Bifunctional purine biosynthesis protein PURH

Overview
NameBifunctional purine biosynthesis protein PURH
Smed IDSMED30026515
Length (bp)1913
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bifunctional purine biosynthesis protein PURH (SMED30026515) t-SNE clustered cells

Violin plots show distribution of expression levels for Bifunctional purine biosynthesis protein PURH (SMED30026515) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bifunctional purine biosynthesis protein PURH (SMED30026515) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bifunctional purine biosynthesis protein PURH (SMED30026515) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Human
Match: ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:HGNC Symbol;Acc:HGNC:794])

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 360/596 (60.40%), Postives = 455/596 (76.34%), Query Frame = 3
Query:   60 KLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSI-TNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            +LAL SVSDKT L     +L +L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILARN  +D  D+ ++++  I +V CNLYPF K ++S  + + +A+E IDIGGVTL+RAAAKN ARV V+C+P DY  V  EM+S  + + S+ETR +LALKAF HTA YDE IS YF+ ++ +  + + LRYGMNPHQ PA L   L+      +P+T++NG+PGF+NLCDALNAWQLV EL +A    IPAAASFKHVSPAGAA+G+PLS+DE K C+V  +   LTP+++AYARARGADRMSSFGDF+ALSD CDV TAKIISREVSDGIIAP Y EEAL ILS KK G YCVL+++++Y+P  +E++T+FG  L QKRN+ +++   F N    +  LPESA+RDLIVATIA+KYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G   ED E+ +K    FE  P+ LT+ E+K+W+ KL  V +SSDAFFPFRDN+DRA +SGV +IAAPSGS  D  +IEAC E  +IL HT LRLFHH
Sbjct:    5 QLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQL-YTLQPK----LPITVLNGAPGFINLCDALNAWQLVKELKEALG--IPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGED-EDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH 592          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Human
Match: ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:HGNC Symbol;Acc:HGNC:794])

HSP 1 Score: 741.495 bits (1913), Expect = 0.000e+0
Identity = 362/599 (60.43%), Postives = 456/599 (76.13%), Query Frame = 3
Query:   54 MSKL-ALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSI-TNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            MS L AL SVSDKT L     +L +L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILARN  +D  D+ ++++  I +V CNLYPF K ++S  + + +A+E IDIGGVTL+RAAAKN ARV V+C+P DY  V  EM+S  + + S+ETR +LALKAF HTA YDE IS YF+ ++ +  + + LRYGMNPHQ PA L   L+      +P+T++NG+PGF+NLCDALNAWQLV EL +A    IPAAASFKHVSPAGAA+G+PLS+DE K C+V  +   LTP+++AYARARGADRMSSFGDF+ALSD CDV TAKIISREVSDGIIAP Y EEAL ILS KK G YCVL+++++Y+P  +E++T+FG  L QKRN+ +++   F N    +  LPESA+RDLIVATIA+KYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G   ED E+ +K    FE  P+ LT+ E+K+W+ KL  V +SSDAFFPFRDN+DRA +SGV +IAAPSGS  D  +IEAC E  +IL HT LRLFHH
Sbjct:    1 MSSLSALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQL-YTLQPK----LPITVLNGAPGFINLCDALNAWQLVKELKEALG--IPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGED-EDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH 591          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Human
Match: ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:HGNC Symbol;Acc:HGNC:794])

HSP 1 Score: 294.664 bits (753), Expect = 1.322e-95
Identity = 136/217 (62.67%), Postives = 173/217 (79.72%), Query Frame = 3
Query: 1062 EVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRA 1703
            +VSDGIIAP Y EEAL ILS KK G YCVL+++++Y+P  +E++T+FG  L QKRN+ +++   F N    +  LPESA+RDLIVATIA+KYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G   ED E+ +K    FE  P+ LT+ E+K+W+ KL  V +SSDAFFPFRDN+DRA
Sbjct:    5 QVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGED-EDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRA 220          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Human
Match: ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:HGNC Symbol;Acc:HGNC:794])

HSP 1 Score: 192.2 bits (487), Expect = 3.460e-57
Identity = 90/160 (56.25%), Postives = 119/160 (74.38%), Query Frame = 3
Query:  225 LLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSI-TNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANL 698
            +L GRVKTLHPA+HAGILARN  +D  D+ ++++  I +V CNLYPF K ++S  + + +A+E IDIGGVTL+RAAAKN ARV V+C+P DY  V  EM+S  + + S+ETR +LALKAF HTA YDE IS YF+ ++ +  + + LRYGMNPHQ PA L
Sbjct:    1 MLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQL 160          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Human
Match: ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:HGNC Symbol;Acc:HGNC:794])

HSP 1 Score: 77.0258 bits (188), Expect = 9.730e-17
Identity = 38/73 (52.05%), Postives = 50/73 (68.49%), Query Frame = 3
Query:   60 KLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGIL 278
            +LAL SVSDKT L     +L +L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HA +L
Sbjct:    5 QLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAELL 77          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Celegans
Match: atic-1 (5-Aminoimidazole-4-carboxamide ribonucleotide formylTransferase/IMP Cyclohydrolase homolog [Source:UniProtKB/TrEMBL;Acc:Q95QQ4])

HSP 1 Score: 624.009 bits (1608), Expect = 0.000e+0
Identity = 329/602 (54.65%), Postives = 424/602 (70.43%), Query Frame = 3
Query:   48 TSMSKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF--RPETTISLRYGMNPHQIP-ANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGMEL----TPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISG--DSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            T    LA++SVSDKT L  L   L S     IASGGTA+ I D    V  ++D T  PE+L GRVKTLHPA+H GILAR++E D+ DL+K    ++ +V+CNLYPF+K + S D  + +A+E+IDIGGVTL+RAAAKN  RV+V+CDP DY+ +I+E+KS     + E R+ LALKAF HT  YDE ISG+ + +F    E  + LRYG NPHQ   A L I         MP+ ++NGSPG++N+ D LN WQLV EL+ A   ++PAAASFKHVSPAGAA+GLPL++ E   C+V+ + +      LA+AYARARGADRMSSFGDFIALS+ CD  TAKII+REVSDG++APD+   AL +L+ KK G YCVLKIN NY P   E +T+FG  L+QKRN+A+INA+ F N     ++L + AI DLIVATIALKY QSNSVC+A  GQVIG+GAGQQSRIHCTRLAG+KA  WWLRQHP VLSL +K+ +KR++ +N ID+  SG   S+   + + + F  P + L +++RK W+ +   VV+SSDAF PFRDN+D A + GV ++A P GS  D  I EAC E+ + L+HT LRLFHH
Sbjct:    2 TDGKSLAIISVSDKTGLIPLAHGLVSAGLTLIASGGTAKAIRDQGIDVHDVADVTKFPEMLGGRVKTLHPAVHGGILARDTESDRKDLEKHNISFVSVVVCNLYPFKKTVQSKDCSVEEAVENIDIGGVTLLRAAAKNHERVSVICDPADYDHIISELKS--GGTTRERRQLLALKAFEHTTSYDESISGFMRRRFAGNGERALPLRYGTNPHQKDDAELYI-----VEDEMPIKVLNGSPGYINILDGLNGWQLVKELSDA--TKMPAAASFKHVSPAGAAVGLPLNETEAACCMVSDLPIDTKKPSLAAAYARARGADRMSSFGDFIALSEKCDELTAKIINREVSDGVVAPDFDPAALSLLAKKKNGNYCVLKINPNYLPSETEERTVFGLRLRQKRNNAVINAETFNNVVGSANELNKQAIDDLIVATIALKYAQSNSVCFAHRGQVIGMGAGQQSRIHCTRLAGDKAMNWWLRQHPTVLSLPWKNAIKRSEKSNAIDVLCSGVLGSEIAIDQWQQYFNEPVEPLAEDDRKQWLSQQTGVVMSSDAFLPFRDNVDCAKQFGVSYVAHPGGSVRDDDIKEACDEHGITLIHTGLRLFHH 594          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Celegans
Match: atic-1 (5-Aminoimidazole-4-carboxamide ribonucleotide formylTransferase/IMP Cyclohydrolase homolog [Source:UniProtKB/TrEMBL;Acc:Q95QQ4])

HSP 1 Score: 444.891 bits (1143), Expect = 4.804e-151
Identity = 238/427 (55.74%), Postives = 303/427 (70.96%), Query Frame = 3
Query:  573 KAFCHTAHYDEVISGYFQNKF--RPETTISLRYGMNPHQIP-ANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGMEL----TPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISG--DSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            KAF HT  YDE ISG+ + +F    E  + LRYG NPHQ   A L I         MP+ ++NGSPG++N+ D LN WQLV EL+ A   ++PAAASFKHVSPAGAA+GLPL++ E   C+V+ + +      LA+AYARARGADRMSSFGDFIALS+ CD  TAKII+REVSDG++APD+   AL +L+ KK G YCVLKIN NY P   E +T+FG  L+QKRN+A+INA+ F N     ++L + AI DLIVATIALKY QSNSVC+A  GQVIG+GAGQQSRIHCTRLAG+KA  WWLRQHP VLSL +K+ +KR++ +N ID+  SG   S+   + + + F  P + L +++RK W+ +   VV+SSDAF PFRDN+D A + GV ++A P GS  D  I EAC E+ + L+HT LRLFHH
Sbjct:   45 KAFEHTTSYDESISGFMRRRFAGNGERALPLRYGTNPHQKDDAELYI-----VEDEMPIKVLNGSPGYINILDGLNGWQLVKELSDA--TKMPAAASFKHVSPAGAAVGLPLNETEAACCMVSDLPIDTKKPSLAAAYARARGADRMSSFGDFIALSEKCDELTAKIINREVSDGVVAPDFDPAALSLLAKKKNGNYCVLKINPNYLPSETEERTVFGLRLRQKRNNAVINAETFNNVVGSANELNKQAIDDLIVATIALKYAQSNSVCFAHRGQVIGMGAGQQSRIHCTRLAGDKAMNWWLRQHPTVLSLPWKNAIKRSEKSNAIDVLCSGVLGSEIAIDQWQQYFNEPVEPLAEDDRKQWLSQQTGVVMSSDAFLPFRDNVDCAKQFGVSYVAHPGGSVRDDDIKEACDEHGITLIHTGLRLFHH 464          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Celegans
Match: atic-1 (5-Aminoimidazole-4-carboxamide ribonucleotide formylTransferase/IMP Cyclohydrolase homolog [Source:UniProtKB/TrEMBL;Acc:Q95QQ4])

HSP 1 Score: 430.639 bits (1106), Expect = 1.365e-146
Identity = 214/388 (55.15%), Postives = 275/388 (70.88%), Query Frame = 3
Query:  732 MPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGMEL----TPLASAYARAR-----------------GADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISG--DSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            MP+ ++NGSPG++N+ D LN WQLV EL+ A   ++PAAASFKHVSPAGAA+GLPL++ E   C+V+ + +      LA+AYARAR                 GADRMSSFGDFIALS+ CD  TAKII+REVSDG++APD+   AL +L+ KK G YCVLKIN NY P   E +T+FG  L+QKRN+A+INA+ F N     ++L + AI DLIVATIALKY QSNSVC+A  GQVIG+GAGQQSRIHCTRLAG+KA  WWLRQHP VLSL +K+ +KR++ +N ID+  SG   S+   + + + F  P + L +++RK W+ +   VV+SSDAF PFRDN+D A + GV ++A P GS  D  I EAC E+ + L+HT LRLFHH
Sbjct:    1 MPIKVLNGSPGYINILDGLNGWQLVKELSDA--TKMPAAASFKHVSPAGAAVGLPLNETEAACCMVSDLPIDTKKPSLAAAYARAREQDWMIADRLQRIAPSIGADRMSSFGDFIALSEKCDELTAKIINREVSDGVVAPDFDPAALSLLAKKKNGNYCVLKINPNYLPSETEERTVFGLRLRQKRNNAVINAETFNNVVGSANELNKQAIDDLIVATIALKYAQSNSVCFAHRGQVIGMGAGQQSRIHCTRLAGDKAMNWWLRQHPTVLSLPWKNAIKRSEKSNAIDVLCSGVLGSEIAIDQWQQYFNEPVEPLAEDDRKQWLSQQTGVVMSSDAFLPFRDNVDCAKQFGVSYVAHPGGSVRDDDIKEACDEHGITLIHTGLRLFHH 386          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Fly
Match: CG11089 (gene:FBgn0039241 transcript:FBtr0084710)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 352/597 (58.96%), Postives = 444/597 (74.37%), Query Frame = 3
Query:   51 SMSKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQED--FENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            S SK+ALLSVSDKT L  L  SL +L +  +ASGGTA  +  +   V  +S+ TG+PE+L GRVKTLHPA+HAGIL+R ++ D  D+ K  +  I LV+CNLYPF   ++  D+ L+DA+E+IDIGGVTL+RAAAKN  RV V+C+  DY+ V++E+K+  N  ++ETR+ LALKAF HTA YD+ IS YF+ ++    + + LRYGMNPHQ PA L   L       +PLT++N SPGF+NLCDALN WQLV EL +A   ++PAA SFKHVSPAGAA+G+PL+  + K C+V  +  +LTPLA+AYARARGADRMSSFGDF+ALSD CDV TA+IISREVSDGIIA  Y  EAL+IL  KK G YC+L+++ NY P   E KTIFG  L+QKRNDA+I+A  F N  +    LPE A+RDLIVATIALKYTQSNSVCYA++GQV+GIGAGQQSRIHCTRLAG KAD WWLRQHP V  +KFK+ +KRA+I+N ID Y++G   +D     F   F+  P  LT E++ +W+++L  V L SDAFFPFRDNIDRA  SGV +IA+P+GSTNDA +I AC E+ +I+ HT LRLFHH
Sbjct:    2 SSSKIALLSVSDKTGLLDLGKSLVALGFDLVASGGTATSLRGAGLKVRDVSEITGAPEMLGGRVKTLHPAVHAGILSRTTDSDLADMRKQGFDLIQLVVCNLYPFASTVAKPDVTLADAVENIDIGGVTLLRAAAKNHQRVTVVCEAVDYDRVLSELKASGNT-TVETRQALALKAFTHTATYDDAISDYFRKQYGSGVSQLPLRYGMNPHQKPAQLYTQLAK-----LPLTVLNASPGFINLCDALNGWQLVRELKKAL--QLPAATSFKHVSPAGAAVGVPLNPAQAKLCMVDDLYEQLTPLATAYARARGADRMSSFGDFVALSDVCDVVTARIISREVSDGIIAAGYEPEALEILKKKKNGGYCILQMDPNYEPSAVERKTIFGLTLEQKRNDAVIDASLFSNVVSKRGPLPEVAVRDLIVATIALKYTQSNSVCYARDGQVVGIGAGQQSRIHCTRLAGEKADNWWLRQHPSVAGMKFKAGVKRAEISNAIDNYVNGTVGKDMPLSQFEGMFDKAPAQLTSEQKVEWLKQLSGVALGSDAFFPFRDNIDRASLSGVSYIASPAGSTNDAGVIAACDEHGIIMAHTNLRLFHH 590          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Fly
Match: CG11089 (gene:FBgn0039241 transcript:FBtr0303476)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 352/597 (58.96%), Postives = 444/597 (74.37%), Query Frame = 3
Query:   51 SMSKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQED--FENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            S SK+ALLSVSDKT L  L  SL +L +  +ASGGTA  +  +   V  +S+ TG+PE+L GRVKTLHPA+HAGIL+R ++ D  D+ K  +  I LV+CNLYPF   ++  D+ L+DA+E+IDIGGVTL+RAAAKN  RV V+C+  DY+ V++E+K+  N  ++ETR+ LALKAF HTA YD+ IS YF+ ++    + + LRYGMNPHQ PA L   L       +PLT++N SPGF+NLCDALN WQLV EL +A   ++PAA SFKHVSPAGAA+G+PL+  + K C+V  +  +LTPLA+AYARARGADRMSSFGDF+ALSD CDV TA+IISREVSDGIIA  Y  EAL+IL  KK G YC+L+++ NY P   E KTIFG  L+QKRNDA+I+A  F N  +    LPE A+RDLIVATIALKYTQSNSVCYA++GQV+GIGAGQQSRIHCTRLAG KAD WWLRQHP V  +KFK+ +KRA+I+N ID Y++G   +D     F   F+  P  LT E++ +W+++L  V L SDAFFPFRDNIDRA  SGV +IA+P+GSTNDA +I AC E+ +I+ HT LRLFHH
Sbjct:    2 SSSKIALLSVSDKTGLLDLGKSLVALGFDLVASGGTATSLRGAGLKVRDVSEITGAPEMLGGRVKTLHPAVHAGILSRTTDSDLADMRKQGFDLIQLVVCNLYPFASTVAKPDVTLADAVENIDIGGVTLLRAAAKNHQRVTVVCEAVDYDRVLSELKASGNT-TVETRQALALKAFTHTATYDDAISDYFRKQYGSGVSQLPLRYGMNPHQKPAQLYTQLAK-----LPLTVLNASPGFINLCDALNGWQLVRELKKAL--QLPAATSFKHVSPAGAAVGVPLNPAQAKLCMVDDLYEQLTPLATAYARARGADRMSSFGDFVALSDVCDVVTARIISREVSDGIIAAGYEPEALEILKKKKNGGYCILQMDPNYEPSAVERKTIFGLTLEQKRNDAVIDASLFSNVVSKRGPLPEVAVRDLIVATIALKYTQSNSVCYARDGQVVGIGAGQQSRIHCTRLAGEKADNWWLRQHPSVAGMKFKAGVKRAEISNAIDNYVNGTVGKDMPLSQFEGMFDKAPAQLTSEQKVEWLKQLSGVALGSDAFFPFRDNIDRASLSGVSYIASPAGSTNDAGVIAACDEHGIIMAHTNLRLFHH 590          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Zebrafish
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:ZFIN;Acc:ZDB-GENE-011212-4])

HSP 1 Score: 724.931 bits (1870), Expect = 0.000e+0
Identity = 360/596 (60.40%), Postives = 449/596 (75.34%), Query Frame = 3
Query:   57 SKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMK-SITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQE--DFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            S++ALLSVSDKT L      L S+    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+H GILAR +  D  D++K+ +  + + +CNLYPF K +SS  + + DA+E IDIGGVTL+RAAAKN ARV V+CDP DY  V  EM+ S  ++ ++ETR+ LALKAF HTA YDE IS YF+ ++ R  + + LRYGMNPHQ PA L       P  A+PLT++NGSPGF+NLCDALNAWQLV EL +A    +PAA SFKHVSPAGAA+G+PLS+DE K C+V  M  +LTPLA+AYARARG+DRMSSFGDFIALSD CDV TAKIISREVSDGI+AP Y E+AL+ILS KK G YCVLK++  Y P  +E++ +FG  LKQKRN A+I+ + F N  +   +L ESA+RDLIVA+IA+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KAD WWLR HP VLS++F+  +KRA++ N IDLY+SG   E  D E +   FE  P+ L++ E+K+WI  L  V LSSDAFFPFRDN+DRA +SGV +IAAPSGST D  +++AC E  + LVHT +RLFHH
Sbjct:    3 SEIALLSVSDKTGLVEFARRLVSVGLSLVASGGTAKTLRDAGLAVRDVSEITGFPEMLGGRVKTLHPAVHGGILARQTPSDNADMEKLGFSLVRVAVCNLYPFVKTVSSPGVTVEDAVEQIDIGGVTLLRAAAKNHARVTVVCDPSDYNVVAKEMETSEIHDTTMETRKTLALKAFTHTAQYDEAISDYFRREYSRGVSQLPLRYGMNPHQAPAQL---YTTRP--ALPLTVLNGSPGFINLCDALNAWQLVRELRKALG--LPAATSFKHVSPAGAAVGVPLSEDEAKVCMVNDMLQDLTPLATAYARARGSDRMSSFGDFIALSDVCDVPTAKIISREVSDGIVAPGYEEDALRILSKKKNGNYCVLKMDPEYEPDEEEVRVLFGLHLKQKRNGAVIDKELFSNIVS-KGKLSESALRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKADNWWLRHHPGVLSMRFRGGVKRAEMANAIDLYVSGTVGEGPDKEVWKGLFEEVPEPLSEVEKKNWISSLQAVALSSDAFFPFRDNVDRAKQSGVEYIAAPSGSTADEVVVKACNELGITLVHTNIRLFHH 590          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Xenopus
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:NCBI gene;Acc:448061])

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 361/596 (60.57%), Postives = 461/596 (77.35%), Query Frame = 3
Query:   54 MSKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEM-KSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGD-SQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            M+++AL SVSDKT L      L++L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILAR+S +D+ DL+K+ + Y+ +V+CNLYPF K +S+A + + +A+E IDIGGVTL+RAAAKN ARV VLCDP DY+ +  EM KS   + + E R +LALKAF HTA YD+ IS YF+ ++   T+ + LRYG+NPHQ+PA +       P   +PLT++NGSPGF+NLCDALNAWQLV EL  A    +PAA SFKHVSPAGAA+G+PL ++E + C+V  +   LTPLA+AYARARGADRMSSFGDFIA+SD CDVATAKIISREVSDGI+AP Y +EALKILS KK G YCVL+++ +Y P + EI++IFG +L+QKRNDA+I+ + + N    + ++PESA+RDLIVATIALKYTQSNSVCYAK+GQVIG+GAGQQSRIHCTRLAG+KAD WWLR HP+VL +KFK+ +KRADI+N ID Y+SG   +ED   +   ++ PP+ LT  E+KDWI KL  V LSSDAFFPF+DN++RA KSGV+FIAAPSGS+ D  +I+AC E  ++L HT LRLFHH
Sbjct:    1 MAEIALFSVSDKTGLVEFAQQLSTLGLSLVASGGTAKCLRDAGLSVRDVSEITGFPEMLGGRVKTLHPAVHAGILARSSPEDQADLNKLGFSYVRVVVCNLYPFVKTVSAAGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVLCDPSDYKSIAEEMGKSDKKDTTPERRCQLALKAFTHTAQYDDAISDYFRKQYSKGTSQLPLRYGINPHQVPAQI---YTRGPQ--LPLTVLNGSPGFINLCDALNAWQLVRELKNALG--LPAATSFKHVSPAGAAVGVPLMEEEAQVCMVQDLFPTLTPLATAYARARGADRMSSFGDFIAVSDVCDVATAKIISREVSDGIVAPGYEDEALKILSKKKNGSYCVLQMDPSYEPSDIEIRSIFGLQLEQKRNDAVIDRNLYNNVVTNNKEIPESAVRDLIVATIALKYTQSNSVCYAKDGQVIGMGAGQQSRIHCTRLAGDKADNWWLRHHPRVLGMKFKAGVKRADISNAIDQYVSGTLGEEDLPQWQALYDQPPEQLTLAEKKDWISKLSGVALSSDAFFPFKDNLERAKKSGVQFIAAPSGSSADKIVIDACNELGIVLAHTNLRLFHH 589          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Xenopus
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:NCBI gene;Acc:448061])

HSP 1 Score: 747.658 bits (1929), Expect = 0.000e+0
Identity = 360/592 (60.81%), Postives = 457/592 (77.20%), Query Frame = 3
Query:   66 ALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEM-KSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGD-SQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            AL SVSDKT L      L++L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILAR+S +D+ DL+K+ + Y+ +V+CNLYPF K +S+A + + +A+E IDIGGVTL+RAAAKN ARV VLCDP DY+ +  EM KS   + + E R +LALKAF HTA YD+ IS YF+ ++   T+ + LRYG+NPHQ+PA +       P   +PLT++NGSPGF+NLCDALNAWQLV EL  A    +PAA SFKHVSPAGAA+G+PL ++E + C+V  +   LTPLA+AYARARGADRMSSFGDFIA+SD CDVATAKIISREVSDGI+AP Y +EALKILS KK G YCVL+++ +Y P + EI++IFG +L+QKRNDA+I+ + + N    + ++PESA+RDLIVATIALKYTQSNSVCYAK+GQVIG+GAGQQSRIHCTRLAG+KAD WWLR HP+VL +KFK+ +KRADI+N ID Y+SG   +ED   +   ++ PP+ LT  E+KDWI KL  V LSSDAFFPF+DN++RA KSGV+FIAAPSGS+ D  +I+AC E  ++L HT LRLFHH
Sbjct:    4 ALFSVSDKTGLVEFAQQLSTLGLSLVASGGTAKCLRDAGLSVRDVSEITGFPEMLGGRVKTLHPAVHAGILARSSPEDQADLNKLGFSYVRVVVCNLYPFVKTVSAAGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVLCDPSDYKSIAEEMGKSDKKDTTPERRCQLALKAFTHTAQYDDAISDYFRKQYSKGTSQLPLRYGINPHQVPAQI---YTRGPQ--LPLTVLNGSPGFINLCDALNAWQLVRELKNALG--LPAATSFKHVSPAGAAVGVPLMEEEAQVCMVQDLFPTLTPLATAYARARGADRMSSFGDFIAVSDVCDVATAKIISREVSDGIVAPGYEDEALKILSKKKNGSYCVLQMDPSYEPSDIEIRSIFGLQLEQKRNDAVIDRNLYNNVVTNNKEIPESAVRDLIVATIALKYTQSNSVCYAKDGQVIGMGAGQQSRIHCTRLAGDKADNWWLRHHPRVLGMKFKAGVKRADISNAIDQYVSGTLGEEDLPQWQALYDQPPEQLTLAEKKDWISKLSGVALSSDAFFPFKDNLERAKKSGVQFIAAPSGSSADKIVIDACNELGIVLAHTNLRLFHH 588          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Xenopus
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:NCBI gene;Acc:448061])

HSP 1 Score: 746.117 bits (1925), Expect = 0.000e+0
Identity = 359/591 (60.74%), Postives = 456/591 (77.16%), Query Frame = 3
Query:   69 LLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEM-KSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGD-SQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            L SVSDKT L      L++L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILAR+S +D+ DL+K+ + Y+ +V+CNLYPF K +S+A + + +A+E IDIGGVTL+RAAAKN ARV VLCDP DY+ +  EM KS   + + E R +LALKAF HTA YD+ IS YF+ ++   T+ + LRYG+NPHQ+PA +       P   +PLT++NGSPGF+NLCDALNAWQLV EL  A    +PAA SFKHVSPAGAA+G+PL ++E + C+V  +   LTPLA+AYARARGADRMSSFGDFIA+SD CDVATAKIISREVSDGI+AP Y +EALKILS KK G YCVL+++ +Y P + EI++IFG +L+QKRNDA+I+ + + N    + ++PESA+RDLIVATIALKYTQSNSVCYAK+GQVIG+GAGQQSRIHCTRLAG+KAD WWLR HP+VL +KFK+ +KRADI+N ID Y+SG   +ED   +   ++ PP+ LT  E+KDWI KL  V LSSDAFFPF+DN++RA KSGV+FIAAPSGS+ D  +I+AC E  ++L HT LRLFHH
Sbjct:   11 LFSVSDKTGLVEFAQQLSTLGLSLVASGGTAKCLRDAGLSVRDVSEITGFPEMLGGRVKTLHPAVHAGILARSSPEDQADLNKLGFSYVRVVVCNLYPFVKTVSAAGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVLCDPSDYKSIAEEMGKSDKKDTTPERRCQLALKAFTHTAQYDDAISDYFRKQYSKGTSQLPLRYGINPHQVPAQI---YTRGPQ--LPLTVLNGSPGFINLCDALNAWQLVRELKNALG--LPAATSFKHVSPAGAAVGVPLMEEEAQVCMVQDLFPTLTPLATAYARARGADRMSSFGDFIAVSDVCDVATAKIISREVSDGIVAPGYEDEALKILSKKKNGSYCVLQMDPSYEPSDIEIRSIFGLQLEQKRNDAVIDRNLYNNVVTNNKEIPESAVRDLIVATIALKYTQSNSVCYAKDGQVIGMGAGQQSRIHCTRLAGDKADNWWLRHHPRVLGMKFKAGVKRADISNAIDQYVSGTLGEEDLPQWQALYDQPPEQLTLAEKKDWISKLSGVALSSDAFFPFKDNLERAKKSGVQFIAAPSGSSADKIVIDACNELGIVLAHTNLRLFHH 594          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Xenopus
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:NCBI gene;Acc:448061])

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 359/592 (60.64%), Postives = 457/592 (77.20%), Query Frame = 3
Query:   66 ALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEM-KSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGD-SQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            +L SVSDKT L      L++L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILAR+S +D+ DL+K+ + Y+ +V+CNLYPF K +S+A + + +A+E IDIGGVTL+RAAAKN ARV VLCDP DY+ +  EM KS   + + E R +LALKAF HTA YD+ IS YF+ ++   T+ + LRYG+NPHQ+PA +       P   +PLT++NGSPGF+NLCDALNAWQLV EL  A    +PAA SFKHVSPAGAA+G+PL ++E + C+V  +   LTPLA+AYARARGADRMSSFGDFIA+SD CDVATAKIISREVSDGI+AP Y +EALKILS KK G YCVL+++ +Y P + EI++IFG +L+QKRNDA+I+ + + N    + ++PESA+RDLIVATIALKYTQSNSVCYAK+GQVIG+GAGQQSRIHCTRLAG+KAD WWLR HP+VL +KFK+ +KRADI+N ID Y+SG   +ED   +   ++ PP+ LT  E+KDWI KL  V LSSDAFFPF+DN++RA KSGV+FIAAPSGS+ D  +I+AC E  ++L HT LRLFHH
Sbjct:   23 SLFSVSDKTGLVEFAQQLSTLGLSLVASGGTAKCLRDAGLSVRDVSEITGFPEMLGGRVKTLHPAVHAGILARSSPEDQADLNKLGFSYVRVVVCNLYPFVKTVSAAGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVLCDPSDYKSIAEEMGKSDKKDTTPERRCQLALKAFTHTAQYDDAISDYFRKQYSKGTSQLPLRYGINPHQVPAQI---YTRGPQ--LPLTVLNGSPGFINLCDALNAWQLVRELKNALG--LPAATSFKHVSPAGAAVGVPLMEEEAQVCMVQDLFPTLTPLATAYARARGADRMSSFGDFIAVSDVCDVATAKIISREVSDGIVAPGYEDEALKILSKKKNGSYCVLQMDPSYEPSDIEIRSIFGLQLEQKRNDAVIDRNLYNNVVTNNKEIPESAVRDLIVATIALKYTQSNSVCYAKDGQVIGMGAGQQSRIHCTRLAGDKADNWWLRHHPRVLGMKFKAGVKRADISNAIDQYVSGTLGEEDLPQWQALYDQPPEQLTLAEKKDWISKLSGVALSSDAFFPFKDNLERAKKSGVQFIAAPSGSSADKIVIDACNELGIVLAHTNLRLFHH 607          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Xenopus
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:NCBI gene;Acc:448061])

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 357/588 (60.71%), Postives = 454/588 (77.21%), Query Frame = 3
Query:   78 VSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEM-KSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGD-SQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            VSDKT L      L++L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILAR+S +D+ DL+K+ + Y+ +V+CNLYPF K +S+A + + +A+E IDIGGVTL+RAAAKN ARV VLCDP DY+ +  EM KS   + + E R +LALKAF HTA YD+ IS YF+ ++   T+ + LRYG+NPHQ+PA +       P   +PLT++NGSPGF+NLCDALNAWQLV EL  A    +PAA SFKHVSPAGAA+G+PL ++E + C+V  +   LTPLA+AYARARGADRMSSFGDFIA+SD CDVATAKIISREVSDGI+AP Y +EALKILS KK G YCVL+++ +Y P + EI++IFG +L+QKRNDA+I+ + + N    + ++PESA+RDLIVATIALKYTQSNSVCYAK+GQVIG+GAGQQSRIHCTRLAG+KAD WWLR HP+VL +KFK+ +KRADI+N ID Y+SG   +ED   +   ++ PP+ LT  E+KDWI KL  V LSSDAFFPF+DN++RA KSGV+FIAAPSGS+ D  +I+AC E  ++L HT LRLFHH
Sbjct:    7 VSDKTGLVEFAQQLSTLGLSLVASGGTAKCLRDAGLSVRDVSEITGFPEMLGGRVKTLHPAVHAGILARSSPEDQADLNKLGFSYVRVVVCNLYPFVKTVSAAGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVLCDPSDYKSIAEEMGKSDKKDTTPERRCQLALKAFTHTAQYDDAISDYFRKQYSKGTSQLPLRYGINPHQVPAQI---YTRGPQ--LPLTVLNGSPGFINLCDALNAWQLVRELKNALG--LPAATSFKHVSPAGAAVGVPLMEEEAQVCMVQDLFPTLTPLATAYARARGADRMSSFGDFIAVSDVCDVATAKIISREVSDGIVAPGYEDEALKILSKKKNGSYCVLQMDPSYEPSDIEIRSIFGLQLEQKRNDAVIDRNLYNNVVTNNKEIPESAVRDLIVATIALKYTQSNSVCYAKDGQVIGMGAGQQSRIHCTRLAGDKADNWWLRHHPRVLGMKFKAGVKRADISNAIDQYVSGTLGEEDLPQWQALYDQPPEQLTLAEKKDWISKLSGVALSSDAFFPFKDNLERAKKSGVQFIAAPSGSSADKIVIDACNELGIVLAHTNLRLFHH 587          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Mouse
Match: Atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:MGI Symbol;Acc:MGI:1351352])

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 362/596 (60.74%), Postives = 453/596 (76.01%), Query Frame = 3
Query:   57 SKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMK-SITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISG--DSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            S+LAL SVSDKT L     SLASL    +ASGGTA+ I D+   V  +S+ TG PE+L GRVKTLHPA+HAGILARN  +D  D+ ++++  + +V+CNLYPF K ++S D+ +  A+E IDIGGVTL+RAAAKN ARV V+C+P DY  V  EM  S + + S+ETR  LALKAF HTA YDE IS YF+ ++ +  + + LRYGMNPHQ PA L   L+      +P+T++NG+PGF+NLCDALNAWQLV EL  A D  IPAAASFKHVSPAGAA+G+PLS+DE + C+V  +   LTPLA AYARARGADRMSSFGDF+ALSD CDV TAKIISREVSDGI+AP Y EEALKILS KK G YCVL+++++Y+P  +E++T+FG  L QKRN+ +++   F N    +  LPESA+RDLIVAT+A+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G     ED   +   FE  P+ LT+ E+K+W+ KL  V +SSDAFFPFRDN+DRA +SGV +I APSGST D  +IEAC E  ++L HT LRLFHH
Sbjct:    4 SQLALFSVSDKTGLVEFARSLASLGLSLVASGGTAKAIRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLVRVVVCNLYPFVKTVASPDVTVEAAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYAGVAAEMHGSDSKDTSLETRRHLALKAFTHTAQYDEAISDYFRKQYSKGISQMPLRYGMNPHQTPAQL-YTLKPK----LPITVLNGAPGFINLCDALNAWQLVTELRGAVD--IPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLAVAYARARGADRMSSFGDFVALSDICDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIVATVAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEISNAIDQYVTGTIGEGEDLVKWEALFEEVPELLTEAEKKEWVDKLSGVSVSSDAFFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLRLFHH 592          
BLAST of Bifunctional purine biosynthesis protein PURH vs. UniProt/SwissProt
Match: sp|O35567|PUR9_RAT (Bifunctional purine biosynthesis protein PURH OS=Rattus norvegicus OX=10116 GN=Atic PE=1 SV=2)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 362/596 (60.74%), Postives = 453/596 (76.01%), Query Frame = 3
Query:   57 SKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITN-ELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISG--DSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            S+LAL SVSDKT L     +LASL    +ASGGTA+ I D+   V  +S+ TG PE+L GRVKTLHPA+HAGILARN  +D  D+ ++++  I +V+CNLYPF K ++S D+ +  A+E IDIGGVTL+RAAAKN ARV V+C+P DY  V  EM+   N + S+ETR  LALKAF HTA YDE IS YF+ ++ +  + + LRYGMNPHQ PA L   L+      +P+T++NG+PGF+NLCDALNAWQLV EL  A D  IPAAASFKHVSPAGAA+G+PLS+DE + C+V  +   LTPLA AYARARGADRMSSFGDF+ALSD CDV TAKIISREVSDGI+AP Y EEALKILS KK G YCVL+++++Y+P  +E++T+FG  L QKRN+ +++   F N    +  LPESA+RDLIVATIA+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+++N ID Y++G     ED   +   FE  P+ LT+ E+K+W+ KL  V +SSDAFFPFRDN+DRA +SGV +I APSGST D  +IEAC E  ++L HT LRLFHH
Sbjct:    4 SQLALFSVSDKTGLVEFARNLASLGLSLVASGGTAKAIRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLIRVVVCNLYPFVKTVASPDVTVEAAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYGAVAAEMQGSGNKDTSLETRRHLALKAFTHTAQYDEAISDYFRRQYSKGISQMPLRYGMNPHQTPAQL-YTLKPK----LPITVLNGAPGFINLCDALNAWQLVTELRGAVD--IPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLAIAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNGSYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEGEDLVKWKALFEEVPELLTEAEKKEWVDKLSGVSVSSDAFFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLRLFHH 592          
BLAST of Bifunctional purine biosynthesis protein PURH vs. UniProt/SwissProt
Match: sp|Q9CWJ9|PUR9_MOUSE (Bifunctional purine biosynthesis protein PURH OS=Mus musculus OX=10090 GN=Atic PE=1 SV=2)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 362/596 (60.74%), Postives = 453/596 (76.01%), Query Frame = 3
Query:   57 SKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMK-SITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISG--DSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            S+LAL SVSDKT L     SLASL    +ASGGTA+ I D+   V  +S+ TG PE+L GRVKTLHPA+HAGILARN  +D  D+ ++++  + +V+CNLYPF K ++S D+ +  A+E IDIGGVTL+RAAAKN ARV V+C+P DY  V  EM  S + + S+ETR  LALKAF HTA YDE IS YF+ ++ +  + + LRYGMNPHQ PA L   L+      +P+T++NG+PGF+NLCDALNAWQLV EL  A D  IPAAASFKHVSPAGAA+G+PLS+DE + C+V  +   LTPLA AYARARGADRMSSFGDF+ALSD CDV TAKIISREVSDGI+AP Y EEALKILS KK G YCVL+++++Y+P  +E++T+FG  L QKRN+ +++   F N    +  LPESA+RDLIVAT+A+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G     ED   +   FE  P+ LT+ E+K+W+ KL  V +SSDAFFPFRDN+DRA +SGV +I APSGST D  +IEAC E  ++L HT LRLFHH
Sbjct:    4 SQLALFSVSDKTGLVEFARSLASLGLSLVASGGTAKAIRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLVRVVVCNLYPFVKTVASPDVTVEAAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYAGVAAEMHGSDSKDTSLETRRHLALKAFTHTAQYDEAISDYFRKQYSKGISQMPLRYGMNPHQTPAQL-YTLKPK----LPITVLNGAPGFINLCDALNAWQLVTELRGAVD--IPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLAVAYARARGADRMSSFGDFVALSDICDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIVATVAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEISNAIDQYVTGTIGEGEDLVKWEALFEEVPELLTEAEKKEWVDKLSGVSVSSDAFFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLRLFHH 592          
BLAST of Bifunctional purine biosynthesis protein PURH vs. UniProt/SwissProt
Match: sp|Q5R5C2|PUR9_PONAB (Bifunctional purine biosynthesis protein PURH OS=Pongo abelii OX=9601 GN=ATIC PE=2 SV=1)

HSP 1 Score: 743.806 bits (1919), Expect = 0.000e+0
Identity = 362/595 (60.84%), Postives = 454/595 (76.30%), Query Frame = 3
Query:   63 LALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSI-TNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            LAL SVSDKT L     +L +L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILARN  +D  D+ ++++  I +V CNLYPF K ++S  + + +A+E IDIGGVTL+RAAAKN ARV V+C+P DY  V  EMKS    + S+ETR +LALKAF HTA YDE IS YF+ ++ +  + + LRYGMNPHQ PA L   L+      +P+T++NG+PGF+NLCDALNAWQLV EL +A    IPAAASFKHVSPAGAA+G+PLS+DE K C+V  +   LTP+++AYARARGADRMSSFGDF+ALSD CDV TAKIISREVSDGIIAP Y EEALKILS KK G YCVL+++++Y+P  +E++T+FG  L QKRN+ +++   F N    +  LPESA+RDLIVATIA+KYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G   ED E+ +K    FE  P+ LT+ E+K+W+ KL  V +SSDAFFPFRDN+DRA +SGV +IAAPSGS  D  +IEAC E  +IL HT LRLFHH
Sbjct:    6 LALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMKSSEIKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGISQMPLRYGMNPHQTPAQL-YTLKPK----LPITVLNGAPGFINLCDALNAWQLVKELKEALG--IPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALKILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGED-EDLIKWEALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH 592          
BLAST of Bifunctional purine biosynthesis protein PURH vs. UniProt/SwissProt
Match: sp|P31335|PUR9_CHICK (Bifunctional purine biosynthesis protein PURH OS=Gallus gallus OX=9031 GN=ATIC PE=1 SV=1)

HSP 1 Score: 742.651 bits (1916), Expect = 0.000e+0
Identity = 367/596 (61.58%), Postives = 449/596 (75.34%), Query Frame = 3
Query:   60 KLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMK-SITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGME--LTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            +LALLSVS+K  L     SL +L    IASGGTA  + D+   V  +SD TG PE+L GRVKTLHPA+HAGILARN  +D  D++K ++  + +V+CNLYPF K +SS  + + +A+E IDIGGV L+RAAAKN ARV V+CDP DY  V  EM  S   + S+ETR  LALKAF HTA YD  IS YF+ ++ +  + + LRYGMNPHQ PA L       P   +PLT+VNGSPGF+NLCDALNAWQLV EL QA    IPAAASFKHVSPAGAA+G+PLS++E + C+V  +   LTPLASAYAR+RGADRMSSFGDFIALSD CDV TAKIISREVSDG++AP Y EEALKILS KK G YCVL+++ NY P ++EI+T++G +L QKRN+A+I+   FKN    +  LPESA+RDLIVA+IA+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+++N ID Y++G   ED E+ +K    FE  P  LT+ E+K WI KL  V LSSDAFFPFRDN+DRA + GV+FI APSGS  D  +IEAC E  + L+HT LRLFHH
Sbjct:    6 QLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQL---YTTRPK--LPLTVVNGSPGFINLCDALNAWQLVKELKQALG--IPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGED-EDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH 593          
BLAST of Bifunctional purine biosynthesis protein PURH vs. UniProt/SwissProt
Match: sp|P31939|PUR9_HUMAN (Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 360/596 (60.40%), Postives = 455/596 (76.34%), Query Frame = 3
Query:   60 KLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSI-TNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            +LAL SVSDKT L     +L +L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILARN  +D  D+ ++++  I +V CNLYPF K ++S  + + +A+E IDIGGVTL+RAAAKN ARV V+C+P DY  V  EM+S  + + S+ETR +LALKAF HTA YDE IS YF+ ++ +  + + LRYGMNPHQ PA L   L+      +P+T++NG+PGF+NLCDALNAWQLV EL +A    IPAAASFKHVSPAGAA+G+PLS+DE K C+V  +   LTP+++AYARARGADRMSSFGDF+ALSD CDV TAKIISREVSDGIIAP Y EEAL ILS KK G YCVL+++++Y+P  +E++T+FG  L QKRN+ +++   F N    +  LPESA+RDLIVATIA+KYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G   ED E+ +K    FE  P+ LT+ E+K+W+ KL  V +SSDAFFPFRDN+DRA +SGV +IAAPSGS  D  +IEAC E  +IL HT LRLFHH
Sbjct:    5 QLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQL-YTLQPK----LPITVLNGAPGFINLCDALNAWQLVKELKEALG--IPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGED-EDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH 592          
BLAST of Bifunctional purine biosynthesis protein PURH vs. TrEMBL
Match: A0A1S3A1S3 (bifunctional purine biosynthesis protein PURH OS=Erinaceus europaeus OX=9365 GN=ATIC PE=3 SV=1)

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 368/597 (61.64%), Postives = 460/597 (77.05%), Query Frame = 3
Query:   57 SKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSI-TNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            ++LAL SVSDKT L     +L S+    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILARN  +D  D+ ++++  I +V+CNLYPF K ++S D+ + +A+E IDIGGVTL+RAAAKN ARV V+C+P DY  V  EM+S  + + S+ETR +LALKAF HTA YDE IS YF+ ++ +  + + LRYGMNPHQ PA L      NP   +P+T+VNG+PGF+NLCDALNAWQLV EL +A    IPAAASFKHVSPAGAA+G+PLS+DE K C+V  +   LTP+++AYARARGADRMSSFGDFIALSD CDV TAKIISREVSDGIIAP Y EEAL+ILS KK G YCVL+++++Y+P  +E++T+FG  L QKRN+ II+   F N    +  LPESA+RDLIVATIA+KYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HPKVLS+KFK+ +KRA+I+N ID Y++G   ED E+ +K    FE  P++LT+ +RK+WI KL  V +SSDAFFPFRDN+DRA +SGV +IAAPSGS  D  +IEAC E  +IL HT LRLFHH
Sbjct:    4 NQLALFSVSDKTGLVDFARNLTSVGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVVCNLYPFVKTVASPDVTVGEAVEQIDIGGVTLLRAAAKNHARVTVVCEPADYAAVSAEMQSSDSKDTSLETRRQLALKAFTHTAQYDEAISDYFRRQYSKGISQMPLRYGMNPHQTPAQL---YTLNPK--LPITVVNGAPGFINLCDALNAWQLVRELREALG--IPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISTAYARARGADRMSSFGDFIALSDICDVPTAKIISREVSDGIIAPGYEEEALQILSKKKNGSYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGIIDKSLFSNIVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPKVLSMKFKTGVKRAEISNAIDQYVTGTIGED-EDLVKWKALFEEVPESLTEAQRKEWIEKLSEVSVSSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH 592          
BLAST of Bifunctional purine biosynthesis protein PURH vs. TrEMBL
Match: Q6GLB6 (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase OS=Xenopus tropicalis OX=8364 GN=atic PE=2 SV=1)

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 361/596 (60.57%), Postives = 461/596 (77.35%), Query Frame = 3
Query:   54 MSKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEM-KSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGD-SQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            M+++AL SVSDKT L      L++L    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+HAGILAR+S +D+ DL+K+ + Y+ +V+CNLYPF K +S+A + + +A+E IDIGGVTL+RAAAKN ARV VLCDP DY+ +  EM KS   + + E R +LALKAF HTA YD+ IS YF+ ++   T+ + LRYG+NPHQ+PA +       P   +PLT++NGSPGF+NLCDALNAWQLV EL  A    +PAA SFKHVSPAGAA+G+PL ++E + C+V  +   LTPLA+AYARARGADRMSSFGDFIA+SD CDVATAKIISREVSDGI+AP Y +EALKILS KK G YCVL+++ +Y P + EI++IFG +L+QKRNDA+I+ + + N    + ++PESA+RDLIVATIALKYTQSNSVCYAK+GQVIG+GAGQQSRIHCTRLAG+KAD WWLR HP+VL +KFK+ +KRADI+N ID Y+SG   +ED   +   ++ PP+ LT  E+KDWI KL  V LSSDAFFPF+DN++RA KSGV+FIAAPSGS+ D  +I+AC E  ++L HT LRLFHH
Sbjct:    1 MAEIALFSVSDKTGLVEFAQQLSTLGLSLVASGGTAKCLRDAGLSVRDVSEITGFPEMLGGRVKTLHPAVHAGILARSSPEDQADLNKLGFSYVRVVVCNLYPFVKTVSAAGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVLCDPSDYKSIAEEMGKSDKKDTTPERRCQLALKAFTHTAQYDDAISDYFRKQYSKGTSQLPLRYGINPHQVPAQI---YTRGPQ--LPLTVLNGSPGFINLCDALNAWQLVRELKNALG--LPAATSFKHVSPAGAAVGVPLMEEEAQVCMVQDLFPTLTPLATAYARARGADRMSSFGDFIAVSDVCDVATAKIISREVSDGIVAPGYEDEALKILSKKKNGSYCVLQMDPSYEPSDIEIRSIFGLQLEQKRNDAVIDRNLYNNVVTNNKEIPESAVRDLIVATIALKYTQSNSVCYAKDGQVIGMGAGQQSRIHCTRLAGDKADNWWLRHHPRVLGMKFKAGVKRADISNAIDQYVSGTLGEEDLPQWQALYDQPPEQLTLAEKKDWISKLSGVALSSDAFFPFKDNLERAKKSGVQFIAAPSGSSADKIVIDACNELGIVLAHTNLRLFHH 589          
BLAST of Bifunctional purine biosynthesis protein PURH vs. TrEMBL
Match: A0A091IP64 (Bifunctional purine biosynthesis protein PURH (Fragment) OS=Egretta garzetta OX=188379 GN=Z169_05016 PE=3 SV=1)

HSP 1 Score: 751.51 bits (1939), Expect = 0.000e+0
Identity = 372/595 (62.52%), Postives = 455/595 (76.47%), Query Frame = 3
Query:   63 LALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEM-KSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGME--LTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            LALLSVSDKT+L     SL +L    IASGGTA+ + D+   V  +SD TG PE+L GRVKTLHPA+HAGILARN  +D  D++K ++  + +V+CNLYPF K +SS D+ + +A+E IDIGGV L+RAAAKN ARV V+CDP DY  V  EM  S   + S+ETR  LALKAF HTA YD  IS YF+ ++ +  + + LRYGMNPHQ PA L   +R+     +PLT+VNGSPGF+NLCDALNAWQLV EL QA    +PAAASFKHVSPAGAA+G+PLS++E + C+V      LTPLASAYAR+RGADRMSSFGDFIALSD CDVATAKIISREVSDG++AP Y EEALKIL+ KK G YCVL+++ +Y P ++EI+T++G  L QKRN+A+I+   FKN    +  LPESA+RDLIVA+IA+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G   ED E+ +K    FE  P  LT+ E+K WI KL  V LSSDAFFPFRDN+DRA +SGVRFIAAPSGS  D  +IEAC E  + L+HT LRLFHH
Sbjct:    1 LALLSVSDKTSLVEFAKSLNALGLGLIASGGTAKSLRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPDVTVQEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSAVAKEMATSKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQL-YTMRSK----LPLTVVNGSPGFINLCDALNAWQLVKELKQALG--MPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDFHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVATAKIISREVSDGVVAPGYEEEALKILAKKKNGGYCVLQMDPHYEPDDNEIRTLYGLYLMQKRNNAVIDRSLFKNIVTKNKNLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANNWWLRHHPRVLSMKFKAGVKRAEISNAIDQYVTGTIGED-EDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRSGVRFIAAPSGSAADDVVIEACNELGITLIHTNLRLFHH 587          
BLAST of Bifunctional purine biosynthesis protein PURH vs. TrEMBL
Match: A0A087RDE8 (Bifunctional purine biosynthesis protein PURH (Fragment) OS=Aptenodytes forsteri OX=9233 GN=AS27_07226 PE=3 SV=1)

HSP 1 Score: 751.125 bits (1938), Expect = 0.000e+0
Identity = 372/595 (62.52%), Postives = 455/595 (76.47%), Query Frame = 3
Query:   63 LALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMK-SITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGME--LTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            LALLSVSDKT+L     SL +L    IASGGTA+ + D+   V  +SD TG PE+L GRVKTLHPA+HAGILARN  +D  D++K ++  + +V+CNLYPF K +SS D+ + +A+E IDIGGV L+RAAAKN ARV V+CDP DY  V  EM  S   + S+ETR  LALKAF HTA YD  IS YF+ ++ +  + + LRYGMNPHQ PA L   +R+     +PLT+VNGSPGF+NLCDALNAWQLV EL QA    IPAAASFKHVSPAGAA+G+PLS++E + C+V      LTPLASAYAR+RGADRMSSFGDFIALSD CDVATAKIISREVSDG++AP Y EEALKIL+ KK G YCVL+++ +Y P ++EI+T++G  L QKRN+A+I+   FKN    +  LPESA+RDLIVA+IA+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G   ED E+ +K    FE  P  LT+ E+K WI KL  V LSSDAFFPFRDN+DRA +SGV+FIAAPSGS  D  +IEAC E  + L+HT LRLFHH
Sbjct:    1 LALLSVSDKTSLVEFAKSLNALGLGLIASGGTAKSLRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPDVTVQEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSAVAKEMAISKDKDTSMETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQL-YTMRSR----LPLTVVNGSPGFINLCDALNAWQLVKELKQALG--IPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDFHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVATAKIISREVSDGVVAPGYEEEALKILAKKKNGGYCVLQMDPHYEPDDNEIRTLYGLHLMQKRNNAVIDRSLFKNIVTKNKNLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANNWWLRHHPRVLSMKFKAGVKRAEISNAIDQYVTGTIGED-EDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRSGVQFIAAPSGSAADEVVIEACNELGITLIHTNLRLFHH 587          
BLAST of Bifunctional purine biosynthesis protein PURH vs. TrEMBL
Match: A0A093FJV0 (Bifunctional purine biosynthesis protein PURH (Fragment) OS=Gavia stellata OX=37040 GN=N328_03427 PE=3 SV=1)

HSP 1 Score: 749.969 bits (1935), Expect = 0.000e+0
Identity = 370/595 (62.18%), Postives = 455/595 (76.47%), Query Frame = 3
Query:   63 LALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEM-KSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGME--LTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKG---FEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            LALLSVSDKT+L     SL +L    IASGGTA+ + D+   V  +SD TG PE+L GRVKTLHPA+HAGILARN  +D  D++K ++  + +V+CNLYPF K +SS D+ + +A+E IDIGGV L+RAAAKN ARV V+CDP DY  V  EM  S   + S+ETR  LALKAF HTA YD  IS YF+ ++ +  + + LRYGMNPHQ PA L   +R+     +PLT+VNGSPGF+NLCDALNAWQLV EL QA    +PAAASFKHVSPAGAA+G+PLS++E + C+V      LTPLASAYAR+RGADRMSSFGDFIALSD CDVATAKIISREVSDG++AP Y EEALKIL+ KK G YCVL+++ +Y P ++EI+T++G  L QKRN+A+I+   FKN    +  LPESA+RDLIVA+IA+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KA+ WWLR HP+VLS+KFK+ +KRA+I+N ID Y++G   ED E+ +K    FE  P  LT+ E+K WI +L  V LSSDAFFPFRDN+DRA +SGV+FIAAPSGS  D  +IEAC E  + L+HT LRLFHH
Sbjct:    1 LALLSVSDKTSLVEFAKSLNALGLGLIASGGTAKSLRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPDVTVQEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSAVAKEMATSRDKDTSMETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQL-YTMRSK----LPLTVVNGSPGFINLCDALNAWQLVKELKQALG--LPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDFHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVATAKIISREVSDGVVAPGYEEEALKILAKKKNGGYCVLQMDPHYEPDDNEIRTLYGLHLMQKRNNAVIDRSLFKNVVTKNKNLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANNWWLRHHPRVLSMKFKAGVKRAEISNAIDQYVTGTIGED-EDLVKWQAMFEEVPAQLTEAEKKQWIARLTAVSLSSDAFFPFRDNVDRAKRSGVQFIAAPSGSAADEVVIEACNELGITLIHTNLRLFHH 587          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Cavefish
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:ZFIN;Acc:ZDB-GENE-011212-4])

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 328/591 (55.50%), Postives = 416/591 (70.39%), Query Frame = 3
Query:   66 ALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITN-ELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            A+LSVSDKT L      L ++    +ASGGTA+ + D+   V  +S+ TG PE+L GRVKTLHPA+H GILAR+S  D+ D++K+ +  + +V+CNLYPF K ++S ++ ++DA+E IDIGGVTL+RAAAKN ARV ++CDP DY+ +  EM+S  N + S++TR+ LALKAF HTA YDE I+ YF+ ++    + + LRYGMNPHQ PA +   LR     A+PLT++NGSPGF+NLCDALNAWQLV EL  A    +PAA SFKHVSPAGAA+G+ LS++E K C+V  M  +LTPLA+AYARARGADRMSSFGDFIALSD CDV TAKIISREVSDGIIAP Y EEAL+ILS KK G YCVL+++  Y P   E++ +FG  LKQKRN+A+I+ + F N  +  + L E A++DLIVATIA+K+TQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KAD WWLR HP VL +KF+S +KRA++ N ID Y+SG   E                             N++     F  F        +SGV +IAAP+GST D  +I AC E  + L HT  RLFHH
Sbjct:   11 AVLSVSDKTGLLDFAKRLVAVGLNLVASGGTAKTLRDAGLTVRDVSELTGFPEMLGGRVKTLHPAVHGGILARHSPSDQADMEKLGFSLVRVVVCNLYPFVKTVASPNVTVADAVEQIDIGGVTLLRAAAKNHARVTIVCDPSDYDLIAKEMESSGNHDTSLDTRKTLALKAFTHTAQYDEAIADYFRREYSGGVSQLQLRYGMNPHQAPAQI-YTLRP----ALPLTVLNGSPGFINLCDALNAWQLVRELKSALG--LPAATSFKHVSPAGAAVGVALSEEEAKVCMVHDMLKDLTPLATAYARARGADRMSSFGDFIALSDPCDVPTAKIISREVSDGIIAPAYDEEALRILSKKKNGNYCVLQMDPEYEPDEQEVRVLFGLHLKQKRNNAVIDKELFSNIVSKGT-LSEKALQDLIVATIAVKFTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKADNWWLRHHPTVLGMKFRSGVKRAEMANAIDQYVSGTIGE----------------------------PNLMCLPGVFRVFS-------QSGVEYIAAPAGSTADEVVINACNELGITLAHTNKRLFHH 558          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Sea Lamprey
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:ZFIN;Acc:ZDB-GENE-011212-4])

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 354/593 (59.70%), Postives = 443/593 (74.70%), Query Frame = 3
Query:   66 ALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMK-SITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFE--NFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            AL SVS+K  L  L   L +L    +ASGGTA  + D+   V  +++ TG  E+L GRVKTLHPA+H GILAR+S  D+ DL++  +  I +V+CNLYPF K +S+ D+ + DA+E IDIGGVTL+RAAAKN  RV VLCDP DY  V  EM+ S   + S ETR  LALKAF HTA YD  I+ YF+ +F R    + LRYGMNPHQ PA +       P   +PLT++NGSPGF+NLCDALNAWQLV EL  A    +PAAASFKHVSPAGAA+ +PLS++E + C+V  +   L+PLA+AYARARGADRMSSFGDFIALSD CDV TAKIISREVSDGI+AP Y EEALKIL+ KK G YCVL+++ +Y P+  E +T+FG +L+QKRNDA+I+   F N      +LPE AIRDLIVA++A+KYTQSNSVCYAKNGQVIGIG+GQQSRIHCTRLAG+KA+ WWLRQHP+VL L+F++ +KRA+++N ID+++SG   +D +   +   FE  P+  T+ ERKDWI +L+ V LSSDAFFPF DN+DRA +SGV+FIAAPSGST D  I+EAC ++ + LVHT LRLFHH
Sbjct:    8 ALFSVSNKEGLVGLASRLDALGLGLVASGGTATALRDAGLSVRDVAEVTGFAEMLGGRVKTLHPAVHGGILARSSAGDQADLERHGFSMIRVVVCNLYPFIKTVSTPDVTVPDAVEQIDIGGVTLLRAAAKNHERVTVLCDPSDYGTVAAEMEASAERDSSPETRRCLALKAFEHTARYDAAIADYFRREFGRGMAQLPLRYGMNPHQAPAQI---YTTGPR--LPLTVLNGSPGFINLCDALNAWQLVRELKTAL--ALPAAASFKHVSPAGAAVAVPLSEEEARVCMVQDIAGSLSPLATAYARARGADRMSSFGDFIALSDVCDVPTAKIISREVSDGIVAPGYQEEALKILAKKKNGNYCVLQMDASYEPEPQESRTVFGLQLQQKRNDAVIDRTLFSNVVTARKELPEEAIRDLIVASVAVKYTQSNSVCYAKNGQVIGIGSGQQSRIHCTRLAGDKANHWWLRQHPRVLGLRFRAAVKRAEVSNAIDVFVSGTVGQDVDLATWQAFFEEVPEAFTEAERKDWIGRLEGVALSSDAFFPFCDNVDRAKQSGVQFIAAPSGSTADQLIVEACDKHGIALVHTNLRLFHH 593          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Yeast
Match: ADE17 (Enzyme of 'de novo' purine biosynthesis; contains both 5-aminoimidazole-4-carboxamide ribonucleotide transformylase and inosine monophosphate cyclohydrolase activities; ADE17 has a paralog, ADE16, that arose from the whole genome duplication; ade16 ade17 mutants require adenine and histidine [Source:SGD;Acc:S000004727])

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 325/595 (54.62%), Postives = 425/595 (71.43%), Query Frame = 3
Query:   57 SKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGME-LTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGD---SQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            +K A+LSV DKT L  L   L   N + +ASGGTA+ I D+   +E +S  T +PE+L GRVKTLHPA+H GILAR+ + D+ DL +     +D V+CNLYPF++ ++   + + +A+E IDIGGVTL+RAAAKN ARV +L DP DY   ++E+ S   E+S + R +LALKAF HTA YD  IS +F+ ++   +  I+LRYG NPHQ PA   ++ ++    ++P  ++ GSPG++NL DALN+W LV EL+ + +  +PAAASFKHVSPAGAA+G+PLSD E +   V  +E L+PLA AYARARGADRMSSFGD+IALS+  DV TAKIISREVSDG+IAP Y  EAL ILS KKGGKYC+L+I+ NY P+  E + ++G  L+QKRNDAIIN   FK   + +  L E AI DL VATIA+KYTQSNSVCYA+NG V+G+GAGQQSRIHCTRLAG+KAD WW RQHP+VL +K+   +KR + +N IDL+++G     + +   +   FE  P+  T EERK+W+ KL NV LSSDAFFPF DN+ RAVKSGV++IAAPSGS  D  +  A    +++ V   +RLFHH
Sbjct:    5 TKTAILSVYDKTGLLDLARGLIEKNVRILASGGTARMIRDAGFPIEDVSAITHAPEMLGGRVKTLHPAVHGGILARDIDSDEKDLKEQHIEKVDYVVCNLYPFKETVAKVGVTIPEAVEEIDIGGVTLLRAAAKNHARVTILSDPKDYSEFLSELSS-NGEISQDLRNRLALKAFEHTADYDAAISDFFRKQYSEGQAQITLRYGANPHQKPAQAYVSQQD----SLPFKVLCGSPGYINLLDALNSWPLVKELSASLN--LPAAASFKHVSPAGAAVGIPLSDVEKQVYFVADIENLSPLACAYARARGADRMSSFGDWIALSNIVDVPTAKIISREVSDGVIAPGYEPEALAILSKKKGGKYCILQIDPNYVPEAVERRQVYGVTLEQKRNDAIINQSTFKEIVSQNKNLTEQAIIDLTVATIAIKYTQSNSVCYARNGMVVGLGAGQQSRIHCTRLAGDKADNWWFRQHPRVLEIKWAKGVKRPEKSNAIDLFVTGQIPTEEPELSEYQSKFEEIPKPFTPEERKEWLSKLTNVSLSSDAFFPFPDNVYRAVKSGVKYIAAPSGSVMDKVVFSAADSFDLVYVENPIRLFHH 592          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Yeast
Match: ADE16 (Enzyme of 'de novo' purine biosynthesis; contains both 5-aminoimidazole-4-carboxamide ribonucleotide transformylase and inosine monophosphate cyclohydrolase activities; ADE16 has a paralog, ADE17, that arose from the whole genome duplication; ade16 ade17 mutants require adenine and histidine [Source:SGD;Acc:S000004018])

HSP 1 Score: 652.899 bits (1683), Expect = 0.000e+0
Identity = 327/594 (55.05%), Postives = 420/594 (70.71%), Query Frame = 3
Query:   57 SKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGME-LTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFE--NFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            +K A+LSV DKT L  L   L   N + +ASGGTA  + ++   V+ +S  T +PE+L GRVKTLHPA+HAGILARN E D+ DL +     +D V+CNLYPF++ ++   + + +A+E IDIGGVTL+RAAAKN +RV +L DP DY   + ++ S   E+S + R + ALKAF HTA YD  IS +F+ ++   +  + LRYG NPHQ PA   I  +      +P  ++ G+PG++NL DALN+W LV EL+ + +  +PAAASFKHVSPAGAA+GLPLSD E +   V  ME L+PLA AYARARGADRMSSFGDFIALS+  DVATAKIIS+EVSDG+IAP Y  EAL ILS KK GKYC+L+I+ NY P   E + +FG  L+QKRNDAIIN   FK   + +  L E A+ DL VAT+ LKYTQSNSVCYAKNG V+G+GAGQQSRIHCTRLAG+K D WWLRQHPKVL++K+   +KRAD +N IDL+++G   E  E  ++   FE  P+  T EER +W+ KL+NV LSSDAFFPF DN+ RAV+SGV+FI APSGS  D  + +A    +++ V   +RLFHH
Sbjct:    5 TKTAILSVYDKTGLLDLAKGLVENNVRILASGGTANMVREAGFPVDDVSSITHAPEMLGGRVKTLHPAVHAGILARNLEGDEKDLKEQHIDKVDFVVCNLYPFKETVAKIGVTVQEAVEEIDIGGVTLLRAAAKNHSRVTILSDPNDYSIFLQDL-SKDGEISQDLRNRFALKAFEHTADYDAAISDFFRKQYSEGKAQLPLRYGCNPHQRPAQAYITQQEE----LPFKVLCGTPGYINLLDALNSWPLVKELSASLN--LPAAASFKHVSPAGAAVGLPLSDVERQVYFVNDMEDLSPLACAYARARGADRMSSFGDFIALSNIVDVATAKIISKEVSDGVIAPGYEPEALNILSKKKNGKYCILQIDPNYVPGQMESREVFGVTLQQKRNDAIINQSTFKEIVSKNKALTEQAVIDLTVATLVLKYTQSNSVCYAKNGMVVGLGAGQQSRIHCTRLAGDKTDNWWLRQHPKVLNMKWAKGIKRADKSNAIDLFVTGQRIEGPEKVDYESKFEEVPEPFTKEERLEWLSKLNNVSLSSDAFFPFPDNVYRAVQSGVKFITAPSGSVMDKVVFQAADSFDIVYVENPIRLFHH 591          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Nematostella
Match: EDO37389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFU6])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 353/594 (59.43%), Postives = 444/594 (74.75%), Query Frame = 3
Query:   63 LALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEM-KSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETT-ISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFE--NFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            LALLSVS+K  L      L  L ++ +ASGGTA  I ++   V  +S+ TG+PE+L GRVKTLHPA+H GILAR SE DK D+ K  + YI +V+CNLYPF   ++   + +S+A+E IDIGGVTL+RAAAKN  RV V+CDP DY  V++EM ++ T +   +TR+ LALKAF HTA YD  IS YF+ ++    + I LRYGMNPHQ PA L   +   P   +P+ ++NG+PGF+NLCDA N+WQLV EL Q+    IPAAASFKHVSPAGAA+G PL+ DE K C+V  M   LTPLA+AYARARGADRMSSFGD++ALSD CD+ATAKIISREVSDG+IAP Y  EAL++L  KKGGKYC+L+++ +Y P   E +TIFG +L+Q RN+A I+AD FKN       LPESA+RDL VA+IALKYTQSNSVCYAKNGQV+GIGAGQQSRIHCTRLAG+KA+ WWLR HP+VL + F+  +KRA+++N ID+Y++G   +D +   +   FE PP+ LT+ +RK+WI KL  V LSSDAFFPFRDNIDRAV+SGV FIA+PSGS  D   IEA  E+N+ +VHT +RLFHH
Sbjct:    9 LALLSVSNKKGLVEFAKQLHDLGFRLVASGGTANAIRNAGIPVRDVSEITGAPEMLGGRVKTLHPAVHGGILARVSEGDKADMAKQGFEYIRVVVCNLYPFVNTVAKEGVIVSEAVEQIDIGGVTLLRAAAKNHERVTVVCDPEDYNKVLSEMTENETCDTLPDTRKTLALKAFSHTASYDMAISDYFRKEYSENVSHIPLRYGMNPHQKPAQL---MTMEPE--LPVKVLNGAPGFINLCDAFNSWQLVRELHQSLG--IPAAASFKHVSPAGAAVGTPLTPDEAKVCMVDDMLDRLTPLATAYARARGADRMSSFGDWVALSDECDLATAKIISREVSDGVIAPSYQNEALEVLKKKKGGKYCILQMDPSYEPPALESRTIFGLQLEQLRNNAKIDADVFKNVMTKRKDLPESAVRDLTVASIALKYTQSNSVCYAKNGQVVGIGAGQQSRIHCTRLAGDKANNWWLRHHPRVLQMSFRKGVKRAEMSNAIDVYVNGTVGQDTDKATWEAMFESPPELLTENDRKEWIAKLKGVSLSSDAFFPFRDNIDRAVQSGVEFIASPSGSAADTICIEAGDEHNITMVHTNIRLFHH 595          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Nematostella
Match: EDO28137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7B4])

HSP 1 Score: 218.779 bits (556), Expect = 1.887e-64
Identity = 158/470 (33.62%), Postives = 228/470 (48.51%), Query Frame = 3
Query:  195 KISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETTIS--------------------LRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGMELTPLASAYARARGADRMSSFGDFIALSDCCDVATAK-IISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLP-ESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLS----LKFKSNLKRADINNL 1526
            +++DYTG PE++DGRVKTLHP IH GIL R +  D   +D+   + IDLV  NLYPF   ++     L+DAIE+IDIGG T++R+AAKN   VA++ + GDY  +I  +K+    LS   R  LALKAF HTA YD +I+ Y     +   ++S                    +RYG NPHQ  A      +   ++A  + +      F N+ D   A + V    +      P     KH +P G A+ L   D E             +  AY  A   D  S+FG  IA +   D  TAK I+ R+  + IIAP  S+ A  +++AK   +          R    + K + G  L Q R+  +I A+  K       + P E  + DLI A    K+ +SN++ YAK  Q IG+GAGQ SR++  R+A  KA+   L+    V++      F+  L  A  N +
Sbjct:    6 EVADYTGFPEMMDGRVKTLHPKIHGGILGRRA-IDGAVMDEHGIKPIDLVAVNLYPFAATVAKPGCDLADAIENIDIGGPTMVRSAAKNHKDVAIVVNAGDYTGIIESLKA--GGLSYAQRFDLALKAFEHTAAYDGMIANYLGTIDQSRDSLSTEERGAFPRTFNSQFIKAQEMRYGENPHQSAAFYVEAQKGEASVATAIQLQGKELSFNNVADTDAALECVKSFVK------PTCVIVKHANPCGVAVAL---DSE-----------GGIRQAYELAYATDTESAFGGIIAFNRELDGETAKAIVERQFVEVIIAPKISQAARDVVAAKANVRLLECGEWPVERSTGWDFKRVNGGLLVQSRDIGMIKAEDLKIVT---KRAPSEQEVHDLIFAWKVAKFVKSNAIVYAKGRQTIGVGAGQMSRVNSARIAAIKAEHAGLQVAGSVMASDAFFPFRDGLDNAAANGI 449          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Medaka
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:NCBI gene;Acc:101159333])

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 355/596 (59.56%), Postives = 444/596 (74.50%), Query Frame = 3
Query:   57 SKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITN-ELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQE--DFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            S+LALLSVSDKT L      L ++    +ASGGTA+ + ++   V  +S+ TG PE+L GRVKTLHPA+H GILAR +  D  D+DK+ Y  + +V+CNLYPF K +SS ++ + DA+E IDIGGVTL+RAAAKN ARV ++C+P DY  V  EM+S ++ + ++ETR+ LALKAF HTA YDE IS YF+ ++ R  + + LRYGMNPHQ PA L   LR      +PL ++NG+PGF+NLCDALNAWQLV EL  A    + AA SFKHVSPAGAA+G+PL+++E K C+V  M  +LTPLA+AYARARG+DRMSSFGDFIALSD CDV TAKIISREVSDGIIAP Y EEALKILS KK G YCVL+++ +Y P + E++ +FG  LKQKRN A+IN D+F N  +  S L + A+RDL VATIA+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KAD WWLR HP+VL++ F+S +KRA++ N ID Y+S    E  D   +   +E  P+ L+D E+K WI  L  V +SSDAFFPFRDNIDRA +SGV +IAAP+GS  D  +I AC E  + LVHT LRLFHH
Sbjct:    4 SELALLSVSDKTGLVDFSRRLVNVGLSLVASGGTAKALREAGLAVRDVSELTGHPEMLGGRVKTLHPAVHGGILARRTPSDTADMDKLGYSLVRVVVCNLYPFVKTVSSPNVTVEDAVEQIDIGGVTLLRAAAKNHARVTIVCNPDDYSLVAKEMESSSDKDTTLETRKTLALKAFTHTAQYDEAISDYFRGQYSRGVSQLPLRYGMNPHQAPAQL-YTLRPE----LPLKVINGAPGFINLCDALNAWQLVRELKSALG--MAAATSFKHVSPAGAAVGVPLTEEEAKVCMVHDMLSDLTPLATAYARARGSDRMSSFGDFIALSDVCDVPTAKIISREVSDGIIAPGYEEEALKILSKKKNGNYCVLQMDSDYEPDDTEVRVLFGLYLKQKRNGALINKDFFTNVVSKGS-LSDEAVRDLTVATIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKADNWWLRHHPRVLNMNFRSGVKRAEMANCIDQYVSNTIGEGPDLAVWKSKYEEVPEPLSDTEKKKWISSLQAVAVSSDAFFPFRDNIDRAKQSGVEYIAAPAGSAADQVVINACNEQGITLVHTNLRLFHH 591          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Medaka
Match: atic (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase [Source:NCBI gene;Acc:101159333])

HSP 1 Score: 669.848 bits (1727), Expect = 0.000e+0
Identity = 331/555 (59.64%), Postives = 415/555 (74.77%), Query Frame = 3
Query:   57 SKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKISDYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITN-ELSIETREKLALKAFCHTAHYDEVISGYFQNKF-RPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGM--ELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQE--DFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRA 1703
            S+LALLSVSDKT L      L ++    +ASGGTA+ + ++   V  +S+ TG PE+L GRVKTLHPA+H GILAR +  D  D+DK+ Y  + +V+CNLYPF K +SS ++ + DA+E IDIGGVTL+RAAAKN ARV ++C+P DY  V  EM+S ++ + ++ETR+ LALKAF HTA YDE IS YF+ ++ R  + + LRYGMNPHQ PA L   LR      +PL ++NG+PGF+NLCDALNAWQLV EL  A    + AA SFKHVSPAGAA+G+PL+++E K C+V  M  +LTPLA+AYARARG+DRMSSFGDFIALSD CDV TAKIISREVSDGIIAP Y EEALKILS KK G YCVL+++ +Y P + E++ +FG  LKQKRN A+IN D+F N  +  S L + A+RDL VATIA+KYTQSNSVCYAK+GQVIGIGAGQQSRIHCTRLAG+KAD WWLR HP+VL++ F+S +KRA++ N ID Y+S    E  D   +   +E  P+ L+D E+K WI  L  V +SSDAFFPFRDNIDRA
Sbjct:    4 SELALLSVSDKTGLVDFSRRLVNVGLSLVASGGTAKALREAGLAVRDVSELTGHPEMLGGRVKTLHPAVHGGILARRTPSDTADMDKLGYSLVRVVVCNLYPFVKTVSSPNVTVEDAVEQIDIGGVTLLRAAAKNHARVTIVCNPDDYSLVAKEMESSSDKDTTLETRKTLALKAFTHTAQYDEAISDYFRGQYSRGVSQLPLRYGMNPHQAPAQL-YTLRPE----LPLKVINGAPGFINLCDALNAWQLVRELKSALG--MAAATSFKHVSPAGAAVGVPLTEEEAKVCMVHDMLSDLTPLATAYARARGSDRMSSFGDFIALSDVCDVPTAKIISREVSDGIIAPGYEEEALKILSKKKNGNYCVLQMDSDYEPDDTEVRVLFGLYLKQKRNGALINKDFFTNVVSKGS-LSDEAVRDLTVATIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKADNWWLRHHPRVLNMNFRSGVKRAEMANCIDQYVSNTIGEGPDLAVWKSKYEEVPEPLSDTEKKKWISSLQAVAVSSDAFFPFRDNIDRA 550          
BLAST of Bifunctional purine biosynthesis protein PURH vs. Planmine SMEST
Match: SMESG000009882.1 (SMESG000009882.1)

HSP 1 Score: 1027.7 bits (2656), Expect = 0.000e+0
Identity = 497/503 (98.81%), Postives = 499/503 (99.20%), Query Frame = 3
Query:  318 MEYRYIDLVICNLYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGMELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEEALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 1826
            M YRYIDLVICNLYPFEKNISS DIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSI NELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTI+NGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGMELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDY EEALKILSAKKGGKYCVLKI+RNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH
Sbjct:    1 MGYRYIDLVICNLYPFEKNISSTDIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYECVINEMKSIINELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETTISLRYGMNPHQIPANLSINLRNNPTIAMPLTILNGSPGFVNLCDALNAWQLVLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGMELTPLASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYCEEALKILSAKKGGKYCVLKIDRNYRPQNDEIKTIFGFELKQKRNDAIINADYFKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDSQEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRAVKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH 503          
The following BLAST results are available for this feature:
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATIC0.000e+060.405-aminoimidazole-4-carboxamide ribonucleotide form... [more]
ATIC0.000e+060.435-aminoimidazole-4-carboxamide ribonucleotide form... [more]
ATIC1.322e-9562.675-aminoimidazole-4-carboxamide ribonucleotide form... [more]
ATIC3.460e-5756.255-aminoimidazole-4-carboxamide ribonucleotide form... [more]
ATIC9.730e-1752.055-aminoimidazole-4-carboxamide ribonucleotide form... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atic-10.000e+054.655-Aminoimidazole-4-carboxamide ribonucleotide form... [more]
atic-14.804e-15155.745-Aminoimidazole-4-carboxamide ribonucleotide form... [more]
atic-11.365e-14655.155-Aminoimidazole-4-carboxamide ribonucleotide form... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG110890.000e+058.96gene:FBgn0039241 transcript:FBtr0084710[more]
CG110890.000e+058.96gene:FBgn0039241 transcript:FBtr0303476[more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atic0.000e+060.405-aminoimidazole-4-carboxamide ribonucleotide form... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atic0.000e+060.575-aminoimidazole-4-carboxamide ribonucleotide form... [more]
atic0.000e+060.815-aminoimidazole-4-carboxamide ribonucleotide form... [more]
atic0.000e+060.745-aminoimidazole-4-carboxamide ribonucleotide form... [more]
atic0.000e+060.645-aminoimidazole-4-carboxamide ribonucleotide form... [more]
atic0.000e+060.715-aminoimidazole-4-carboxamide ribonucleotide form... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Atic0.000e+060.745-aminoimidazole-4-carboxamide ribonucleotide form... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35567|PUR9_RAT0.000e+060.74Bifunctional purine biosynthesis protein PURH OS=R... [more]
sp|Q9CWJ9|PUR9_MOUSE0.000e+060.74Bifunctional purine biosynthesis protein PURH OS=M... [more]
sp|Q5R5C2|PUR9_PONAB0.000e+060.84Bifunctional purine biosynthesis protein PURH OS=P... [more]
sp|P31335|PUR9_CHICK0.000e+061.58Bifunctional purine biosynthesis protein PURH OS=G... [more]
sp|P31939|PUR9_HUMAN0.000e+060.40Bifunctional purine biosynthesis protein PURH OS=H... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3A1S30.000e+061.64bifunctional purine biosynthesis protein PURH OS=E... [more]
Q6GLB60.000e+060.575-aminoimidazole-4-carboxamide ribonucleotide form... [more]
A0A091IP640.000e+062.52Bifunctional purine biosynthesis protein PURH (Fra... [more]
A0A087RDE80.000e+062.52Bifunctional purine biosynthesis protein PURH (Fra... [more]
A0A093FJV00.000e+062.18Bifunctional purine biosynthesis protein PURH (Fra... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atic0.000e+055.505-aminoimidazole-4-carboxamide ribonucleotide form... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atic0.000e+059.705-aminoimidazole-4-carboxamide ribonucleotide form... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ADE170.000e+054.62Enzyme of 'de novo' purine biosynthesis; contains ... [more]
ADE160.000e+055.05Enzyme of 'de novo' purine biosynthesis; contains ... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO373890.000e+059.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281371.887e-6433.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
atic0.000e+059.565-aminoimidazole-4-carboxamide ribonucleotide form... [more]
atic0.000e+059.645-aminoimidazole-4-carboxamide ribonucleotide form... [more]
back to top
BLAST of Bifunctional purine biosynthesis protein PURH vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000009882.10.000e+098.81SMESG000009882.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026515 ID=SMED30026515|Name=Bifunctional purine biosynthesis protein PURH|organism=Schmidtea mediterranea sexual|type=transcript|length=1913bp
ATCTATATTGCGGTATTTGTGTTTATTTTTCGCGTCATTTTTAAAAAACC
AGCATGTCTAAATTGGCTCTTTTAAGTGTTTCTGATAAAACAAACTTAAA
ATATTTAATTGATTCGCTTGCATCTTTGAATTATAAATTCATTGCTTCTG
GTGGAACAGCTCAATTCATTGCAGACAGTAATCATGTTGTTGAAAAAATT
TCAGATTATACTGGTTCTCCCGAATTGCTAGATGGTAGGGTAAAAACCTT
ACATCCAGCTATCCATGCAGGTATTTTAGCTCGAAATTCTGAAAAGGATA
AGCTCGATTTGGATAAAATGGAATATCGATACATTGATCTTGTTATTTGT
AATCTGTATCCTTTTGAGAAGAACATTTCTTCGGCTGATATTAAATTATC
AGATGCAATTGAAAGCATTGATATTGGAGGTGTAACACTAATTCGAGCAG
CTGCGAAGAACTTTGCTCGAGTTGCGGTGTTGTGTGATCCTGGTGACTAC
GAATGTGTAATAAATGAAATGAAATCCATCACCAATGAGCTATCAATTGA
AACTCGCGAGAAATTAGCCTTGAAAGCGTTTTGTCACACAGCCCATTATG
ATGAAGTGATTAGCGGTTATTTTCAAAATAAATTCCGTCCGGAAACGACG
ATTTCGCTACGATATGGTATGAATCCCCATCAAATACCGGCAAACTTATC
AATTAACCTGCGGAACAATCCAACTATAGCAATGCCATTGACGATTGTGA
ATGGGAGTCCAGGATTTGTGAATCTTTGTGATGCACTTAATGCCTGGCAG
CTTGTGCTGGAGTTGACTCAAGCGTTCGACAATAGAATTCCTGCTGCAGC
TAGTTTTAAGCATGTCAGTCCTGCTGGGGCGGCCATTGGCCTCCCTTTAT
CAGATGATGAAATTAAATCATGCCTTGTAACGGGAATGGAATTGACTCCT
TTAGCATCTGCTTATGCTCGGGCCAGAGGAGCGGACAGAATGTCTTCTTT
TGGAGATTTTATTGCTCTGTCTGATTGTTGCGATGTTGCCACAGCGAAAA
TCATCTCACGAGAAGTATCCGACGGAATAATCGCGCCTGATTATAGCGAG
GAAGCGTTGAAAATTCTTTCCGCCAAAAAAGGAGGAAAATATTGCGTTTT
AAAGATTAACAGAAATTATCGCCCGCAAAATGATGAAATTAAAACTATTT
TCGGATTCGAATTAAAACAAAAACGAAACGATGCAATAATTAATGCGGAT
TATTTCAAGAATTCCGCCGCTGGTGATTCCCAGCTCCCAGAAAGTGCAAT
TCGAGATCTTATAGTAGCTACTATAGCTTTAAAATATACTCAATCTAATT
CGGTATGTTATGCCAAGAATGGCCAAGTTATCGGTATCGGAGCGGGCCAA
CAATCTAGAATCCATTGTACAAGACTTGCAGGAAACAAGGCCGATATTTG
GTGGTTGAGGCAGCATCCAAAAGTTCTCAGTTTAAAATTTAAATCCAATC
TCAAGCGAGCTGATATAAACAATTTGATAGATTTGTATATCAGTGGAGAT
TCGCAAGAGGATTTTGAGAACTTTTTGAAGGGATTCGAAATACCACCGCA
AACTCTAACTGATGAGGAACGTAAGGATTGGATAAGGAAATTGGATAATG
TTGTTCTAAGTAGTGATGCTTTTTTCCCGTTTAGAGACAATATAGACCGA
GCGGTTAAATCCGGTGTCAGGTTTATTGCGGCTCCATCTGGATCGACTAA
TGATGCATCAATTATCGAGGCATGCAAGGAAAATAATGTCATTCTTGTCC
ACACGGCATTGCGTTTGTTTCACCATTAATTTAGATTAAAAAGGCATATG
AAAATTTTCTATTGAATATTTAATGTTTTTCTTAAATAAAAGTTTTGTTT
GTTTGAAAAAAAA
back to top

protein sequence of SMED30026515-orf-1

>SMED30026515-orf-1 ID=SMED30026515-orf-1|Name=SMED30026515-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=592bp
MSKLALLSVSDKTNLKYLIDSLASLNYKFIASGGTAQFIADSNHVVEKIS
DYTGSPELLDGRVKTLHPAIHAGILARNSEKDKLDLDKMEYRYIDLVICN
LYPFEKNISSADIKLSDAIESIDIGGVTLIRAAAKNFARVAVLCDPGDYE
CVINEMKSITNELSIETREKLALKAFCHTAHYDEVISGYFQNKFRPETTI
SLRYGMNPHQIPANLSINLRNNPTIAMPLTIVNGSPGFVNLCDALNAWQL
VLELTQAFDNRIPAAASFKHVSPAGAAIGLPLSDDEIKSCLVTGMELTPL
ASAYARARGADRMSSFGDFIALSDCCDVATAKIISREVSDGIIAPDYSEE
ALKILSAKKGGKYCVLKINRNYRPQNDEIKTIFGFELKQKRNDAIINADY
FKNSAAGDSQLPESAIRDLIVATIALKYTQSNSVCYAKNGQVIGIGAGQQ
SRIHCTRLAGNKADIWWLRQHPKVLSLKFKSNLKRADINNLIDLYISGDS
QEDFENFLKGFEIPPQTLTDEERKDWIRKLDNVVLSSDAFFPFRDNIDRA
VKSGVRFIAAPSGSTNDASIIEACKENNVILVHTALRLFHH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000429neoblast
PLANA:0002089reproductive organ
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036914MGS-like_dom_sf
IPR011607MGS-like_dom
IPR002695PurH-like
IPR024051AICAR_Tfase_dup_dom_sf
IPR024050AICAR_Tfase_insert_dom_sf
IPR016193Cytidine_deaminase-like
Vocabulary: biological process
TermDefinition
GO:0006164purine nucleotide biosynthetic process
GO:0031100animal organ regeneration
GO:0046452dihydrofolate metabolic process
GO:0046654tetrahydrofolate biosynthetic process
GO:0003360brainstem development
GO:0006189'de novo' IMP biosynthetic process
GO:0008152metabolic process
GO:0009116nucleoside metabolic process
GO:0009235cobalamin metabolic process
GO:0009259ribonucleotide metabolic process
GO:0010035response to inorganic substance
GO:0021549cerebellum development
GO:0021987cerebral cortex development
Vocabulary: molecular function
TermDefinition
GO:0004643phosphoribosylaminoimidazolecarboxamide formyltransferase activity
GO:0003937IMP cyclohydrolase activity
GO:0003824catalytic activity
GO:0042803protein homodimerization activity
GO:0045296cadherin binding
GO:0005515protein binding
GO:0016740transferase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0070062extracellular exosome
GO:0005739mitochondrion
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011607Methylglyoxal synthase-like domainSMARTSM00851MGS_2acoord: 14..128
e-value: 4.1E-33
score: 126.0
IPR011607Methylglyoxal synthase-like domainPFAMPF02142MGScoord: 18..128
e-value: 4.5E-18
score: 65.2
IPR002695Bifunctional purine biosynthesis protein PurH-likeSMARTSM00798aicarft_impchascoord: 133..463
e-value: 1.6E-110
score: 383.1
IPR002695Bifunctional purine biosynthesis protein PurH-likePFAMPF01808AICARFT_IMPCHascoord: 133..462
e-value: 3.5E-88
score: 295.9
IPR002695Bifunctional purine biosynthesis protein PurH-likePIRSFPIRSF000414PurHcoord: 1..591
e-value: 6.1E-164
score: 543.9
IPR002695Bifunctional purine biosynthesis protein PurH-likeTIGRFAMTIGR00355TIGR00355coord: 3..591
e-value: 3.2E-169
score: 562.0
IPR002695Bifunctional purine biosynthesis protein PurH-likePANTHERPTHR11692BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEINcoord: 3..591
IPR036914Methylglyoxal synthase-like domain superfamilyGENE3DG3DSA:3.40.50.1380coord: 1..194
e-value: 1.0E-75
score: 255.5
IPR036914Methylglyoxal synthase-like domain superfamilySUPERFAMILYSSF52335Methylglyoxal synthase-likecoord: 2..193
IPR024050AICAR transformylase, insert domain superfamilyGENE3DG3DSA:1.10.287.440coord: 478..517
e-value: 3.9E-99
score: 332.2
IPR024051AICAR transformylase, duplicated domain superfamilyGENE3DG3DSA:3.40.140.20coord: 228..374
e-value: 1.2E-63
score: 215.5
IPR024051AICAR transformylase, duplicated domain superfamilyGENE3DG3DSA:3.40.140.20coord: 378..591
e-value: 3.9E-99
score: 332.2
NoneNo IPR availablePANTHERPTHR11692:SF0BIFUNCTIONAL PURINE BIOSYNTHESIS PROTEIN PURHcoord: 3..591
NoneNo IPR availablePROSITEPS51855MGScoord: 1..144
score: 18.088
NoneNo IPR availableCDDcd01421IMPCHcoord: 3..190
e-value: 7.62869E-92
score: 278.713
IPR016193Cytidine deaminase-likeSUPERFAMILYSSF53927Cytidine deaminase-likecoord: 199..591