIK-PTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIGDTNPNFKLDLPCFAGSIS---KISCGQCHVVLLLSSGQVA-CFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG--LPCGVINGHIMQPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKT 1108
            L D NN++   KL FE +  + + I   +    H++ +T EG V+ WG+ +  +LG G +   K P  I  P     L+ K+       +  +S G   +   T    +  +G      +G  + N + ++P     IS   +++CG  H + +   G++   FG    G++G            V  P+V+ +     + K+  G+  +L L    Q++ WG G  L CG      ++P  +  +    I+D+  G +H L LT+  +++A G+N  GQ         +  P ++   D   V  I     +S A T
Sbjct:  444 LGDSNNQSTLKKLTFEPQRAV-KKISSSRGSDGHTLAVTMEGEVFSWGDGDYGKLGHGNSSTQKYPKLIQGP-----LQGKV-------VVCVSAGYRHSASVTEDGELYTWGEGDFGRLGHGDSNSR-NIPTLVKDISNVGQVACGSSHTIAVSQDGRIVWSFGGGDNGKLG------HGDTNRVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQLYAWGCGACLGCGSSEATALRPKLIEDLACTRIVDISCGDSHCLALTHDNEVYAWGNNSMGQCGQGHSTSPVTKPKKVMGMDGISVQQISAGTSHSLAWT 741          
BLAST of FYVE-type domain-containing protein vs. Ensembl Sea Lamprey
Match: rcc2 (regulator of chromosome condensation 2 [Source:NCBI gene;Acc:406455])

HSP 1 Score: 60.4622 bits (145), Expect = 6.937e-10
Identity = 47/202 (23.27%), Postives = 82/202 (40.59%), Query Frame = 2
Query:  611 CHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLN-----------SPVEIKKFDENK------------VTNIYCCNHYSAAKTEKDEVYMWG 1135
            CH +LL   GQV  +G+   GQ+G         ++ V  PR V + F   V+  A G  HTLC+ E   +  +G      L  G  +  +  P  +    +P++ +  G+  S+ +     +++ G   +GQ   N    FL            +P  +  F E              VT+I C ++++  +  +  V+ WG
Sbjct:   64 CHCLLLTDLGQVYTWGRGDKGQLG------HGDLKRVEAPRPVDALFKLTVVAAACGRSHTLCITETGVVMAFGENHLGQLGLGTKSNAMPTPKQIVYSGQPVVKVACGAEFSMLVDCKGNLYSFGCPEYGQLGHNTDGRFLACSNRLEFVCELAPRRVLVFTERTRDGKVNTVPAVCVTDIACGSNHTLVRDSQRRVFSWG 259          

HSP 2 Score: 56.9954 bits (136), Expect = 8.180e-9
Identity = 59/220 (26.82%), Postives = 89/220 (40.45%), Query Frame = 2
Query:  284 SSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLP---CFAGS-ISKISCGQCHVVLLLSSGQVACFGKNMYGQIG--------------------IPRKDL-------DSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG 838
            + H ++LT  G VY WG  ++ QLG G  K     R+  P     L  KL  V +      +CG + T+  T    ++ +G      +G    +  +  P    ++G  + K++CG    +L+   G +  FG   YGQ+G                     PR+ L       D  V TV  P V        V  IA G+ HTL  D   ++F WG+G
Sbjct:   63 ACHCLLLTDLGQVYTWGRGDKGQLGHGDLK-----RVEAPRPVDAL-FKLTVVAA------ACGRSHTLCITETGVVMAFGENHLGQLGLGTKSNAMPTPKQIVYSGQPVVKVACGAEFSMLVDCKGNLYSFGCPEYGQLGHNTDGRFLACSNRLEFVCELAPRRVLVFTERTRDGKVNTV--PAVC-------VTDIACGSNHTLVRDSQRRVFSWGFG 261          
BLAST of FYVE-type domain-containing protein vs. Ensembl Sea Lamprey
Match: rcc2 (regulator of chromosome condensation 2 [Source:NCBI gene;Acc:406455])

HSP 1 Score: 58.9214 bits (141), Expect = 2.242e-9
Identity = 51/213 (23.94%), Postives = 90/213 (42.25%), Query Frame = 2
Query:  284 SSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIGDTNPNFKLDLP---CFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIG--------------------IPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG 838
            ++HS++++  G VY WG   + QLG G        R+++P         ++ +   +I + +CG + T+  T    +  +G      +G  N    +  P    ++G  + K++CG    V +   G +  FG   YGQ+G                     PR+ L   +E     +V+T      V  +A G  HT+ LD   ++F WG+G
Sbjct:   63 AAHSLLISTRGLVYSWGRGEKGQLGHG-----DTCRVDVPRI-------IDTLKECVIVDGACGRSHTLCLTDTGTVYAFGENRLGQLGLGNQTDAVPSPTQIVYSGRQVVKVACGAEFSVFIDCDGNLFSFGCPEYGQLGHNTDGRYIVRAQRIEFVCELAPRR-LARFIEKTRDGQVLTVRGV-VVRDVACGANHTIALDTRGRVFTWGFG 261          
BLAST of FYVE-type domain-containing protein vs. Ensembl Sea Lamprey
Match: NEK9 (NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC:18591])

HSP 1 Score: 57.3806 bits (137), Expect = 1.042e-8
Identity = 75/323 (23.22%), Postives = 125/323 (38.70%), Query Frame = 2
Query:  278 CGS-SHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVL---IKNISCGGTFTIFTTHCNCIIKYGS-IIGDTNPNFKLDLPCFA---------GSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVST---PRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG------YGL---PCGVING-----HIMQPSHMPGIYE-----PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKD-EVYMWG 1135
            C S +H   +T E  +Y W N       +G  K++      + H       + + VD +L   ++ ++CG  FT+  T    +  +GS   G    N +L +               +++ISCG CHV+ L  SG V  +G   YG++G+         ET +T   P+ V      ++ ++  GT  T  L    ++   G       GL     G+ N      H +    MP + +      I  + GG  HS  +    ++   G N  GQ         L   +         +T + C + ++ A TE D  +Y WG
Sbjct:  356 CASNTHFAAVTVEKELYTWANV------QGGTKMVG----QLGHKDKASYRQPKRVDKLLGLAVRQVACGDEFTVCLTEQGEVFSFGSDYYGCMGCNGELGVEVLEPMPVQFFNINPVTQISCGDCHVMALTRSGAVYAWGCGEYGRLGL---------ETDATEFYPKRVPLSNRWKITEVCCGTDGTFFLTAQGKVLACGNNEFNKLGLNQCTSGLRNRETSVFHEVIMKLMPTLVKQLSIYKIRSISGGKTHSAVIDVCGRLLTFGHNKHGQLGTGDFKKHLGIVLHKGPLVGKLITMVSCGDGFTIAATEADNHIYAWG 659          

HSP 2 Score: 47.7506 bits (112), Expect = 8.689e-6
Identity = 60/241 (24.90%), Postives = 91/241 (37.76%), Query Frame = 2
Query:  221 MKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLG------EGYNKIIKPT-RINIPHTCTKLESKLEFVDSVLIKNISCGGTF--TIFTTHCNCIIK------YGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEI-NQIFCWGYGLPCGVINGHI-MQPSHMPG 892
            M + F N  P+ Q    I CG  H + LTR G VY WG     +LG      E Y K +  + R  I   C   +    F  +   K ++CG      +    C   ++      +  +I    P     L  +   I  IS G+ H  ++   G++  FG N +GQ+G         +     P V        +  ++ G   T+   E  N I+ WG        NG + + PS  PG
Sbjct:  453 MPVQFFNINPVTQ----ISCGDCHVMALTRSGAVYAWGCGEYGRLGLETDATEFYPKRVPLSNRWKITEVCCGTDGT--FFLTAQGKVLACGNNEFNKLGLNQCTSGLRNRETSVFHEVIMKLMPTLVKQLSIY--KIRSISGGKTHSAVIDVCGRLLTFGHNKHGQLGTGDFKKHLGIVLHKGPLV-----GKLITMVSCGDGFTIAATEADNHIYAWG-----NTDNGRLGVMPSEKPG 675          
BLAST of FYVE-type domain-containing protein vs. Ensembl Sea Lamprey
Match: rcc1 (regulator of chromosome condensation 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2216])

HSP 1 Score: 54.299 bits (129), Expect = 5.861e-8
Identity = 73/326 (22.39%), Postives = 122/326 (37.42%), Query Frame = 2
Query:  248 PIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------IIGDTNPNFKLDLPC---FAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIG-----IPRKDLDSSVETVSTPRVVT-----SHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEP-----------IIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            P+ Q +     G  HSV L + G VY +G N++  LG          RI +      +   +   +  L   +S G + T   T    +  +G+      IIG   P  K  LP        I K++ G  H+VLL  S Q+   G    GQ+G        +     +  +  P  V       H     + +  G+Y T  L     ++  G+GL     N H +  +     + P            ++L GG +HSL L +  K++++G   +G+         +  P  +     + + +I C    S A T+    + WG
Sbjct:   68 PVLQAV----AGGMHSVCLGKSGKVYTFGCNDEGALG----------RITVEDVEEAMPGTVMLPE--LAVQVSAGDSHTAVLTEFGSVYLWGTFRDNNGIIGLLEPMMKCPLPTKLTLDTRIVKVASGNDHLVLLSESRQIYTLGCGEQGQLGRVAEMFANRGGRRGLLRLLVPEQVRVKARRGHSHVEFLDVFCGSYFTFALSTDGSLY--GFGLS----NYHQLGTAKPDSAFVPNLLTSFENSETWLELCGGQHHSLCLDSGGKVYSLGRADYGRLGLGKGACDVALPTLVPT--PSHINSIACGASVSYAVTKDGRAFSWG 369          
BLAST of FYVE-type domain-containing protein vs. Ensembl Yeast
Match: SRM1 (Nucleotide exchange factor for Gsp1p; localizes to the nucleus, required for nucleocytoplasmic trafficking of macromolecules; suppressor of the pheromone response pathway; potentially phosphorylated by Cdc28p; human homolog of the RAN GEF, RCC1, can complement a temperature sensitive point mutant [Source:SGD;Acc:S000003065])

HSP 1 Score: 56.6102 bits (135), Expect = 6.985e-9
Identity = 63/269 (23.42%), Postives = 110/269 (40.89%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPI--DQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLG----EGYN-KIIKPTRINIPHT---------CTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPR--------KDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMP 889
            ++AWG+   N+ +L      I ++     +VP     NI  +  G  H + L  EG V+ WGN  QNQLG    E +  K + P    + H          C  L    + V   L +   CG          +  ++ G+++  T P  +L LP     I  I+ G+ H ++L   G +   G+    ++GIP+        KD+      V  P  + +    +   +A G++H++ + +    + WG+G    V  G     + +P
Sbjct:  186 VYAWGTFRCNEGILGFYQDKIKIQ-KTPWKVPTFSKYNIVQLAPGKDHILFLDEEGMVFAWGNGQQNQLGRKVMERFRLKTLDPRPFGLRHVKYIASGENHCFALTKDNKLVSWGLNQFGQCG---------VSEDVEDGALV--TKPK-RLALPDNV-VIRSIAAGEHHSLILSQDGDLYSCGRLDMFEVGIPKDNLPEYTYKDVHGKARAVPLPTKLNN--VPKFKSVAAGSHHSVAVAQNGIAYSWGFGETYAVGLGPFEDDTEVP 438          

HSP 2 Score: 52.373 bits (124), Expect = 1.556e-7
Identity = 84/383 (21.93%), Postives = 147/383 (38.38%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENR-VPIDQ-NIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKI----------------------IKPTRINIPH-TCTKLESKLEFVDSVLIKNISC-----GGTFTIFTTHCNCIIKYGSIIGDTNPNFKLD-----LPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIK-IATGTYHTLCLDEINQIFCWGY------GLPCGVINGHIMQPSHMPGIYEPII--DLDGGSNHSLFLTNSRKIFAIGS-NVFGQAAP--NFP-YPFLN-------SPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            +F WG+    +  L    K   +K    N  +P D+  I     G  H++ L  E +V+ WG N+   LG   +                        ++ T   IP  +   L    + V      N+SC     G  +   T  CN       I+G      K+      +P F+  +I +++ G+ H++ L   G V  +G     Q+G  RK ++        PR     F  R +K IA+G  H   L + N++  WG       G+   V +G ++       + + ++   +  G +HSL L+    +++ G  ++F    P  N P Y + +        P+  K  +  K  ++   +H+S A  +    Y WG
Sbjct:   48 IFCWGTGSMCELGLGPLAKNKEVKRPRLNPFLPRDEAKIISFAVGGMHTLALDEESNVWSWGCNDVGALGRDTSNAKEQLKDMDADDSSDDEDGDLNELESTPAKIPRESFPPLAEGHKVVQLAATDNMSCALFSNGEVYAWGTFRCN-----EGILGFYQDKIKIQKTPWKVPTFSKYNIVQLAPGKDHILFLDEEGMVFAWGNGQQNQLG--RKVMERFRLKTLDPRP----FGLRHVKYIASGENHCFALTKDNKLVSWGLNQFGQCGVSEDVEDGALVTKPKRLALPDNVVIRSIAAGEHHSLILSQDGDLYSCGRLDMFEVGIPKDNLPEYTYKDVHGKARAVPLPTKLNNVPKFKSVAAGSHHSVAVAQNGIAYSWG 419          
BLAST of FYVE-type domain-containing protein vs. Ensembl Yeast
Match: FMP25 (Protein required for assembly of respiratory complex III; mitochondrial inner membrane protein; required for an early step in assembly of respiratory complex III (cytochrome bc1 complex); mRNA is targeted to mitochondria [Source:SGD;Acc:S000004067])

HSP 1 Score: 50.8322 bits (120), Expect = 5.634e-7
Identity = 60/231 (25.97%), Postives = 93/231 (40.26%), Query Frame = 2
Query:  587 ISKISCGQCHVVLLLSSGQVACFGKN--------MYGQIGIPR-KDLDSSVETVSTPRV-VTSHFAHR---------VIKIATGTYHTLCLDEINQIFCWGY------GLPCGVINGHIMQPS--------HMPGIYE-PIIDLDGGSNHSLFL------TNSRKIFAIGSNVFGQAAPNFPYPFLNS---PVEIKKFDENKVTNIYCCNHYSAAKTEKD-EVYMWGKISH 1147
            + +   G  H+VLL + G+  C              GQ GIP     D          + + + F H          + KIA G+YHTL +D+  +I+ +G+       LP      ++  P         H PG+     +D+      S         T+    FA G+ +FG+   N    F NS   P++IK  D+ K+TN  C +H    +TE++ EV  WG   H
Sbjct:  297 VVQFDAGSHHLVLLSNLGKAYCCATGNDQKQAQVSKGQFGIPTFSQFDEFPPNNQLFEIELLNKFKHEGEDVVRKREIKKIACGSYHTLAIDKTGEIYAFGWNRFGQLALPISYNLEYVSFPRSVTHAFKPHFPGMTNWKCVDIHCDDETSFVTIRKPGSTSDHHYFAFGNGLFGELGNN---TFKNSQCDPIKIKS-DDKKLTNWSCGSHCVFTETEQENEVIAWGNNDH 523          
BLAST of FYVE-type domain-containing protein vs. Ensembl Nematostella
Match: EDO34610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNU8])

HSP 1 Score: 87.8113 bits (216), Expect = 2.472e-19
Identity = 80/285 (28.07%), Postives = 122/285 (42.81%), Query Frame = 2
Query:  152 FLFAWGSNE-----HNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEG-YNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFT-IFTTHCNCII---KYGSIIGD--TNPNFKLDL-------PCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIID-LDGGSNHSLFL 946
            FL  WG  E     H  C    N+  IS  L     V  D  + +I CGSSH++++T +G ++ WGN N  QLG G  N  ++P  +            L       I+ ++CG   + ++T    C      Y + +G     P+FK +          F   + +++CG  H + L S+G VA  G N  GQIGI  K     ++ V     VT         +A G  H L  D   Q++ WGY   CG     ++ P ++    +  +  L GG +HS+ L
Sbjct:    2 FLITWGCGEFAQHGHGHC----NDVPISSGLFNPLLVGQDGQVTHIACGSSHTLVITGDGRLFSWGNGNSGQLGIGSTNTTLQPHLV-----------PLGVTPGTRIEGVACGTRHSFVWTEEGECFSFGNNYSAQLGYDFRKPDFKDNQLKPIYVDTLFNRKVLQVACGSRHSLFLFSNGHVAAVGCNNRGQIGIGNKTDTFCIQNVPDLTGVT--------VVACGNSHCLAADVQGQVWAWGYSKACGARE-DLLSPENIFTSTDSCVKALSGGDSHSMIL 262          

HSP 2 Score: 53.9138 bits (128), Expect = 5.631e-8
Identity = 48/197 (24.37%), Postives = 88/197 (44.67%), Query Frame = 2
Query:  581 GSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG--YGLPCGV------INGHIMQPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAA---PNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            G ++ I+CG  H +++   G++  +G    GQ+GI     +++++    P  VT     R+  +A GT H+    E  + F +G  Y    G          + ++P ++  ++   ++ +  GS HSLFL ++  + A+G N  GQ         +   N P      D   VT + C N +  A   + +V+ WG
Sbjct:   38 GQVTHIACGSSHTLVITGDGRLFSWGNGNSGQLGI--GSTNTTLQPHLVPLGVTP--GTRIEGVACGTRHSFVWTEEGECFSFGNNYSAQLGYDFRKPDFKDNQLKPIYVDTLFNRKVLQVACGSRHSLFLFSNGHVAAVGCNNRGQIGIGNKTDTFCIQNVP------DLTGVTVVACGNSHCLAADVQGQVWAWG 224          
BLAST of FYVE-type domain-containing protein vs. Ensembl Nematostella
Match: EDO49099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI68])

HSP 1 Score: 88.1965 bits (217), Expect = 3.187e-18
Identity = 69/297 (23.23%), Postives = 128/297 (43.10%), Query Frame = 2
Query:  320 VYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDT------NPNFKLDLPCFAGSI--SKISCGQCHVVLLLS---SGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEP--------IIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNF-----PYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            +Y WG      LG G     + T+   PH    L  K        I+ ++CG T T+  +    +  +GS  G           F     C   S+  ++++C + H   + +    G +  FG+N YGQ+GIP   L       S  + V+S   H++ ++A G++H+  L E   ++ WG      + NG+    S +P + E         ++++  G  HS F+T   ++F  G N +GQ   +       +   N  V ++   + +  ++ C + ++A  T+  E++ WG+
Sbjct:  209 IYTWGEGTNGMLGHG-----EDTQEAHPHVVEALLGKD-------IRKVACGATHTLALSKDGEVFSWGSGYGGRLGQGHLRDRFTPIRICGLESLNLTQVACNEFHSAAVCACSKQGALFSFGENDYGQLGIPEDKL-----LTSYIQCVSSLSEHKISRVACGSFHSAALAEHGSLWLWGCNESGQLGNGNYTSTS-LPSLLEAGNDLRHDAVMEVACGDQHSAFITKKGRMFCCGDNTYGQLGAHLNDNQDDHVTYNVAVRVRVPTDFRCVHVACGDSHTAVVTDGGEIFTWGR 487          

HSP 2 Score: 61.2326 bits (147), Expect = 8.417e-10
Identity = 57/251 (22.71%), Postives = 103/251 (41.04%), Query Frame = 2
Query:  251 IDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGY-NKIIKPTRI-------------NIPHT-----CTKLESKLEF-----------VDSVLIKNISCGGTFT--------IFTTHCNCIIKYGSI-IGDTNPNFKL--------DLPCF--AG------SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG 838
            + ++I+ + CG++H++ L+++G V+ WG+    +LG+G+      P RI             N  H+     C+K  +   F            D +L   I C  + +          + H   + ++GS+ +   N + +L         LP    AG      ++ +++CG  H   +   G++ C G N YGQ+G    D      T +    V      R + +A G  HT  + +  +IF WG G
Sbjct:  238 LGKDIRKVACGATHTLALSKDGEVFSWGSGYGGRLGQGHLRDRFTPIRICGLESLNLTQVACNEFHSAAVCACSKQGALFSFGENDYGQLGIPEDKLLTSYIQCVSSLSEHKISRVACGSFHSAALAEHGSLWLWGCNESGQLGNGNYTSTSLPSLLEAGNDLRHDAVMEVACGDQHSAFITKKGRMFCCGDNTYGQLGAHLNDNQDDHVTYNVAVRVRVPTDFRCVHVACGDSHTAVVTDGGEIFTWGRG 488          
BLAST of FYVE-type domain-containing protein vs. Ensembl Nematostella
Match: EDO34592 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNX9])

HSP 1 Score: 75.8702 bits (185), Expect = 3.335e-14
Identity = 79/337 (23.44%), Postives = 131/337 (38.87%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKT-ISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAA----PNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            +F WG     Q  + +  +  IS     EN +    N++ + CG +H+  L ++G VY  G+N   QLG+      + +  N P +   +E                  TFTI    C                                 G+ H V +   G V  +G N YGQIG+  K +   V+T+  P+++       V++IA G  H++ L     +FCWG      L  G  +  + +P+ +  +   P + +  G  HS  L++S  +F  G N +GQ       + P P L     +K      V  + C   ++A  T    V+ +G
Sbjct:    1 MFCWGKCSEGQLGVGETEQEFISTPRLLEN-LEFSSNVREVSCGWNHTAFLCKDGTVYTCGSNEFGQLGQ------EKSHTN-PESVHAIE------------------TFTITKVTC---------------------------------GKAHTVAVSDQGLVFAWGDNSYGQIGLGSK-VKEKVQTI--PKMLKGLAKMSVVQIACGCNHSMALTISGHLFCWGDNSSGQLGIGKTHSSMSEPAPVLSLNGVPFMLISAGGAHSFALSSSGALFGWGKNEYGQLGVHDTTDRPLPTL-----LKSLRSQGVCYVSCGEKHTAVLTSDGGVFTFG 270          

HSP 2 Score: 72.0182 bits (175), Expect = 5.780e-13
Identity = 69/252 (27.38%), Postives = 103/252 (40.87%), Query Frame = 2
Query:  152 FLFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCII-----KYGSI-IGDTNPNFKLDLPCFAGSISK-----ISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCL-DEINQIFCWGYG----LPCGVIN 859
             +FAWG N + Q  L    K     +    +     ++  I CG +HS+ LT  GH++ WG+N+  QLG G             H+     + +  ++ V    IS GG  +   +    +      +YG + + DT       LP    S+       +SCG+ H  +L S G V  FG    GQ+G       +S     TPR V       V +IA G  HTL L     +++ +G G    L  GV N
Sbjct:  105 LVFAWGDNSYGQIGLGSKVKEKVQTIPKMLKGLAKMSVVQIACGCNHSMALTISGHLFCWGDNSSGQLGIGKT-----------HSSMSEPAPVLSLNGVPFMLISAGGAHSFALSSSGALFGWGKNEYGQLGVHDTTDR---PLPTLLKSLRSQGVCYVSCGEKHTAVLTSDGGVFTFGCGTSGQLG------HNSNHHEYTPRKVFELMGSVVTQIACGRAHTLALVPSSGRVYTFGRGGDGQLGLGVTN 336          

HSP 3 Score: 59.6918 bits (143), Expect = 3.796e-9
Identity = 48/208 (23.08%), Postives = 84/208 (40.38%), Query Frame = 2
Query:  575 FAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG------YGLPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSD 1177
            F+ ++ ++SCG  H   L   G V   G N +GQ+G  +          + P  V +     + K+  G  HT+ + +   +F WG       GL   V       P  + G+ +  ++ +  G NHS+ LT S  +F  G N  GQ      +  ++ P  +   +      I     +S A +    ++ WGK  +     + T+D
Sbjct:   33 FSSNVREVSCGWNHTAFLCKDGTVYTCGSNEFGQLGQEKSH--------TNPESVHAIETFTITKVTCGKAHTVAVSDQGLVFAWGDNSYGQIGLGSKVKEKVQTIPKMLKGLAKMSVVQIACGCNHSMALTISGHLFCWGDNSSGQLGIGKTHSSMSEPAPVLSLNGVPFMLISAGGAHSFALSSSGALFGWGKNEYGQLGVHDTTD 232          

HSP 4 Score: 55.8398 bits (133), Expect = 4.832e-8
Identity = 51/194 (26.29%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  143 MSEFLFAWGSNEHNQCLLDDNNKTIS--MKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIG------DTNPNFKLDLPCFAGSISKISCGQCHVVLLL-SSGQVACFGKNMYGQIGI 685
            +S  LF WG N   Q  +   + ++S    +   N VP       I  G +HS  L+  G ++GWG N   QLG  ++   +P           L + L+ + S  +  +SCG   T   T    +  +G      +G      +  P    +L      +++I+CG+ H + L+ SSG+V  FG+   GQ+G+
Sbjct:  157 ISGHLFCWGDNSSGQLGIGKTHSSMSEPAPVLSLNGVP----FMLISAGGAHSFALSSSGALFGWGKNEYGQLGV-HDTTDRP-----------LPTLLKSLRSQGVCYVSCGEKHTAVLTSDGGVFTFGCGTSGQLGHNSNHHEYTPRKVFEL--MGSVVTQIACGRAHTLALVPSSGRVYTFGRGGDGQLGL 332          
BLAST of FYVE-type domain-containing protein vs. Ensembl Nematostella
Match: EDO33245 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSP6])

HSP 1 Score: 74.3294 bits (181), Expect = 4.564e-14
Identity = 83/384 (21.61%), Postives = 152/384 (39.58%), Query Frame = 2
Query:  245 VPIDQN---IKYIKCGSSHSVMLTREGHVYGWGNNNQNQLG-----EGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLD-----------LPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDS-----SVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEI-NQIFCWGYGLPCGVINGHIMQPSHMPGIYEPI-----------IDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINNMISDNYGINSLQFGSWHVVGVLSAQ 1288
            VPID     I  ++ G  H+V L+++G VY WG N+   LG     EG  +  +P  +++P             D V I  +S G + T   +    +  +G+   D +    L            L   +  I KI+ G  H   L +SG +   G    GQ+G  ++   +      +  +  P +V S    +   +  G++ T  + +  + ++ WG     G +    +Q  H P   + +           I +  G +H++    + K++A+G   +G+            P  I   D   +  + C    S A ++K E+Y WG  S +   +    D    P K+   N+ S+ + +  +  G  H V +L+A+
Sbjct:   72 VPIDLEGVPIVQVESGGMHTVALSKDGKVYTWGCNDDGALGRETTSEGEEEF-QPGVVSMP-------------DDVNIVMVSAGDSHTAALSDQGTVYAWGTYR-DASGQIGLQPDGVKKKPAVILTSESDRIIKIASGNDHTAALTTSGNLFTLGCAEQGQLGRVKECFSARGGRRGLAYILEPALVRSKKGLKFKDVFCGSFATFVVAKTGSDVYAWGLN-NYGQLGTGDVQTWHFPVKVKSLSQLNKSEKDKHITIANGQHHTIVCDPNGKVYALGRADYGRLGLGDGAKETALPAHITSLDNEVIEKVACGECVSFAVSDKGELYSWGMGSCLQLGNGNDEDDVTTPAKVQGKNLNSETHRVLGVSAGGQHTV-ILAAE 438          
BLAST of FYVE-type domain-containing protein vs. Ensembl Nematostella
Match: EDO37196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGI6])

HSP 1 Score: 74.3294 bits (181), Expect = 1.562e-13
Identity = 81/341 (23.75%), Postives = 139/341 (40.76%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSII------------GDTNPNFK-LDLPCFAG-SISKISCGQ--CHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVING---HIMQPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKD 1117
            +FA G + + +  L   +  +++    EN          +  G  H++ LT EG ++ WG     +LG G        R+N  H   KL   ++   S  ++++SCG      ++H   I+  G +             GD   + K   +  F    +  I+CG      + L   G V  +G   +G++G          E  S P  V       V K+A G   +L L     ++ WG G    + +G   H+ +P  + G+  + I+D+  G+ H L +T+S ++FA G N  GQ   N        P  +   +  K+T + C + +S A  E D
Sbjct: 2475 VFACGESTNGRLGLGPLSANVTVPRQIENLSSFMVRKVSVHSGGRHAMALTIEGKLFSWGEGEDGKLGHG-------NRMNCDH--PKL---IDTFKSSCVRDMSCG------SSHSAAILSSGELYTWGLGEYGRLGHGDNYTHLKPKKVQSFTSHRVIDIACGSRDAQTLALTDDGTVWSWGDGDFGKLG------RGGSEGCSVPNPVEKLQGQGVCKVACGAQFSLALSTSGLVWTWGKGDYYRLGHGNDTHVRKPQIVDGLRGKKIVDVAVGALHCLAVTDSGQVFAWGDNDHGQQGNN-TTTVNRRPQLVNGLEGQKITRVACGSSHSIAWAESD 2790          

HSP 2 Score: 60.077 bits (144), Expect = 3.036e-9
Identity = 68/293 (23.21%), Postives = 125/293 (42.66%), Query Frame = 2
Query:  314 GHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIF---------TTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISC--GQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEP-----IIDLDGGSN--HSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            G +YGWG+N++ QLG      ++  ++ +P T   L S    +  V I     GG  T+F          T      + G    DT  + K+        + K++   G  H + L + G V  +G+   G++G   ++      +   PRV+ +     VI I+ G  H+ C+ + ++++ WG G   G +     +   +P + E      +ID+  GS    +L LT+   +++ G   +G+            P++++      V+ + C + +S A T    VY WGK
Sbjct: 3354 GTIYGWGHNHRGQLGS-----LEGAKVKLPQTIEALAS----IRPVQI----VGGEQTLFAVTAEGKVYATGYGHGGRLGLGGTDTVTSIKMLESLQHVVVRKVAVHSGGKHAMALSADGDVYSWGEGDDGKLGHGNRN------SCDRPRVIEALRGKGVIDISCGGSHSACITQNHELYTWGKG-RYGRLGHGDSEDQLLPKVVEALRGNRVIDVACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRG-GSDGCKIPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWGK 3625          

HSP 3 Score: 59.3066 bits (142), Expect = 6.089e-9
Identity = 57/231 (24.68%), Postives = 91/231 (39.39%), Query Frame = 2
Query:  224 KLGFENRVPID----------QNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYN------KIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGG--TFTIFTTHCNCIIKYGSIIGDTNP---------NFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG 832
            KLG  NR   D          + +  I CG SHS  +T+   +Y WG     +LG G +      K+++  R N                   + +++CG     T+  T  +C+  +G   GD               + +    G  +SK+ CG    V L  SG V  +GK  Y ++G    D       V  P+ V +    +VI IATG+ H +   +  +++ WG
Sbjct: 3472 KLGHGNRNSCDRPRVIEALRGKGVIDISCGGSHSACITQNHELYTWGKGRYGRLGHGDSEDQLLPKVVEALRGN------------------RVIDVACGSGDAQTLCLTDDDCVWSWGD--GDYGKLGRGGSDGCKIPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWGKGDYYRLGHGVDD------HVRRPKRVAALQGKKVITIATGSLHCVASTDTGEVYTWG 3676          

HSP 4 Score: 56.6102 bits (135), Expect = 3.937e-8
Identity = 67/295 (22.71%), Postives = 108/295 (36.61%), Query Frame = 2
Query:  272 IKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGT--YHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDL-----DGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            +  G  H++ L+ +G VY WG  +  +LG G        R+            +E +    + +ISCGG      +H  CI                               Q H        ++  +GK  YG++G          E    P+VV +   +RVI +A G+    TLCL + + ++ WG G   G +         +P   E +I L     + GS  S+ LT S  ++  G   + +         +  P  +      KV  I   + +  A T+  EVY WG
Sbjct: 3446 VHSGGKHAMALSADGDVYSWGEGDDGKLGHGNRNSCDRPRV------------IEALRGKGVIDISCGG------SHSACIT------------------------------QNH--------ELYTWGKGRYGRLG------HGDSEDQLLPKVVEALRGNRVIDVACGSGDAQTLCLTDDDCVWSWGDG-DYGKLGRGGSDGCKIPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWGKGDYYRLGHGVD-DHVRRPKRVAALQGKKVITIATGSLHCVASTDTGEVYTWG 3676          

HSP 5 Score: 54.6842 bits (130), Expect = 1.504e-7
Identity = 61/249 (24.50%), Postives = 100/249 (40.16%), Query Frame = 2
Query:  290 HSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAG----SISKISCGQ--CHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVING---HIMQPSHMPGI-YEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQ 994
            H + LTREG VY WG+ +  +LG G       +    P   T L  K        +  ISCG T +   T    +  +G      +G  +   +L     +G     I  ++CG    H +     G V  +G   YG++G    D          P+ +       V K+  G   +L L     ++ WG G    + +G   H+  P  +  +  + ++D+  GS H L LT++ +++  G N  GQ
Sbjct:   28 HFLALTREGEVYSWGSGDGGKLGHG-----DTSPREEPTLVTGLAGK-------QVIRISCGSTHSAAVTSEGELYTWGRGNYGRLGHGSSEDQLVPVLVSGLRGHHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGGSD------GCKNPKSIERLQGLGVCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDHVRHPKLVEALDGKHVVDVSVGSIHCLALTDAGEVYCWGRNDQGQ 258          

HSP 6 Score: 54.6842 bits (130), Expect = 1.569e-7
Identity = 52/227 (22.91%), Postives = 96/227 (42.29%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFE---NRVPIDQNIKYIKCGS--SHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSI--------IGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTL 796
            L+ WG   + +    D+   +  K+      NRV ID     + CGS  + ++ LT +  V+ WG+ +  +LG G +             C K+  K+E +  + +  + CG  F++  T    +  +G          + D     K         +  I+ G  H V    +G+V  +G N  GQ+G      D +   ++ PR+VT+    ++ ++A G+ HT+
Sbjct: 3514 LYTWGKGRYGRLGHGDSEDQLLPKVVEALRGNRV-ID-----VACGSGDAQTLCLTDDDCVWSWGDGDYGKLGRGGSD-----------GC-KIPMKVESLIGLGVSKVECGSQFSVALTRSGAVYTWGKGDYYRLGHGVDDHVRRPKRVAALQGKKVITIATGSLHCVASTDTGEVYTWGDNDEGQLG------DGTTNAIARPRLVTALQGKKISRVACGSAHTI 3716          

HSP 7 Score: 51.2174 bits (121), Expect = 1.758e-6
Identity = 60/281 (21.35%), Postives = 114/281 (40.57%), Query Frame = 2
Query:  320 VYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVT--SHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEP-----IIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNH--YSAAKTEKDEVYMWG 1135
            V+ WG N+++QLG      +K ++I +P          EF+ ++ ++ I+ GG+ T+F                                                G+V   G++  G++G     L      V+ PR +   S F  R + + +G  H + L    ++F WG G    + +G+ M   H P + +      + D+  GS+HS  + +S +++  G   +G+      Y  L  P +++ F  ++V +I C +    + A T+   V+ WG
Sbjct: 2423 VFVWGLNDKDQLGG-----LKGSKIKVPVLS-------EFIGALKVQQIA-GGSKTLFAVS-------------------------------------------HDGKVFACGESTNGRLG-----LGPLSANVTVPRQIENLSSFMVRKVSVHSGGRHAMALTIEGKLFSWGEGEDGKLGHGNRMNCDH-PKLIDTFKSSCVRDMSCGSSHSAAILSSGELYTWGLGEYGRLGHGDNYTHLK-PKKVQSFTSHRVIDIACGSRDAQTLALTDDGTVWSWG 2640          

HSP 8 Score: 48.9062 bits (115), Expect = 7.679e-6
Identity = 54/214 (25.23%), Postives = 91/214 (42.52%), Query Frame = 2
Query:  536 GDTNPNFKLDLPC-FAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGT--YHTLCLDEINQIFCWGYG----LPCGVINGHIMQPS--HMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNV---FGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGK 1138
            GDT+P  +  L    AG  + +ISCG  H   + S G++  +G+  YG++G        S E    P +V+    H +I +A G+   HTL   +   ++ WG G    L  G  +G     S   + G+   +  +  G+  SL LT    ++  G       G    +     +  P  ++  D   V ++   + +  A T+  EVY WG+
Sbjct:   52 GDTSPREEPTLVTGLAGKQVIRISCGSTHSAAVTSEGELYTWGRGNYGRLG------HGSSEDQLVPVLVSGLRGHHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGGSDGCKNPKSIERLQGL--GVCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDH----VRHPKLVEALDGKHVVDVSVGSIHCLALTDAGEVYCWGR 253          

HSP 9 Score: 48.9062 bits (115), Expect = 8.501e-6
Identity = 50/220 (22.73%), Postives = 85/220 (38.64%), Query Frame = 2
Query:  272 IKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNK------IIKPTR----INIP------HTCT--------------------------KLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIG--------DTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATG 781
            I CGS+HS  +T EG +Y WG  N  +LG G ++      ++   R    I++       HT                            K    +E +  + +  + CG  F++  T    +  +G   G        D   + KL        +  +S G  H + L  +G+V C+G+N  GQ+G    D+D  +     P +V+   +  ++ IA G
Sbjct:   74 ISCGSTHSAAVTSEGELYTWGRGNYGRLGHGSSEDQLVPVLVSGLRGHHIIDVACGSGDAHTLAAADDGTVWSWGDGDYGKLGRGGSDGCKNPKSIERLQGLGVCKVYCGAQFSLALTRDGSVWTWGKGEGFRLGHGTEDHVRHPKLVEALDGKHVVDVSVGSIHCLALTDAGEVYCWGRNDQGQLG----DIDCQIR--PEPTLVSGLASKGIVGIACG 287          
BLAST of FYVE-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000015298.2 (probable E3 ubiquitin-protein ligase HERC4 [Source:NCBI gene;Acc:101161054])

HSP 1 Score: 90.5077 bits (223), Expect = 2.970e-18
Identity = 65/208 (31.25%), Postives = 96/208 (46.15%), Query Frame = 2
Query:  242 RVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------IIGDTNPNFKLDLPCFAGSI-----SKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG 832
            R+P+ Q    + CGS H+V LT+EG VY WG N++ QLG G     K   I+ P  C +  S +  V       +S GG  +   +    +  +G        +GD+        P    S+     + ISCG+ H  +L   G V  FG   +GQ+G       +S      PR+V   +  +V +IA G YHTL L E N+I+ +G
Sbjct:  116 RIPVSQ----VACGSRHTVALTKEGQVYTWGQNSRGQLGLGK----KGCSISSPQ-CVRSLSGMPLV------QVSAGGDHSFALSVSGSVFGWGRNDCGQLGLGDSQDRCT---PTSVDSLNLKKTTSISCGKDHTAILTKHGTVFTFGSGQFGQLG------HNSSRNELRPRLVAELWGAKVTRIACGRYHTLVLQENNKIYSFG 299          

HSP 2 Score: 55.0694 bits (131), Expect = 2.502e-7
Identity = 50/189 (26.46%), Postives = 80/189 (42.33%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENR--VPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIK---NISCGGTFTIFTTHCNCIIKYGS-IIGDTNPNF-------KLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIG 682
            ++ WG N   Q  L     +IS      +   +P+ Q    +  G  HS  L+  G V+GWG N+  QLG G ++            CT        VDS+ +K   +ISCG   T   T    +  +GS   G    N        +L    +   +++I+CG+ H ++L  + ++  FG N   Q+G
Sbjct:  138 VYTWGQNSRGQLGLGKKGCSISSPQCVRSLSGMPLVQ----VSAGGDHSFALSVSGSVFGWGRNDCGQLGLGDSQ----------DRCTPTS-----VDSLNLKKTTSISCGKDHTAILTKHGTVFTFGSGQFGQLGHNSSRNELRPRLVAELWGAKVTRIACGRYHTLVLQENNKIYSFGCNDQNQLG 307          

HSP 3 Score: 50.8322 bits (120), Expect = 5.002e-6
Identity = 45/188 (23.94%), Postives = 77/188 (40.96%), Query Frame = 2
Query:  587 ISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIY-EPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            I  + CG   V+LL   G V              R D+    + +  PR++ +     V ++A G+ HT+ L +  Q++ WG      L  G     I  P  +  +   P++ +  G +HS  L+ S  +F  G N  GQ           +P  +   +  K T+I C   ++A  T+   V+ +G
Sbjct:   77 IEAVGCGDDEVILLSEKGSVY-------------RVDV---TQALYLPRMLEAFCRIPVSQVACGSRHTVALTKEGQVYTWGQNSRGQLGLGKKGCSISSPQCVRSLSGMPLVQVSAGGDHSFALSVSGSVFGWGRNDCGQLGLGDSQDRC-TPTSVDSLNLKKTTSISCGKDHTAILTKHGTVFTFG 247          
BLAST of FYVE-type domain-containing protein vs. Ensembl Medaka
Match: rcbtb1 (RCC1 and BTB domain-containing protein 1 [Source:NCBI gene;Acc:101165789])

HSP 1 Score: 84.7297 bits (208), Expect = 9.103e-17
Identity = 84/323 (26.01%), Postives = 139/323 (43.03%), Query Frame = 2
Query:  227 LGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEG-YNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCG-GTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAG-----SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRV-IKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIID-LDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN--HYSAAKTEKDEVYMWGK 1138
            L  E+R  + Q   +    ++ +V ++    V+ +G N+   LG G Y   I P ++N             F+    + ++S G G   +       +  +G    S +G+   N +L     +G      ++K++CG  H + L+  G+V  +G N  GQ+G        S      PR +T     ++ + I  G   ++ L    +++ WGY     L  G  NG+   PS +       +  +  G  H L LT+   ++A G+N FGQ         L SPV I   D+ +V  +  C+  H SAAKT   EVYMWG+
Sbjct:   13 LSSEDRASVRQACVF-GTSANEAVYVSHGNEVFAFGLNSNGCLGTGDYCSTIVPKKLN-------------FLQGKKVVSLSYGSGPHVLLAAENGQLFAWGHNGYSQLGNGTTNQELSPVLISGHLQDKKVTKVACGSHHSMALMEDGEVFAWGYNNCGQVG------SGSTANQPYPRRITGGLQGKLAVDITCGQTSSMALVNSGEVYAWGYNGNGQLGIGN-NGNQPSPSRLAAFQGLCVQRIVAGYGHCLALTDEGALYAWGANTFGQLGTGNKSNHL-SPVRIMA-DKERVVEVAACHSTHISAAKTRTGEVYMWGQ 312          

HSP 2 Score: 63.929 bits (154), Expect = 3.491e-10
Identity = 61/237 (25.74%), Postives = 100/237 (42.19%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNK-IIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG-------SIIGDTNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIAT--GTYHTLCLDEINQIFCWG 832
            LFAWG N ++Q      N+ +S  L     +  D+ +  + CGS HS+ L  +G V+ WG NN  Q+G G       P RI        L+ KL         +I+CG T ++   +   +  +G        I  + N      L  F G  + +I  G  H + L   G +  +G N +GQ+G   K        +S  R++      RV+++A    T+ +       +++ WG
Sbjct:   96 LFAWGHNGYSQLGNGTTNQELSPVL-ISGHLQ-DKKVTKVACGSHHSMALMEDGEVFAWGYNNCGQVGSGSTANQPYPRRIT-----GGLQGKLAV-------DITCGQTSSMALVNSGEVYAWGYNGNGQLGIGNNGNQPSPSRLAAFQGLCVQRIVAGYGHCLALTDEGALYAWGANTFGQLGTGNKS-----NHLSPVRIMADK--ERVVEVAACHSTHISAAKTRTGEVYMWG 311          
BLAST of FYVE-type domain-containing protein vs. Ensembl Medaka
Match: rcbtb1 (RCC1 and BTB domain-containing protein 1 [Source:NCBI gene;Acc:101165789])

HSP 1 Score: 84.3445 bits (207), Expect = 1.267e-16
Identity = 84/323 (26.01%), Postives = 139/323 (43.03%), Query Frame = 2
Query:  227 LGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEG-YNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCG-GTFTIFTTHCNCIIKYG----SIIGDTNPNFKLDLPCFAG-----SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRV-IKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIID-LDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCN--HYSAAKTEKDEVYMWGK 1138
            L  E+R  + Q   +    ++ +V ++    V+ +G N+   LG G Y   I P ++N             F+    + ++S G G   +       +  +G    S +G+   N +L     +G      ++K++CG  H + L+  G+V  +G N  GQ+G        S      PR +T     ++ + I  G   ++ L    +++ WGY     L  G  NG+   PS +       +  +  G  H L LT+   ++A G+N FGQ         L SPV I   D+ +V  +  C+  H SAAKT   EVYMWG+
Sbjct:   71 LSSEDRASVRQACVF-GTSANEAVYVSHGNEVFAFGLNSNGCLGTGDYCSTIVPKKLN-------------FLQGKKVVSLSYGSGPHVLLAAENGQLFAWGHNGYSQLGNGTTNQELSPVLISGHLQDKKVTKVACGSHHSMALMEDGEVFAWGYNNCGQVG------SGSTANQPYPRRITGGLQGKLAVDITCGQTSSMALVNSGEVYAWGYNGNGQLGIGN-NGNQPSPSRLAAFQGLCVQRIVAGYGHCLALTDEGALYAWGANTFGQLGTGNKSNHL-SPVRIMA-DKERVVEVAACHSTHISAAKTRTGEVYMWGQ 370          

HSP 2 Score: 63.5438 bits (153), Expect = 4.218e-10
Identity = 61/237 (25.74%), Postives = 100/237 (42.19%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNK-IIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYG-------SIIGDTNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIAT--GTYHTLCLDEINQIFCWG 832
            LFAWG N ++Q      N+ +S  L     +  D+ +  + CGS HS+ L  +G V+ WG NN  Q+G G       P RI        L+ KL         +I+CG T ++   +   +  +G        I  + N      L  F G  + +I  G  H + L   G +  +G N +GQ+G   K        +S  R++      RV+++A    T+ +       +++ WG
Sbjct:  154 LFAWGHNGYSQLGNGTTNQELSPVL-ISGHLQ-DKKVTKVACGSHHSMALMEDGEVFAWGYNNCGQVGSGSTANQPYPRRIT-----GGLQGKLAV-------DITCGQTSSMALVNSGEVYAWGYNGNGQLGIGNNGNQPSPSRLAAFQGLCVQRIVAGYGHCLALTDEGALYAWGANTFGQLGTGNKS-----NHLSPVRIMADK--ERVVEVAACHSTHISAAKTRTGEVYMWG 369          
BLAST of FYVE-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000033625.1 (probable E3 ubiquitin-protein ligase HERC4 [Source:NCBI gene;Acc:101161054])

HSP 1 Score: 81.2629 bits (199), Expect = 2.252e-15
Identity = 57/202 (28.22%), Postives = 90/202 (44.55%), Query Frame = 2
Query:  260 NIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLG---EGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------IIGDTNPNFKLDLPCFAGSISKI--SCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG 832
             +  + CGS H+V+L+++G VY WG N++ QLG   EG + I  P        C +  S +  V       +S GG  +   +    +  +G        +GDT       L  +      +  +CG+ H  +L   G V  FG   YGQ+G       +S      PR+V   +  +V KIA G YHTL L +  +++ +G
Sbjct:  123 TVTQVACGSQHTVVLSKDGQVYTWGQNSRGQLGLGKEGCSSISSP-------QCVRSLSSMPVV------QVSAGGDHSFALSVSGSVFGWGRNDCGQLGLGDTTDRETPTLVHYLNMKKTVFAACGKDHTAVLTMDGTVFTFGSGHYGQLG------HNSFRNALCPRLVAELWGAKVTKIACGRYHTLVLTDHMKVYSFG 305          

HSP 2 Score: 70.4774 bits (171), Expect = 4.682e-12
Identity = 50/191 (26.18%), Postives = 90/191 (47.12%), Query Frame = 2
Query:  584 SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGI-----YEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNS--PVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            ++++++CG  H V+L   GQV  +G+N  GQ+G+ ++   S    +S+P+ V S  +  V++++ G  H+  L     +F WG    CG +          P +      +  +    G +H+  LT    +F  GS  +GQ   N    F N+  P  + +    KVT I C  +++   T+  +VY +G
Sbjct:  123 TVTQVACGSQHTVVLSKDGQVYTWGQNSRGQLGLGKEGCSS----ISSPQCVRSLSSMPVVQVSAGGDHSFALSVSGSVFGWGRN-DCGQLGLGDTTDRETPTLVHYLNMKKTVFAACGKDHTAVLTMDGTVFTFGSGHYGQLGHN---SFRNALCPRLVAELWGAKVTKIACGRYHTLVLTDHMKVYSFG 305          
BLAST of FYVE-type domain-containing protein vs. Ensembl Medaka
Match: rpgrb (X-linked retinitis pigmentosa GTPase regulator [Source:NCBI gene;Acc:101169422])

HSP 1 Score: 80.1073 bits (196), Expect = 4.116e-15
Identity = 81/326 (24.85%), Postives = 138/326 (42.33%), Query Frame = 2
Query:  215 ISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS------IIGDTNPNFKLDLPCF---AGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG------YGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISH 1147
            I  K   +N VP     + I CG  H+ ++T  G ++ +G+NN  QLG G +K+     +N P TC K       + S  IK ++CG   T+  T    +   G        +GD           F    G+I  ++ G      L  SG++  +G N  GQIG+ ++   SS + V   R V+         ++ G YH+  +     ++ +G       GL    ++GH + P  +  I E +  +  G  H++ LT+   +F  G   FGQ            P  ++ F + +V  + C  +++A  T+   +Y +G   H
Sbjct:   27 IPSKFWLKNDVP-----RKIACGDEHTALITENGRLFMFGSNNWGQLGLG-SKLT----VNKP-TCVKA------LKSERIKLVACGRNHTLICTAKGQVYACGGNSEGQLGLGDWEEKTSFQRVEFFDSQGAIQMLAAGSNTSAALTVSGKLFMWGDNSEGQIGLGKESQASSPQEVGVGRPVSW--------VSCGYYHSAFVTVDGALYTFGERDSGKLGLGTEQLSGHRV-PQRVKSIKEAVKQVACGGGHTVALTDD-AVFTFGLGQFGQLGHGTFIFESRLPRLVEHFKKGRVCQVACGENHTAVITDDGLLYTFGDGRH 325          
BLAST of FYVE-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064746.1 (SMESG000064746.1)

HSP 1 Score: 1112.44 bits (2876), Expect = 0.000e+0
Identity = 600/606 (99.01%), Postives = 604/606 (99.67%), Query Frame = 2
Query:  143 MSEFLFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINNMISDNYGINSLQFGSWHVVGVLSAQXXXXXXXXXXXXXXXXXXXXXXXXXXXIPSIKAITNISNRERTYTTLKELYSKTPEMKSIETEIQPRNIYKTQIHGSDNSKTKHNIEENPVLLXXXXXXXXXXXXXXXXQISVHFENISSQIDINPDLSKNGLLSNKTQNKNKKNYLQKSKTELIFQPKIKKFSNAKSLSDTKENFKLPILVPGLINLQLSKEYSYGGCETHKFGNKIKGILERSKTLYCKNKL 1960
            MSEFLFAWGSNEHNQCL DDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVL+KNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDE+NQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINN+ISDNYGINSLQFGSWHVVGVLSAQNIEINDSSDENSNFESTFDSESSD+FEIPSIKAITNISNRERTYTTLKELYSKTPEMKSIETEIQPRNIYKTQIHGSDNSKTKHNIEENPVLLITNIIPNIHNENHNKIQISVHFENISSQIDINPDLSKNGLLSNKTQNKNKKNYLQKSKTELIFQPKIKKFSN KSLSDTKENFKLPILVPGLINLQLSKEYSYGGCETHKFGNKIKGILERSKTLYCKNKL
Sbjct:    1 MSEFLFAWGSNEHNQCLFDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLVKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEMNQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINNIISDNYGINSLQFGSWHVVGVLSAQNIEINDSSDENSNFESTFDSESSDAFEIPSIKAITNISNRERTYTTLKELYSKTPEMKSIETEIQPRNIYKTQIHGSDNSKTKHNIEENPVLLITNIIPNIHNENHNKIQISVHFENISSQIDINPDLSKNGLLSNKTQNKNKKNYLQKSKTELIFQPKIKKFSNVKSLSDTKENFKLPILVPGLINLQLSKEYSYGGCETHKFGNKIKGILERSKTLYCKNKL 606          
BLAST of FYVE-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064746.1 (SMESG000064746.1)

HSP 1 Score: 1059.28 bits (2738), Expect = 0.000e+0
Identity = 575/580 (99.14%), Postives = 579/580 (99.83%), Query Frame = 2
Query:  221 MKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINNMISDNYGINSLQFGSWHVVGVLSAQXXXXXXXXXXXXXXXXXXXXXXXXXXXIPSIKAITNISNRERTYTTLKELYSKTPEMKSIETEIQPRNIYKTQIHGSDNSKTKHNIEENPVLLXXXXXXXXXXXXXXXXQISVHFENISSQIDINPDLSKNGLLSNKTQNKNKKNYLQKSKTELIFQPKIKKFSNAKSLSDTKENFKLPILVPGLINLQLSKEYSYGGCETHKFGNKIKGILERSKTLYCKNKL 1960
            MKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVL+KNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDE+NQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINN+ISDNYGINSLQFGSWHVVGVLSAQNIEINDSSDENSNFESTFDSESSD+FEIPSIKAITNISNRERTYTTLKELYSKTPEMKSIETEIQPRNIYKTQIHGSDNSKTKHNIEENPVLLITNIIPNIHNENHNKIQISVHFENISSQIDINPDLSKNGLLSNKTQNKNKKNYLQKSKTELIFQPKIKKFSN KSLSDTKENFKLPILVPGLINLQLSKEYSYGGCETHKFGNKIKGILERSKTLYCKNKL
Sbjct:    1 MKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLVKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEMNQIFCWGYGLPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEPFKISINNIISDNYGINSLQFGSWHVVGVLSAQNIEINDSSDENSNFESTFDSESSDAFEIPSIKAITNISNRERTYTTLKELYSKTPEMKSIETEIQPRNIYKTQIHGSDNSKTKHNIEENPVLLITNIIPNIHNENHNKIQISVHFENISSQIDINPDLSKNGLLSNKTQNKNKKNYLQKSKTELIFQPKIKKFSNVKSLSDTKENFKLPILVPGLINLQLSKEYSYGGCETHKFGNKIKGILERSKTLYCKNKL 580          
BLAST of FYVE-type domain-containing protein vs. Planmine SMEST
Match: SMESG000054104.1 (SMESG000054104.1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.090e-13
Identity = 83/358 (23.18%), Postives = 152/358 (42.46%), Query Frame = 2
Query:  128 KFKNVMSEFLFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISC--GGTFTIFTTHCNCIIKYGSIIGDT-----NPNFKLDLP----CFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTY--HTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISH 1147
            KFK+ +   ++ WG N+ +Q   +  +K   +KL   N    + +   I  GS     +TR G VY  G+++  +LG G +  I    I  P        +LE +D   I  ++   GG   I  T       +G   GD      N   KL+ P     F G  +  ++CG  H   ++  G +  +G   YG++G      D+++     P +V S   ++V+++A G+    TL L     ++ WG G    L  G  +G ++           +I ++ G+  S  LT + +++  G   + +         +  P++I+   + K+ ++     +  A T++ +VY WG   H
Sbjct: 3116 KFKSRIMSKIYVWGLNDKDQLGCEATSK---VKLPILNEALSELDCVSISGGSKSLFCVTRTGKVYVAGDSSNGRLGIGSDTDITAEVIIGPK-------RLEALDKYFIVKVAVHSGGRHAIALTKNGETFSWGE--GDDGKLGHNSRLKLNYPRKIKYFKGKRVVDVACGSSHSAAIVFGGHLYTWGLGDYGRLGHG----DTAMRL--HPELVKSLRDYKVVQVACGSRDAQTLALTSDFTVWSWGDGDFGKLGRGGSSGCLIPQKIECMSLSNVIQIECGAQSSFALTENGQVWTWGKGDYYRLGHGTD-KHIREPMQIEDLKKTKIVHLAVGALHCLAVTDRGQVYSWGDNDH 3454          

HSP 2 Score: 68.5514 bits (166), Expect = 1.564e-11
Identity = 67/297 (22.56%), Postives = 126/297 (42.42%), Query Frame = 2
Query:  272 IKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFT---IFTTHCNC--IIKYGSI-IGDTNPNFKLDL--PCFAGSISKISCG--QCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG----YGLPCGVINGHIMQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKD 1117
            +  G  H++ LT+ G  + WG  +  +L  G+N  +K   +N P        K+++     + +++CG + +   +F  H     +  YG +  GDT      +L        + +++CG      + L S   V  +G   +G++G               P+ +       VI+I  G   +  L E  Q++ WG    Y L  G  + HI +P  +  + +  I+ L  G+ H L +T+  ++++ G N  GQ   N    +   P  +    +NK+ ++ C + +S A T  D
Sbjct: 3220 VHSGGRHAIALTKNGETFSWGEGDDGKL--GHNSRLK---LNYPR-------KIKYFKGKRVVDVACGSSHSAAIVFGGHLYTWGLGDYGRLGHGDTAMRLHPELVKSLRDYKVVQVACGSRDAQTLALTSDFTVWSWGDGDFGKLG------RGGSSGCLIPQKIECMSLSNVIQIECGAQSSFALTENGQVWTWGKGDYYRLGHGT-DKHIREPMQIEDLKKTKIVHLAVGALHCLAVTDRGQVYSWGDNDHGQQG-NGTVTYNMRPTLVSALMDNKIAHVACGSSHSVAWTASD 3496          

HSP 3 Score: 61.6178 bits (148), Expect = 2.083e-9
Identity = 70/302 (23.18%), Postives = 126/302 (41.72%), Query Frame = 2
Query:  158 FAWGSNEHNQCLLDDNNKTISMKLGFENRVPID--QNIKYIK--------CGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKI-IKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGS-ISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHI---MQPSHMPGIYE-PIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPY 1015
            F+WG         DD       KLG  +R+ ++  + IKY K        CGSSHS  +   GH+Y WG  +  +LG G   + + P  +        ++      D+   + ++    FT+++       K G   G +       + C + S + +I CG      L  +GQV  +GK  Y ++G        + + +  P  +      +++ +A G  H L + +  Q++ WG        NG +   M+P+ +  + +  I  +  GS+HS+  T S     + S +  QA   +P+
Sbjct: 3237 FSWGEG-------DDG------KLGHNSRLKLNYPRKIKYFKGKRVVDVACGSSHSAAIVFGGHLYTWGLGDYGRLGHGDTAMRLHPELVKSLRDYKVVQVACGSRDA---QTLALTSDFTVWSWGDGDFGKLGR-GGSSGCLIPQKIECMSLSNVIQIECGAQSSFALTENGQVWTWGKGDYYRLG------HGTDKHIREPMQIEDLKKTKIVHLAVGALHCLAVTDRGQVYSWGDNDHGQQGNGTVTYNMRPTLVSALMDNKIAHVACGSSHSVAWTAS----DLDSFLPSQALNRWPH 3511          

HSP 4 Score: 60.4622 bits (145), Expect = 4.547e-9
Identity = 77/323 (23.84%), Postives = 130/323 (40.25%), Query Frame = 2
Query:  281 GSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSII--GDTNPN-FKLDL----------PCFAGSISK-----ISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIA--TGTYHTLCL--DEINQI--------FCWGYGLPCGVINGHIMQPSHMPGIYEP-----IIDLDGGSNHSLFLTNSRKIFAIGSNVF---GQAAPNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAKTEKDEVYMWG 1135
            G     +++ +G VY  G  N  +LG G  +      +  P   + LE K+     V+   ++ GG       HC  +   G +   GD   N   LD+          P    S+ K     I+ G  H   +  SG++  +GK  YG++G    D          P++V +   + VI +A  +G   TLC+  +E ++I        + WG G   G +         +P   E      +I +D GS  SL LT S +++  G   +   G  + N     +  P ++ + +  K+ ++ C + +    TE  EVY WG
Sbjct: 4171 GEQSLFIVSIDGRVYATGFGNNGRLGIGSTE-----SVQTPILVSGLEEKI-----VVKVAVNSGGK------HCLALCNNGLVYAWGDAEDNKLGLDIRVQPGEDVLTPTLVKSLVKAEIIDIAAGGSHSAAISRSGELYTWGKGRYGRLGHGNGD------DQPFPKIVEALRGYHVIGVACGSGDAQTLCITKNEDSRIDLVPNTSVWSWGDG-DYGKLGRGGFDICKLPMKIETLEGAGVIKVDCGSQFSLVLTASGEVYTWGKGDYFRLGHGSDNH----VRKPEKVAQLNRKKIIDVACGSLHCICCTEDGEVYSWG 4466          
BLAST of FYVE-type domain-containing protein vs. Planmine SMEST
Match: SMESG000057228.1 (SMESG000057228.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.166e-13
Identity = 67/277 (24.19%), Postives = 115/277 (41.52%), Query Frame = 2
Query:  269 YIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIGDTN-------PNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSL-FLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKF 1051
            Y+ CGS  SV L+  G +Y WG+NN NQLG           I            ++ + +  I  ++CG    +  +  + +  +G      IG+ N       P   L L C    I +I+CG  H  +L +SG V  +G N +GQ+G  +   + ++   S P  + S    ++  I  G++H   L     +F +G G    L  G           M  +   +  L  G+  +L ++T S++ +  G +  GQ         ++SP ++  F
Sbjct:  100 YVACGSHFSVALSTNGIIYTWGSNNANQLGRAMRDEFGKIEI------------VQCLSNYSIIQVACGLGHCLALSIDSILFSWGENKHGQIGNGNTSPFVSVPEIVLSLECLP--IKQIACGDLHSSILTTSGSVYTWGDNSHGQLGTGKNGSEEALS--SNPIFLKSIKGIQIAYICVGSFHNALLTHDGGVFTFGDGRYGQLGHGNFEDQFSPRKVMDLMGSTVTQLSCGNFFTLVYVTESKRFYGFGKSDEGQLGIGIHTEAVDSPTKLDDF 360          

HSP 2 Score: 63.5438 bits (153), Expect = 4.090e-10
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  263 IKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFT--------IFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YGLPCGVINGHIMQPSHMPGIYEPIIDLD-----GGSNHSLFLTNSRKIFAIGSNVFGQAA-PNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAK-TEKDEVYMWGK 1138
            +K++ CG+SH+VM    G V   G+N+  Q G+      K  + +        E K  +V        +CG  F+        I+T   N   + G  + D     ++ + C +  SI +++CG  H + L     +  +G+N +GQIG       ++   VS P +V S     + +IA G  H+  L     ++ WG   +G      NG     S  P   + I  +       GS H+  LT+   +F  G   +GQ    NF   F  SP ++     + VT + C N ++    TE    Y +GK
Sbjct:   48 VKHVACGTSHTVMCLCNGTVLCAGDNSLLQFGK------KAPKSHFEKISLFKEDKCCYV--------ACGSHFSVALSTNGIIYTWGSNNANQLGRAMRDEFGKIEI-VQCLSNYSIIQVACGLGHCLALSIDSILFSWGENKHGQIGN-----GNTSPFVSVPEIVLSLECLPIKQIACGDLHSSILTTSGSVYTWGDNSHGQLGTGKNGSEEALSSNPIFLKSIKGIQIAYICVGSFHNALLTHDGGVFTFGDGRYGQLGHGNFEDQF--SPRKVMDLMGSTVTQLSCGNFFTLVYVTESKRFYGFGK 336          

HSP 3 Score: 59.6918 bits (143), Expect = 6.568e-9
Identity = 58/192 (30.21%), Postives = 90/192 (46.88%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMK---LGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNK----------IIKPTR-INIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCH-VVLLLSSGQVACFGKNMYGQIGI 685
            LF+WG N+H Q    + +  +S+    L  E  +PI Q    I CG  HS +LT  G VY WG+N+  QLG G N            +K  + I I + C        F +++L  +   GG FT F       + +G+     +P   +DL     +++++SCG    +V +  S +   FGK+  GQ+GI
Sbjct:  169 LFSWGENKHGQIGNGNTSPFVSVPEIVLSLEC-LPIKQ----IACGDLHSSILTTSGSVYTWGDNSHGQLGTGKNGSEEALSSNPIFLKSIKGIQIAYICVG-----SFHNALLTHD---GGVFT-FGDGRYGQLGHGNFEDQFSPRKVMDL--MGSTVTQLSCGNFFTLVYVTESKRFYGFGKSDEGQLGI 344          

HSP 4 Score: 55.4546 bits (132), Expect = 1.348e-7
Identity = 61/248 (24.60%), Postives = 98/248 (39.52%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQ-----NIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIG----------DTNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG 838
            ++ WGSN  NQ       + +  + G   ++ I Q     +I  + CG  H + L+ +  ++ WG N   Q+G G         +++P     LE        + IK I+CG   +   T    +  +G      +G           +NP F   L    G  I+ I  G  H  LL   G V  FG   YGQ+G        + E   +PR V       V +++ G + TL     ++ F +G+G
Sbjct:  117 IYTWGSNNANQL-----GRAMRDEFG---KIEIVQCLSNYSIIQVACGLGHCLALSIDSILFSWGENKHGQIGNGNTSPF----VSVPEIVLSLE-------CLPIKQIACGDLHSSILTTSGSVYTWGDNSHGQLGTGKNGSEEALSSNPIF---LKSIKGIQIAYICVGSFHNALLTHDGGVFTFGDGRYGQLG------HGNFEDQFSPRKVMDLMGSTVTQLSCGNFFTLVYVTESKRF-YGFG 335          
BLAST of FYVE-type domain-containing protein vs. Planmine SMEST
Match: SMESG000057228.1 (SMESG000057228.1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.469e-13
Identity = 67/277 (24.19%), Postives = 115/277 (41.52%), Query Frame = 2
Query:  269 YIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIGDTN-------PNFKLDLPCFAGSISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG----LPCGVINGHIMQPSHMPGIYEPIIDLDGGSNHSL-FLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEIKKF 1051
            Y+ CGS  SV L+  G +Y WG+NN NQLG           I            ++ + +  I  ++CG    +  +  + +  +G      IG+ N       P   L L C    I +I+CG  H  +L +SG V  +G N +GQ+G  +   + ++   S P  + S    ++  I  G++H   L     +F +G G    L  G           M  +   +  L  G+  +L ++T S++ +  G +  GQ         ++SP ++  F
Sbjct:  100 YVACGSHFSVALSTNGIIYTWGSNNANQLGRAMRDEFGKIEI------------VQCLSNYSIIQVACGLGHCLALSIDSILFSWGENKHGQIGNGNTSPFVSVPEIVLSLECLP--IKQIACGDLHSSILTTSGSVYTWGDNSHGQLGTGKNGSEEALS--SNPIFLKSIKGIQIAYICVGSFHNALLTHDGGVFTFGDGRYGQLGHGNFEDQFSPRKVMDLMGSTVTQLSCGNFFTLVYVTESKRFYGFGKSDEGQLGIGIHTEAVDSPTKLDDF 360          

HSP 2 Score: 63.1586 bits (152), Expect = 5.694e-10
Identity = 79/311 (25.40%), Postives = 129/311 (41.48%), Query Frame = 2
Query:  263 IKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFT--------IFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWG---YGLPCGVINGHIMQPSHMPGIYEPIIDLD-----GGSNHSLFLTNSRKIFAIGSNVFGQAA-PNFPYPFLNSPVEIKKFDENKVTNIYCCNHYSAAK-TEKDEVYMWGK 1138
            +K++ CG+SH+VM    G V   G+N+  Q G+      K  + +        E K  +V        +CG  F+        I+T   N   + G  + D     ++ + C +  SI +++CG  H + L     +  +G+N +GQIG       ++   VS P +V S     + +IA G  H+  L     ++ WG   +G      NG     S  P   + I  +       GS H+  LT+   +F  G   +GQ    NF   F  SP ++     + VT + C N ++    TE    Y +GK
Sbjct:   48 VKHVACGTSHTVMCLCNGTVLCAGDNSLLQFGK------KAPKSHFEKISLFKEDKCCYV--------ACGSHFSVALSTNGIIYTWGSNNANQLGRAMRDEFGKIEI-VQCLSNYSIIQVACGLGHCLALSIDSILFSWGENKHGQIGN-----GNTSPFVSVPEIVLSLECLPIKQIACGDLHSSILTTSGSVYTWGDNSHGQLGTGKNGSEEALSSNPIFLKSIKGIQIAYICVGSFHNALLTHDGGVFTFGDGRYGQLGHGNFEDQF--SPRKVMDLMGSTVTQLSCGNFFTLVYVTESKRFYGFGK 336          

HSP 3 Score: 59.6918 bits (143), Expect = 6.835e-9
Identity = 58/192 (30.21%), Postives = 90/192 (46.88%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMK---LGFENRVPIDQNIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNK----------IIKPTR-INIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSISKISCGQCH-VVLLLSSGQVACFGKNMYGQIGI 685
            LF+WG N+H Q    + +  +S+    L  E  +PI Q    I CG  HS +LT  G VY WG+N+  QLG G N            +K  + I I + C        F +++L  +   GG FT F       + +G+     +P   +DL     +++++SCG    +V +  S +   FGK+  GQ+GI
Sbjct:  169 LFSWGENKHGQIGNGNTSPFVSVPEIVLSLEC-LPIKQ----IACGDLHSSILTTSGSVYTWGDNSHGQLGTGKNGSEEALSSNPIFLKSIKGIQIAYICVG-----SFHNALLTHD---GGVFT-FGDGRYGQLGHGNFEDQFSPRKVMDL--MGSTVTQLSCGNFFTLVYVTESKRFYGFGKSDEGQLGI 344          

HSP 4 Score: 55.4546 bits (132), Expect = 1.488e-7
Identity = 61/248 (24.60%), Postives = 98/248 (39.52%), Query Frame = 2
Query:  155 LFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQ-----NIKYIKCGSSHSVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFVDSVLIKNISCGGTFTIFTTHCNCIIKYGS----IIG----------DTNPNFKLDLPCFAG-SISKISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVTSHFAHRVIKIATGTYHTLCLDEINQIFCWGYG 838
            ++ WGSN  NQ       + +  + G   ++ I Q     +I  + CG  H + L+ +  ++ WG N   Q+G G         +++P     LE        + IK I+CG   +   T    +  +G      +G           +NP F   L    G  I+ I  G  H  LL   G V  FG   YGQ+G        + E   +PR V       V +++ G + TL     ++ F +G+G
Sbjct:  117 IYTWGSNNANQL-----GRAMRDEFG---KIEIVQCLSNYSIIQVACGLGHCLALSIDSILFSWGENKHGQIGNGNTSPF----VSVPEIVLSLE-------CLPIKQIACGDLHSSILTTSGSVYTWGDNSHGQLGTGKNGSEEALSSNPIF---LKSIKGIQIAYICVGSFHNALLTHDGGVFTFGDGRYGQLG------HGNFEDQFSPRKVMDLMGSTVTQLSCGNFFTLVYVTESKRF-YGFG 335          
The following BLAST results are available for this feature:
BLAST of FYVE-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HERC42.793e-1928.37HECT and RLD domain containing E3 ubiquitin protei... [more]
HERC43.108e-1928.37HECT and RLD domain containing E3 ubiquitin protei... [more]
HERC43.176e-1928.37HECT and RLD domain containing E3 ubiquitin protei... [more]
HERC42.170e-1828.92HECT and RLD domain containing E3 ubiquitin protei... [more]
RCBTB11.238e-1627.22RCC1 and BTB domain containing protein 1 [Source:H... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nekl-11.676e-1320.56NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
nekl-11.907e-1320.56NEK (NEver in mitosis Kinase) Like [Source:UniPro... [more]
glo-41.601e-1224.64X-linked retinitis pigmentosa GTPase regulator hom... [more]
herc-11.608e-1223.29HECT and RCC domain E3 ubiquitin ligase [Source:U... [more]
herc-11.608e-1223.29HECT and RCC domain E3 ubiquitin ligase [Source:U... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Herc42.089e-1623.56gene:FBgn0035207 transcript:FBtr0072670[more]
Herc42.089e-1623.56gene:FBgn0035207 transcript:FBtr0072671[more]
Herc42.241e-1622.92gene:FBgn0035207 transcript:FBtr0310555[more]
HERC24.604e-1023.58gene:FBgn0031107 transcript:FBtr0301344[more]
CG66784.213e-821.65gene:FBgn0038917 transcript:FBtr0084148[more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
herc45.030e-1829.97HECT and RLD domain containing E3 ubiquitin protei... [more]
slc47a2.21.017e-1627.46solute carrier family 47 member 2.2 [Source:ZFIN;A... [more]
rcbtb12.866e-1625.34regulator of chromosome condensation (RCC1) and BT... [more]
rcbtb12.866e-1625.34regulator of chromosome condensation (RCC1) and BT... [more]
rpgrb6.914e-1524.77retinitis pigmentosa GTPase regulator b [Source:ZF... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prxl2b5.594e-2029.58peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-... [more]
prxl2b1.089e-1929.23peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-... [more]
prxl2b1.393e-1929.23peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-... [more]
prxl2b1.606e-1929.23peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-... [more]
prxl2b1.769e-1929.23peroxiredoxin like 2B [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Herc41.288e-1928.07hect domain and RLD 4 [Source:MGI Symbol;Acc:MGI:1... [more]
Herc41.399e-1928.07hect domain and RLD 4 [Source:MGI Symbol;Acc:MGI:1... [more]
Sergef7.230e-1824.66secretion regulating guanine nucleotide exchange f... [more]
Sergef1.626e-1725.00secretion regulating guanine nucleotide exchange f... [more]
Rpgr2.643e-1726.30retinitis pigmentosa GTPase regulator [Source:MGI ... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q947D2|PRAF1_ARATH5.314e-2128.75PH, RCC1 and FYVE domains-containing protein 1 OS=... [more]
sp|Q5PQN1|HERC4_RAT3.445e-1928.37Probable E3 ubiquitin-protein ligase HERC4 OS=Ratt... [more]
sp|Q6PAV2|HERC4_MOUSE9.783e-1928.07Probable E3 ubiquitin-protein ligase HERC4 OS=Mus ... [more]
sp|Q5GLZ8|HERC4_HUMAN1.493e-1828.37Probable E3 ubiquitin-protein ligase HERC4 OS=Homo... [more]
sp|Q9FN03|UVR8_ARATH3.163e-1724.68Ultraviolet-B receptor UVR8 OS=Arabidopsis thalian... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|238947413.168e-3226.55tr|K1S4M2|K1S4M2_CRAGI X-linked retinitis pigmento... [more]
gnl|BL_ORD_ID|203316626.158e-3227.75tr|A0A1S3I914|A0A1S3I914_LINUN uncharacterized pro... [more]
gnl|BL_ORD_ID|169916197.429e-3227.79tr|A0A1S3IBF0|A0A1S3IBF0_LINUN uncharacterized pro... [more]
gnl|BL_ORD_ID|1745791682.953e-3128.13tr|A0A3Q2VBD2|A0A3Q2VBD2_HAPBU Uncharacterized pro... [more]
gnl|BL_ORD_ID|1761907143.513e-3128.13tr|A0A3P8NX31|A0A3P8NX31_ASTCA Uncharacterized pro... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rpgrb1.049e-1825.08X-linked retinitis pigmentosa GTPase regulator-lik... [more]
rcbtb12.334e-1525.00regulator of chromosome condensation (RCC1) and BT... [more]
RPGR4.652e-1424.00retinitis pigmentosa GTPase regulator [Source:HGNC... [more]
herc43.481e-1324.10HECT and RLD domain containing E3 ubiquitin protei... [more]
herc43.778e-1324.10HECT and RLD domain containing E3 ubiquitin protei... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001275.12.468e-1623.90pep scaffold:Pmarinus_7.0:GL476529:184068:212443:-... [more]
rcc26.937e-1023.27regulator of chromosome condensation 2 [Source:NCB... [more]
rcc22.242e-923.94regulator of chromosome condensation 2 [Source:NCB... [more]
NEK91.042e-823.22NIMA related kinase 9 [Source:HGNC Symbol;Acc:HGNC... [more]
rcc15.861e-822.39regulator of chromosome condensation 1 [Source:ZFI... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SRM16.985e-923.42Nucleotide exchange factor for Gsp1p; localizes to... [more]
FMP255.634e-725.97Protein required for assembly of respiratory compl... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO346102.472e-1928.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490993.187e-1823.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345923.335e-1423.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332454.564e-1421.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371961.562e-1323.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015298.22.970e-1831.25probable E3 ubiquitin-protein ligase HERC4 [Source... [more]
rcbtb19.103e-1726.01RCC1 and BTB domain-containing protein 1 [Source:N... [more]
rcbtb11.267e-1626.01RCC1 and BTB domain-containing protein 1 [Source:N... [more]
ENSORLT00000033625.12.252e-1528.22probable E3 ubiquitin-protein ligase HERC4 [Source... [more]
rpgrb4.116e-1524.85X-linked retinitis pigmentosa GTPase regulator [So... [more]
back to top
BLAST of FYVE-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064746.10.000e+099.01SMESG000064746.1[more]
SMESG000064746.10.000e+099.14SMESG000064746.1[more]
SMESG000054104.11.090e-1323.18SMESG000054104.1[more]
SMESG000057228.11.166e-1324.19SMESG000057228.1[more]
SMESG000057228.11.469e-1324.19SMESG000057228.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026522 ID=SMED30026522|Name=FYVE-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2116bp
CAAAGTGATTTGAAAATGAAATATATTTATTTTTTTGGTATTTTTTAATT
GATTTTTAAAATGGGTTGAAACGTTTTCAAAATAGGGTTAAAAACCCTTG
TAATATAATTTAAATGGTTTGATCTATAAATTCAAAAACGTCATGAGCGA
ATTTTTATTTGCATGGGGTAGTAATGAGCATAATCAATGTCTGCTTGATG
ATAATAATAAAACAATTTCAATGAAGTTAGGGTTTGAAAATCGAGTTCCA
ATTGATCAAAATATTAAATATATCAAATGTGGTTCTAGTCATTCTGTTAT
GTTAACTCGAGAAGGTCACGTTTATGGATGGGGAAACAATAATCAAAACC
AACTTGGAGAAGGATACAATAAAATAATAAAACCAACCAGAATAAATATT
CCTCACACGTGTACAAAATTAGAATCGAAATTAGAATTTGTTGATAGCGT
TCTGATTAAAAATATTTCTTGCGGAGGAACTTTTACAATTTTTACCACTC
ATTGCAATTGTATAATAAAATACGGTTCAATAATTGGAGATACTAATCCT
AATTTTAAATTGGATCTTCCTTGTTTTGCGGGTTCTATATCGAAGATTTC
ATGTGGACAATGCCATGTAGTGTTACTTCTATCAAGTGGTCAAGTTGCTT
GTTTTGGAAAAAATATGTATGGCCAAATTGGAATTCCCAGAAAGGATTTA
GATAGTAGTGTAGAAACTGTATCTACCCCACGGGTAGTAACAAGCCATTT
TGCTCATCGCGTTATCAAAATCGCTACAGGAACTTACCATACATTATGTT
TAGATGAAATAAATCAAATATTCTGCTGGGGGTATGGCTTGCCATGTGGC
GTTATAAATGGGCACATAATGCAACCTAGTCATATGCCAGGTATTTACGA
GCCTATAATAGATTTAGATGGGGGCTCAAATCATTCCTTGTTTTTAACAA
ATTCTAGAAAAATATTTGCAATAGGATCTAATGTCTTTGGTCAAGCTGCC
CCGAACTTTCCATATCCATTTCTAAACAGTCCAGTTGAAATAAAAAAATT
TGATGAAAATAAAGTGACAAATATATACTGCTGTAATCACTATTCAGCAG
CTAAAACTGAAAAGGACGAAGTCTATATGTGGGGTAAAATCAGTCACATT
ATCACAAACGATTACCAGACCTCAGATATTTTTAAAGAACCGTTTAAAAT
TTCAATAAATAATATGATAAGTGATAATTACGGAATAAATTCTTTGCAAT
TCGGATCTTGGCACGTTGTTGGTGTTCTTTCGGCGCAAAATATTGAGATA
AATGATAGTTCGGATGAAAATTCAAACTTCGAAAGCACTTTTGACAGTGA
ATCATCCGATTCATTCGAGATTCCTAGCATTAAGGCAATCACCAATATTT
CCAATAGAGAAAGAACATATACGACATTGAAAGAATTGTATTCTAAAACA
CCTGAAATGAAATCTATTGAAACTGAAATTCAACCGAGAAATATTTATAA
AACACAAATTCATGGATCTGATAACTCAAAGACTAAGCATAATATTGAAG
AGAATCCTGTGCTATTAATCACCAATATTATCCCAAACATTCACAATGAG
AATCATAATAAAATCCAAATTTCGGTTCATTTTGAAAACATTTCAAGTCA
AATTGACATAAATCCAGACTTATCAAAAAATGGCCTTTTAAGTAATAAAA
CTCAAAATAAAAACAAAAAAAATTATTTGCAAAAATCAAAAACTGAATTA
ATTTTTCAGCCAAAAATTAAAAAGTTTTCGAATGCCAAATCTTTATCAGA
TACTAAAGAAAATTTCAAACTGCCAATTCTTGTTCCTGGTCTGATAAATT
TACAGTTGAGCAAGGAATACAGCTATGGAGGATGTGAAACCCACAAATTT
GGGAATAAAATTAAAGGAATTCTAGAACGGTCGAAAACGTTATACTGTAA
AAACAAATTATAAAAATAATACAGTTTTCCTAGTTCTTTGAAATTAGAAG
ATTCGTTAGTCAATGTGAAATAATATATTAAAACCGTTAGTAAAAGCAGA
TCGCTATCAATAATGAAATATTAAGTAGTAAATATTCTTGATCAGCGAAC
AAAATCAATTTTTGAC
back to top

protein sequence of SMED30026522-orf-1

>SMED30026522-orf-1 ID=SMED30026522-orf-1|Name=SMED30026522-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=607bp
MSEFLFAWGSNEHNQCLLDDNNKTISMKLGFENRVPIDQNIKYIKCGSSH
SVMLTREGHVYGWGNNNQNQLGEGYNKIIKPTRINIPHTCTKLESKLEFV
DSVLIKNISCGGTFTIFTTHCNCIIKYGSIIGDTNPNFKLDLPCFAGSIS
KISCGQCHVVLLLSSGQVACFGKNMYGQIGIPRKDLDSSVETVSTPRVVT
SHFAHRVIKIATGTYHTLCLDEINQIFCWGYGLPCGVINGHIMQPSHMPG
IYEPIIDLDGGSNHSLFLTNSRKIFAIGSNVFGQAAPNFPYPFLNSPVEI
KKFDENKVTNIYCCNHYSAAKTEKDEVYMWGKISHIITNDYQTSDIFKEP
FKISINNMISDNYGINSLQFGSWHVVGVLSAQNIEINDSSDENSNFESTF
DSESSDSFEIPSIKAITNISNRERTYTTLKELYSKTPEMKSIETEIQPRN
IYKTQIHGSDNSKTKHNIEENPVLLITNIIPNIHNENHNKIQISVHFENI
SSQIDINPDLSKNGLLSNKTQNKNKKNYLQKSKTELIFQPKIKKFSNAKS
LSDTKENFKLPILVPGLINLQLSKEYSYGGCETHKFGNKIKGILERSKTL
YCKNKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
GO:0003723RNA binding
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR000408Reg_chr_condens
IPR009091RCC1/BLIP-II
IPR009465Spondin_N
Vocabulary: cellular component
TermDefinition
GO:0001750photoreceptor outer segment
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
GO:0005929cilium
GO:0036064ciliary basal body
GO:0036126sperm flagellum
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
GO:0007601visual perception
GO:0030030cell projection organization
GO:0042073intraciliary transport
GO:0043547positive regulation of GTPase activity
GO:0050896response to stimulus
GO:0060271cilium morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000408Regulator of chromosome condensation, RCC1PRINTSPR00633RCCNDNSATIONcoord: 3..19
score: 25.49
coord: 155..173
score: 33.33
coord: 219..240
score: 21.21
coord: 44..60
score: 40.2
coord: 60..74
score: 46.67
IPR000408Regulator of chromosome condensation, RCC1PFAMPF00415RCC1coord: 57..117
e-value: 7.7E-8
score: 32.8
coord: 166..220
e-value: 2.3E-7
score: 31.3
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS00626RCC1_2coord: 210..220
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 3..57
score: 9.419
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 166..223
score: 12.072
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 224..271
score: 8.916
IPR000408Regulator of chromosome condensation, RCC1PROSITEPS50012RCC1_3coord: 58..121
score: 10.866
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IIGENE3DG3DSA:2.130.10.30coord: 133..382
e-value: 8.7E-36
score: 125.4
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IIGENE3DG3DSA:2.130.10.30coord: 2..132
e-value: 8.8E-20
score: 72.6
IPR009091Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein IISUPERFAMILYSSF50985RCC1/BLIP-IIcoord: 5..378
NoneNo IPR availablePFAMPF13540RCC1_2coord: 255..284
e-value: 6.2E-5
score: 22.7
NoneNo IPR availablePANTHERPTHR22870:SF330E3 UBIQUITIN-PROTEIN LIGASE HERC2coord: 6..115
coord: 149..444
NoneNo IPR availablePANTHERPTHR22870REGULATOR OF CHROMOSOME CONDENSATIONcoord: 6..115
NoneNo IPR availablePANTHERPTHR22870REGULATOR OF CHROMOSOME CONDENSATIONcoord: 149..444