Golgin A5

Overview
NameGolgin A5
Smed IDSMED30026514
Length (bp)2073
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Golgin A5 (SMED30026514) t-SNE clustered cells

Violin plots show distribution of expression levels for Golgin A5 (SMED30026514) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Golgin A5 (SMED30026514) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Golgin A5 (SMED30026514) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026514

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30026514h1SMcG0010545 dd_Smed_v4_5164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026514h1SMcG0010545 dd_Smed_v4_5164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026514h1SMcG0010545 dd_Smed_v4_5164_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026514h1SMcG0010545 dd_Smed_v4_5164_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Golgin A5 vs. Ensembl Human
Match: GOLGA5 (golgin A5 [Source:HGNC Symbol;Acc:HGNC:4428])

HSP 1 Score: 201.445 bits (511), Expect = 9.114e-55
Identity = 165/537 (30.73%), Postives = 282/537 (52.51%), Query Frame = 3
Query:  447 CSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ--------------LINSRKSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIK-----LAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKN------------LKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            C     T NDD   KS EL N+ +      EN+LLR+E+ SLNQE++SLLQR+ ++ E+  + R ++EK +      D+  R L ++ DD+ E +  KD +LAVL   +Q               + S KS  +   ++ N + +   +           +   ++   +++  + +   +K++     LA+ +   E+   D+K+R+D L +Q+ +      + + +L +YK KA+ ILQ KEK+I SLK  + G E   S  + S     EL  +RHE ++ REEI +   ++     +LQ+++ Q   E ES R+ L  L +Q+  +K  +++++T+  +L +E  +++E   R K      +  +DEEI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L+S   + +SL  +LER E +++        S  N       G+ N +     +++ PV  N            ++ A +S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H
Sbjct:  208 CPDHTPTPNDD--GKSHELSNLRL------ENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTFQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLNLESSKQELIDYKQKATRILQSKEKLINSLKEGS-GFEGLDSSTASS----MELEELRHEKEMQREEIQKLMGQIHQLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQS-ELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNSASG----SSSNGSSINMSGIDNGE--GTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYTPEMH 724          
BLAST of Golgin A5 vs. Ensembl Celegans
Match: T24B1.1 (Golgin-84 [Source:UniProtKB/Swiss-Prot;Acc:P90970])

HSP 1 Score: 82.4185 bits (202), Expect = 3.380e-16
Identity = 90/348 (25.86%), Postives = 163/348 (46.84%), Query Frame = 3
Query:  942 DSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGAND-GTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELE-----ARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKP-NIISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            D K K  +  N +++  V  +  I  + EQL ++       + +  EYK KA  IL  KEK++ SLK     G+ D+         LQ E+  +R E DL + ++   ++++     D++EL+ Q+  + +S   +      + ++       +  +  + +R      ++ M+ + D   H S   E+ N +R+ IS  ++   D+  + E          L     Q + VL +N+     L +RLER       LQK  N  + +  D   +    +S    ++  + P T+N   A++++D  + K+   LR +P ARLFF++Y +I+H W+ F+ LTY PEIH
Sbjct:  226 DQKEKAVEECNMHKRKIVGLEEEIRAMVEQLRLAKFNLNENKKEFDEYKNKAQKILTAKEKLVESLKSEQGIGSSDRPVHL-----LQAEVEEIRVERDLTKADLESAQLQVYTLRSDMEELEAQIR-DLQSQLSDQKRTHLEEKQTWDSTIGLLNEKVECSRIENEFTKQEMKRQGD--QHQSKMLEKENELRKTISDLRSRMRDEQTKQEDDGSSQLTDLLLQKQQQLEDVLRNNQV----LNVRLER-------LQKATNRETSIAVDSNSSPMHTSSSHPLLSNINNPQTRN---ALHTVDSTAFKLLSMLRGHPSARLFFVLYFIIMHLWLFFIVLTYTPEIH 551          
BLAST of Golgin A5 vs. Ensembl Fly
Match: Golgin84 (gene:FBgn0039188 transcript:FBtr0084629)

HSP 1 Score: 90.5077 bits (223), Expect = 1.127e-18
Identity = 86/316 (27.22%), Postives = 163/316 (51.58%), Query Frame = 3
Query: 1071 DLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSED-----LQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNADRRGNIGMGNSDFIAIN------------MQDPP----VTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQP 1955
            +L+EY++KA   LQ K+ +IA LK     TE+       S+D     LQ E  +++ E +   EE+ + R++L+  D+  QE   Q   E  S R+  + L ++L + ++     ++D R LT+E   L+++   + A     L  +++++ +MRQ +S  +   T    + E R+++LT +L+++Q++L+   ++ ++L+++ E+ + +L   Q+   +  M + R      G+S    +N            M   P    V +  K A+   D + +++G FLRRYP  R+  I+Y  +LH WV+FV L+  P
Sbjct:  217 ELQEYRIKAQRALQAKDSLIAELKA--KPTEEGADPNLVSKDSETRFLQIEHESLKQELEHANEELQKARLQLD--DYVSQE--RQRQVELSSARQREETLAKELRQAREHSVTSESDQRVLTQELASLRQQLSNQMAAAATRLQEREQQLQQMRQRLS--EEANTGAKSDYETRLKALTQSLVERQSLLERVTSERNALRLQHEKAQTQL---QQNMHLVEMESQR------GSSRHTMLNSTDDVKAQFPLLMHPSPFDNRVARRFKRALRQADSMGIRVGTFLRRYPMMRVSVIVYVALLHLWVMFVLLSTTP 515          
BLAST of Golgin A5 vs. Ensembl Zebrafish
Match: golga5 (golgin A5 [Source:NCBI gene;Acc:406720])

HSP 1 Score: 218.009 bits (554), Expect = 1.242e-60
Identity = 163/511 (31.90%), Postives = 285/511 (55.77%), Query Frame = 3
Query:  513 NIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEI----QLINSRKSD---------------SVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKP-NIISGMN-ADRRGNIGMGNSDFIAINMQDPPVTK---NLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSN 1973
            ++ +N  +EN+LLR+E+SSLNQE++SL+QR     E+    R + +K +      D+  REL S+ DD+ E +  KD +LAVL   +    QL+ +R S                S GS+  +  +   ++++   +  +K + E   +++ E     + ++  +  LA+++ N E+   ++K+R + L +Q   S       + +L++YK KAS ILQ KEK+I SLK  + G E     G+  E     L  +RHE +L REEI + + +++    ++Q+L+ Q  TE ES R+ L  ++EQ  ++ + +++++ +  +  +E ++++E++ R K      +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   + +SL  +LER E +L  LQ   N  S +N A   G      +  I  +  D PVT     ++ A +++D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H S+
Sbjct:  253 HVISNLRLENQLLRNEVSSLNQEMASLIQRAKDMQEEVNLGRARADKWNSDQSRVDRTVRELSSQVDDLTEALSAKDGQLAVLKVRLDEADQLLKARSSALEEAQNERVRILQDHSEGSSLHSQAVQTLQDRLRDAEAAVKREQESYRQIQSEFAARLAKVEAERQTLAESLTNAERRLTEEKQRAEDLQQQAKSSRSAAEYTRQELQDYKNKASRILQSKEKLINSLKEGS-GLEVLEGAGAGVE-----LEELRHEKELQREEIQKLQAQIQSLRTEIQDLETQALTENESWREQLAEVQEQHAQQIRAKQEIEAELERSKQELQYIEEEHHRTKITLQGRVKDREDEIQKLRNQLTNKALSNSSQA-ELEGRLHQLTETLIQKQTMLEALGTEKNSLVFQLERLEQQLKSLQGGQNSASHINMAAMEGPGARQRNTPILFSDGDGPVTGVYGKVRKAASTIDRFSIRLGIFLRRYPMARVFVIIYMALLHLWVMIVLLTYTPEMHHSH 756          
BLAST of Golgin A5 vs. Ensembl Xenopus
Match: pde4d (phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1013100])

HSP 1 Score: 211.46 bits (537), Expect = 2.124e-58
Identity = 181/581 (31.15%), Postives = 305/581 (52.50%), Query Frame = 3
Query:  318 KKSLNKVSANPDENLFQFNHNSKMPRSGSDILKSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ----LINSR---------------KSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLK-GANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNI---------ISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSN 1973
            +K  NK   + D  LF       +P SGS    S N  T +D               KS EL N+ +      EN+LLR+E+ SLNQE++SL+QR+ ++ ++    R ++EK +      D+  REL ++ DD++E M  KD +LAVL   +Q    L+NSR               +  S GS+  +  +   + ++   +  LK + E   +++ E     S L+  +  +A+ V   EK  +++KR+ + L +Q   S     +++ ++ +YK KA+ ILQ KEK+I SLK G+     D +S  +       EL  MRHE D+ REEI +   +++    +LQ+++ Q  TE ES R+ L  + EQL  +++ +++++ +  +  +E +++QE   + K      +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   + +SL  +LER E ++  +Q  +I         I      R  N+ +  SD  A N+    +   ++ A  S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H  N
Sbjct:  170 RKEENKSCVSFDRGLFSMK---TLPDSGS----STNLSTTAD--------------PKSHELSNLRL------ENQLLRNEVQSLNQEMASLIQRSKETQKELNEARTRMEKWNGDNSKNDRTLRELQAQVDDLSEAMAAKDSQLAVLKVRLQEADQLLNSRTEALETLQSEKSRILQDQSEGSSLHSQALQTMQERLREAELTLKREQENYKQMQNEFGTRLSKLEVERQNMAEAVVLAEKKYIEEKRKSEDLQQQAKTSKVGLDSLKQEMADYKQKATRILQSKEKLINSLKEGSGIEGLDSHSASTM------ELEEMRHERDMQREEIQKLMGQIQQLKAELQDVESQQVTEAESAREQLQDVHEQLATQRRAKQELEAELERQKQEFQYMQEDLYKTKNTLQGRIRDREDEIQKLRNQLTNKALSSSSQT-ELENRLHQLTETLIQKQTMLENLSTEKNSLVYQLERLEHQMKNVQGSSINGSSINMSVIENNEGARMRNVPVLFSDSDA-NV--AGMYGRVRKAATSIDQFSIRLGIFLRRYPIARVFIIIYMALLHLWVMIVLLTYTPEMHHDN 713          
BLAST of Golgin A5 vs. Ensembl Xenopus
Match: pde4d (phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1013100])

HSP 1 Score: 210.305 bits (534), Expect = 5.748e-58
Identity = 172/544 (31.62%), Postives = 295/544 (54.23%), Query Frame = 3
Query:  429 DTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ----LINSR---------------KSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLK-GANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNI---------ISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSN 1973
            +T  D+ SS   +   D   KS EL N+ +      EN+LLR+E+ SLNQE++SL+QR+ ++ ++    R ++EK +      D+  REL ++ DD++E M  KD +LAVL   +Q    L+NSR               +  S GS+  +  +   + ++   +  LK + E   +++ E     S L+  +  +A+ V   EK  +++KR+ + L +Q   S     +++ ++ +YK KA+ ILQ KEK+I SLK G+     D +S  +       EL  MRHE D+ REEI +   +++    +LQ+++ Q  TE ES R+ L  + EQL  +++ +++++ +  +  +E +++QE   + K      +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   + +SL  +LER E ++  +Q  +I         I      R  N+ +  SD  A N+    +   ++ A  S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H  N
Sbjct:  192 ETLPDSGSSTNLSTTAD--PKSHELSNLRL------ENQLLRNEVQSLNQEMASLIQRSKETQKELNEARTRMEKWNGDNSKNDRTLRELQAQVDDLSEAMAAKDSQLAVLKVRLQEADQLLNSRTEALETLQSEKSRILQDQSEGSSLHSQALQTMQERLREAELTLKREQENYKQMQNEFGTRLSKLEVERQNMAEAVVLAEKKYIEEKRKSEDLQQQAKTSKVGLDSLKQEMADYKQKATRILQSKEKLINSLKEGSGIEGLDSHSASTM------ELEEMRHERDMQREEIQKLMGQIQQLKAELQDVESQQVTEAESAREQLQDVHEQLATQRRAKQELEAELERQKQEFQYMQEDLYKTKNTLQGRIRDREDEIQKLRNQLTNKALSSSSQT-ELENRLHQLTETLIQKQTMLENLSTEKNSLVYQLERLEHQMKNVQGSSINGSSINMSVIENNEGARMRNVPVLFSDSDA-NV--AGMYGRVRKAATSIDQFSIRLGIFLRRYPIARVFIIIYMALLHLWVMIVLLTYTPEMHHDN 717          
BLAST of Golgin A5 vs. Ensembl Xenopus
Match: pde4d (phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1013100])

HSP 1 Score: 209.92 bits (533), Expect = 9.364e-58
Identity = 172/545 (31.56%), Postives = 295/545 (54.13%), Query Frame = 3
Query:  426 PDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ----LINSR---------------KSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLK-GANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNI---------ISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSN 1973
             +T  D+ SS   +   D   KS EL N+ +      EN+LLR+E+ SLNQE++SL+QR+ ++ ++    R ++EK +      D+  REL ++ DD++E M  KD +LAVL   +Q    L+NSR               +  S GS+  +  +   + ++   +  LK + E   +++ E     S L+  +  +A+ V   EK  +++KR+ + L +Q   S     +++ ++ +YK KA+ ILQ KEK+I SLK G+     D +S  +       EL  MRHE D+ REEI +   +++    +LQ+++ Q  TE ES R+ L  + EQL  +++ +++++ +  +  +E +++QE   + K      +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   + +SL  +LER E ++  +Q  +I         I      R  N+ +  SD  A N+    +   ++ A  S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H  N
Sbjct:  192 AETLPDSGSSTNLSTTAD--PKSHELSNLRL------ENQLLRNEVQSLNQEMASLIQRSKETQKELNEARTRMEKWNGDNSKNDRTLRELQAQVDDLSEAMAAKDSQLAVLKVRLQEADQLLNSRTEALETLQSEKSRILQDQSEGSSLHSQALQTMQERLREAELTLKREQENYKQMQNEFGTRLSKLEVERQNMAEAVVLAEKKYIEEKRKSEDLQQQAKTSKVGLDSLKQEMADYKQKATRILQSKEKLINSLKEGSGIEGLDSHSASTM------ELEEMRHERDMQREEIQKLMGQIQQLKAELQDVESQQVTEAESAREQLQDVHEQLATQRRAKQELEAELERQKQEFQYMQEDLYKTKNTLQGRIRDREDEIQKLRNQLTNKALSSSSQT-ELENRLHQLTETLIQKQTMLENLSTEKNSLVYQLERLEHQMKNVQGSSINGSSINMSVIENNEGARMRNVPVLFSDSDA-NV--AGMYGRVRKAATSIDQFSIRLGIFLRRYPIARVFIIIYMALLHLWVMIVLLTYTPEMHHDN 718          
BLAST of Golgin A5 vs. Ensembl Xenopus
Match: pde4d (phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1013100])

HSP 1 Score: 198.749 bits (504), Expect = 5.794e-54
Identity = 168/541 (31.05%), Postives = 289/541 (53.42%), Query Frame = 3
Query:  426 PDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ----LINSR---------------KSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLK-GANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNI-ISGMNA----DRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSN 1973
             +T  D+ SS   +   D   KS EL N+ +      EN+LLR+E+ SLNQE++SL+QR+ ++ ++    R ++EK +      D+  REL ++ DD++E M  KD +LAVL   +Q    L+NSR               +  S GS+  +  +   + ++   +  LK + E   +++ E     S L+  +  +A+ V   EK  +++KR+ + L +Q   S     +++ ++ +YK KA+ ILQ KEK+I SLK G+     D +S  +       EL  MRHE D+ REEI +   +++    +LQ+++ Q  TE ES R+ L  + EQL  +++ +++++ +  +  +E +++QE   + K      +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   + +SL  +LER E ++  +Q  +I  S +N     +  G  G   S  I   ++   +       +      S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H  N
Sbjct:  192 AETLPDSGSSTNLSTTAD--PKSHELSNLRL------ENQLLRNEVQSLNQEMASLIQRSKETQKELNEARTRMEKWNGDNSKNDRTLRELQAQVDDLSEAMAAKDSQLAVLKVRLQEADQLLNSRTEALETLQSEKSRILQDQSEGSSLHSQALQTMQERLREAELTLKREQENYKQMQNEFGTRLSKLEVERQNMAEAVVLAEKKYIEEKRKSEDLQQQAKTSKVGLDSLKQEMADYKQKATRILQSKEKLINSLKEGSGIEGLDSHSASTM------ELEEMRHERDMQREEIQKLMGQIQQLKAELQDVESQQVTEAESAREQLQDVHEQLATQRRAKQELEAELERQKQEFQYMQEDLYKTKNTLQGRIRDREDEIQKLRNQLTNKALSSSSQT-ELENRLHQLTETLIQKQTMLENLSTEKNSLVYQLERLEHQMKNVQGSSINGSSINMSVIENNEGKAGYTESR-IRFGIRAESI-------ICQFCICSIRLGIFLRRYPIARVFIIIYMALLHLWVMIVLLTYTPEMHHDN 709          
BLAST of Golgin A5 vs. Ensembl Xenopus
Match: pde4d (phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1013100])

HSP 1 Score: 176.022 bits (445), Expect = 4.114e-46
Identity = 160/524 (30.53%), Postives = 281/524 (53.63%), Query Frame = 3
Query:  426 PDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEI----QLINSR---------------KSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLK-GANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNI---------ISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTL 1910
             +T  D+ SS   +   D   KS EL N+ +      EN+LLR+E+ SLNQE++SL+QR+ ++ ++    R ++EK +      D+  REL ++ DD++E M  KD +LAVL   +    QL+NSR               +  S GS+  +  +   + ++   +  LK + E   +++ E     S L+  +  +A+ V   EK  +++KR+ + L +Q   S     +++ ++ +YK KA+ ILQ KEK+I SLK G+     D +S  +       EL  MRHE D+ REEI +   +++    +LQ+++ Q  TE ES R+ L  + EQL  +++ +++++ +  +  +E +++QE   + K      +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   + +SL  +LER E ++  +Q  +I         I      R  N+ +  SD  A N+    +   ++ A  S+D+ S+++GIFLRRYP AR+F IIY +
Sbjct:  192 AETLPDSGSSTNLSTTAD--PKSHELSNLRL------ENQLLRNEVQSLNQEMASLIQRSKETQKELNEARTRMEKWNGDNSKNDRTLRELQAQVDDLSEAMAAKDSQLAVLKVRLQEADQLLNSRTEALETLQSEKSRILQDQSEGSSLHSQALQTMQERLREAELTLKREQENYKQMQNEFGTRLSKLEVERQNMAEAVVLAEKKYIEEKRKSEDLQQQAKTSKVGLDSLKQEMADYKQKATRILQSKEKLINSLKEGSGIEGLDSHSASTM------ELEEMRHERDMQREEIQKLMGQIQQLKAELQDVESQQVTEAESAREQLQDVHEQLATQRRAKQELEAELERQKQEFQYMQEDLYKTKNTLQGRIRDREDEIQKLRNQLTNKALSSSSQT-ELENRLHQLTETLIQKQTMLENLSTEKNSLVYQLERLEHQMKNVQGSSINGSSINMSVIENNEGARMRNVPVLFSDSDA-NV--AGMYGRVRKAATSIDQFSIRLGIFLRRYPIARVFIIIYMV 697          
BLAST of Golgin A5 vs. Ensembl Mouse
Match: Golga5 (golgi autoantigen, golgin subfamily a, 5 [Source:MGI Symbol;Acc:MGI:1351475])

HSP 1 Score: 207.608 bits (527), Expect = 4.291e-57
Identity = 166/551 (30.13%), Postives = 299/551 (54.26%), Query Frame = 3
Query:  414 KSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ---LINSRKSDSVGS--TADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSS--------------LDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGAN--DGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMEL-SVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKN------------LKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            +S  P   S+  SS       D   +S EL N+ +      EN+LLR+E+ SLNQE++SLLQR+ ++ E+  + R ++EK +      D+  REL ++ DD+ E +  KD +LAVL   +Q    + S +++++ +  +  + ++ DH+    L ++ L+   E L + +      Q S              ++  +  LA+ V   E+   ++K+++D L +Q+ +      + + +L +YK KA+ ILQ KEK+I SLK  +  +G E   +          EL  +RHE ++ +EEI +   ++     +LQ+++ Q  +E ES R+ L  L++Q+ +++  +++++T+  ++ +E R+++E   R K      +  ++EEI ++R  ++ K  + + Q  ELE+R+  LT+TLIQKQ +L+S   + +SL  +LER E ++ S    PN  S +N       G+ + +     +++ PV  N            ++ A +S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H
Sbjct:  197 ESTAPSATSEEHSS----TPSDGSSRSQELSNLRL------ENQLLRNEVQSLNQEMASLLQRSKETQEELNKARVRVEKWNVDNSKSDRITRELRAQVDDLTEAVAAKDSQLAVLKVRLQEADQVLSSRTEALEALRSEKSRIMQDHKEGSSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKMEVDRQNLAEAVTLAERKYSEEKKKVDELQQQVKLHRASLESAKQELVDYKQKATRILQSKEKLINSLKEGSSFEGLESSTASS-------MELEELRHEKEMQKEEIQKLMGQMHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQRTSKQELETELERMKQEFRYMEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQS-ELESRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQVHSASSGPNSGSAINMS-----GVDSGE--GTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYSPEMH 722          
BLAST of Golgin A5 vs. Ensembl Mouse
Match: Golga5 (golgi autoantigen, golgin subfamily a, 5 [Source:MGI Symbol;Acc:MGI:1351475])

HSP 1 Score: 207.608 bits (527), Expect = 4.291e-57
Identity = 166/551 (30.13%), Postives = 299/551 (54.26%), Query Frame = 3
Query:  414 KSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ---LINSRKSDSVGS--TADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSS--------------LDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGAN--DGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMEL-SVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKN------------LKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            +S  P   S+  SS       D   +S EL N+ +      EN+LLR+E+ SLNQE++SLLQR+ ++ E+  + R ++EK +      D+  REL ++ DD+ E +  KD +LAVL   +Q    + S +++++ +  +  + ++ DH+    L ++ L+   E L + +      Q S              ++  +  LA+ V   E+   ++K+++D L +Q+ +      + + +L +YK KA+ ILQ KEK+I SLK  +  +G E   +          EL  +RHE ++ +EEI +   ++     +LQ+++ Q  +E ES R+ L  L++Q+ +++  +++++T+  ++ +E R+++E   R K      +  ++EEI ++R  ++ K  + + Q  ELE+R+  LT+TLIQKQ +L+S   + +SL  +LER E ++ S    PN  S +N       G+ + +     +++ PV  N            ++ A +S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H
Sbjct:  197 ESTAPSATSEEHSS----TPSDGSSRSQELSNLRL------ENQLLRNEVQSLNQEMASLLQRSKETQEELNKARVRVEKWNVDNSKSDRITRELRAQVDDLTEAVAAKDSQLAVLKVRLQEADQVLSSRTEALEALRSEKSRIMQDHKEGSSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKMEVDRQNLAEAVTLAERKYSEEKKKVDELQQQVKLHRASLESAKQELVDYKQKATRILQSKEKLINSLKEGSSFEGLESSTASS-------MELEELRHEKEMQKEEIQKLMGQMHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQRTSKQELETELERMKQEFRYMEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQS-ELESRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQVHSASSGPNSGSAINMS-----GVDSGE--GTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYSPEMH 722          
BLAST of Golgin A5 vs. Ensembl Mouse
Match: Golga5 (golgi autoantigen, golgin subfamily a, 5 [Source:MGI Symbol;Acc:MGI:1351475])

HSP 1 Score: 73.559 bits (179), Expect = 4.236e-14
Identity = 55/175 (31.43%), Postives = 106/175 (60.57%), Query Frame = 3
Query: 1206 ELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMEL-SVLQKPNIISGMN 1727
            EL  +RHE ++ +EEI +   ++     +LQ+++ Q  +E ES R+ L  L++Q+ +++  +++++T+  ++ +E R+++E   R K      +  ++EEI ++R  ++ K  + + Q  ELE+R+  LT+TLIQKQ +L+S   + +SL  +LER E ++ S    PN  S +N
Sbjct:   10 ELEELRHEKEMQKEEIQKLMGQMHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQRTSKQELETELERMKQEFRYMEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQS-ELESRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQVHSASSGPNSGSAIN 183          
BLAST of Golgin A5 vs. UniProt/SwissProt
Match: sp|Q7SXE4|GOGA5_DANRE (Golgin subfamily A member 5 OS=Danio rerio OX=7955 GN=golga5 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 7.260e-59
Identity = 162/511 (31.70%), Postives = 284/511 (55.58%), Query Frame = 3
Query:  513 NIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEI----QLINSRKSD---------------SVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKP-NIISGMN-ADRRGNIGMGNSDFIAINMQDPPVTK---NLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSN 1973
            ++ +N  +EN+LLR+E+SSLNQE++SL+QR     E+    R + +K +      D+  REL S+ DD+ E +  KD +LAVL   +    QL+ +R S                S GS+  +  +   ++++   +  +K + E   +++ E     + ++  +  LA+++ N E+   ++K+R + L +Q   S       + +L++YK KAS ILQ KEK+I SLK  + G E     G+  E     L  +RHE +L REEI + + +++    ++Q+L+ Q  TE ES R+ L  ++EQ  ++ + +++++ +  +  +E ++++E++ R K      +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   + +SL  +LER E +L  LQ   N  S +N A   G      +  I  +  D P T     ++ A +++D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H S+
Sbjct:  253 HVISNLRLENQLLRNEVSSLNQEMASLIQRAKDMQEEVNLGRARADKWNSDQSRVDRTVRELSSQVDDLTEALSAKDGQLAVLKVRLDEADQLLKARSSALEEAQNERVRILQDHSEGSSLHSQAVQTLQDRLRDAEAAVKREQESYRQIQSEFAARLAKVEAERQTLAESLTNAERRLTEEKQRAEDLQQQAKSSRSAAEYTKQELQDYKNKASRILQSKEKLINSLKEGS-GLEVLEGAGAGVE-----LEELRHEKELQREEIQKLQAQIQSLRTEIQDLETQALTENESWREQLAEVQEQHAQQIRAKQEIEAELERSKQELQYIEEEHHRTKITLQGRVKDREDEIQKLRNQLTNKALSNSSQA-ELEGRLHQLTETLIQKQTMLEALGTEKNSLVFQLERLEQQLKSLQGGQNSASHINMAAMEGPGARQRNTPILFSDGDGPGTGVYGKVRKAASTIDRFSIRLGIFLRRYPMARVFVIIYMALLHLWVMIVLLTYTPEMHHSH 756          
BLAST of Golgin A5 vs. UniProt/SwissProt
Match: sp|Q6GNT7|GOGA5_XENLA (Golgin subfamily A member 5 OS=Xenopus laevis OX=8355 GN=golga5 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.442e-57
Identity = 166/524 (31.68%), Postives = 282/524 (53.82%), Query Frame = 3
Query:  489 KSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ----LINSR---------------KSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLK-GANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPN---------IISGMNADRRGNIGMGNSDFIAINMQDPPVTK---NLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            KS EL N+ +      EN+LLR+E+ SLNQE++SL+QR+ ++ E+    R ++EK +      D+  REL ++ DD++E M  KD +LAVL   +Q    L+ SR               +  S GS+     +   + ++   +  L  + E   +++ E     S ++  +  LA+ V   EK  +++KR+ D L +QL  S     +++ ++ +YK KA+ ILQ KEK+I SLK G+     D +S  +       EL  MRHE D+ REEI +   +++    +LQ+++ Q  +E ES R+ L  + EQ   +++ +++++ +  +  +E +++QE   + K      +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   + +SL  +LER E +L  +Q  +         +I      R  N+ +  SD       DP V      ++ A  S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H
Sbjct:  211 KSHELSNLRL------ENQLLRNEVQSLNQEMASLIQRSKETQEELNEARTRMEKWNGDNSKNDRTARELRAQVDDLSEAMAAKDSQLAVLKVRLQEADQLLKSRTETLESLQIEKSRILQDQSEGSSIHNQALQTMQERLREAESTLIREQESYKQIQNEFATRLSKIEAERQNLAEAVILAEKKHMEEKRKSDDLQQQLKTSKVGLDSLKQEMADYKQKATRILQSKEKLINSLKEGSGIEGLDSHSASTM------ELEEMRHERDMQREEIQKLMGQIQQLKAELQDVETQQVSEAESAREQLQDVHEQFATQQRAKQELEAELERQKQEFQYIQEDLYKTKNTLQGRIRDREDEIQKLRNQLTNKALSSSSQT-ELENRLHQLTETLIQKQTMLENLSTEKNSLVYQLERLEHQLKNVQGSSLNGTSINMSVIESNEGARMRNVPVLFSD------SDPNVAGMYGRVRKAATSIDQFSIRLGIFLRRYPIARVFIIIYMALLHLWVMIVLLTYTPEMH 715          
BLAST of Golgin A5 vs. UniProt/SwissProt
Match: sp|Q9QYE6|GOGA5_MOUSE (Golgin subfamily A member 5 OS=Mus musculus OX=10090 GN=Golga5 PE=1 SV=2)

HSP 1 Score: 207.608 bits (527), Expect = 3.002e-56
Identity = 166/551 (30.13%), Postives = 299/551 (54.26%), Query Frame = 3
Query:  414 KSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ---LINSRKSDSVGS--TADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSS--------------LDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGAN--DGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMEL-SVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKN------------LKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            +S  P   S+  SS       D   +S EL N+ +      EN+LLR+E+ SLNQE++SLLQR+ ++ E+  + R ++EK +      D+  REL ++ DD+ E +  KD +LAVL   +Q    + S +++++ +  +  + ++ DH+    L ++ L+   E L + +      Q S              ++  +  LA+ V   E+   ++K+++D L +Q+ +      + + +L +YK KA+ ILQ KEK+I SLK  +  +G E   +          EL  +RHE ++ +EEI +   ++     +LQ+++ Q  +E ES R+ L  L++Q+ +++  +++++T+  ++ +E R+++E   R K      +  ++EEI ++R  ++ K  + + Q  ELE+R+  LT+TLIQKQ +L+S   + +SL  +LER E ++ S    PN  S +N       G+ + +     +++ PV  N            ++ A +S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H
Sbjct:  197 ESTAPSATSEEHSS----TPSDGSSRSQELSNLRL------ENQLLRNEVQSLNQEMASLLQRSKETQEELNKARVRVEKWNVDNSKSDRITRELRAQVDDLTEAVAAKDSQLAVLKVRLQEADQVLSSRTEALEALRSEKSRIMQDHKEGSSLQNQALQTLQERLHEADATLKREQESYKQMQSEFAARLNKMEVDRQNLAEAVTLAERKYSEEKKKVDELQQQVKLHRASLESAKQELVDYKQKATRILQSKEKLINSLKEGSSFEGLESSTASS-------MELEELRHEKEMQKEEIQKLMGQMHQLRSELQDMEAQQVSEAESAREQLQDLQDQIAKQRTSKQELETELERMKQEFRYMEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQS-ELESRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQVHSASSGPNSGSAINMS-----GVDSGE--GTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYSPEMH 722          
BLAST of Golgin A5 vs. UniProt/SwissProt
Match: sp|Q8TBA6|GOGA5_HUMAN (Golgin subfamily A member 5 OS=Homo sapiens OX=9606 GN=GOLGA5 PE=1 SV=3)

HSP 1 Score: 201.445 bits (511), Expect = 4.377e-54
Identity = 165/537 (30.73%), Postives = 282/537 (52.51%), Query Frame = 3
Query:  447 CSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ--------------LINSRKSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIK-----LAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKN------------LKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            C     T NDD   KS EL N+ +      EN+LLR+E+ SLNQE++SLLQR+ ++ E+  + R ++EK +      D+  R L ++ DD+ E +  KD +LAVL   +Q               + S KS  +   ++ N + +   +           +   ++   +++  + +   +K++     LA+ +   E+   D+K+R+D L +Q+ +      + + +L +YK KA+ ILQ KEK+I SLK  + G E   S  + S     EL  +RHE ++ REEI +   ++     +LQ+++ Q   E ES R+ L  L +Q+  +K  +++++T+  +L +E  +++E   R K      +  +DEEI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L+S   + +SL  +LER E +++        S  N       G+ N +     +++ PV  N            ++ A +S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H
Sbjct:  208 CPDHTPTPNDD--GKSHELSNLRL------ENQLLRNEVQSLNQEMASLLQRSKETQEELNKARARVEKWNADHSKSDRMTRGLRAQVDDLTEAVAAKDSQLAVLKVRLQEADQLLSTRTEALEALQSEKSRIMQDQSEGNSLQNQALQTFQERLHEADATLKREQESYKQMQSEFAARLNKVEMERQNLAEAITLAERKYSDEKKRVDELQQQVKLYKLNLESSKQELIDYKQKATRILQSKEKLINSLKEGS-GFEGLDSSTASS----MELEELRHEKEMQREEIQKLMGQIHQLRSELQDMEAQQVNEAESAREQLQDLHDQIAGQKASKQELETELERLKQEFHYIEEDLYRTKNTLQSRIKDRDEEIQKLRNQLTNKTLSNSSQS-ELENRLHQLTETLIQKQTMLESLSTEKNSLVFQLERLEQQMNSASG----SSSNGSSINMSGIDNGE--GTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYTPEMH 724          
BLAST of Golgin A5 vs. UniProt/SwissProt
Match: sp|Q3ZU82|GOGA5_RAT (Golgin subfamily A member 5 OS=Rattus norvegicus OX=10116 GN=Golga5 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 6.963e-50
Identity = 172/570 (30.18%), Postives = 299/570 (52.46%), Query Frame = 3
Query:  372 NHNSKMPR-SGSDIL-----KSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ----LINSR-------KSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSS-------LDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGAN--DGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMEL-SVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKN------------LKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            N  S+ P  S SD +     KS    T S+  S  + +V  D    S EL N+ +      EN+LLR+E+ SLNQE++SLLQR+ ++ E+    R ++EK +      D+  REL ++ DD+ E +  KD +LAVL   +Q    +++SR       +S+      D N  S  +N+ +   +E       L + +      QS        ++  +  LA+ V   E+   ++++++D L +Q+ +      + + +L +YK KA+ ILQ KEK+I SLK  +  +G +   +     E+L+ E    + E   L  +I + R EL       Q+++ Q  +E ES R+ L  L++Q+ +++  +++++T+  ++ +E  +++E   R K      +  ++EEI ++R  ++ K  + + Q  ELE+R+  LT+TLIQKQ +L+S   + +SL  +LER E +L S    P+  S +N       G+ + +     +++ PV  N            ++ A +S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H
Sbjct:  174 NSGSQSPEVSSSDSMPEGHKKSTEESTVSNAISVEHSSVPSDG-SMSHELSNLRL------ENQLLRNEVQSLNQEMASLLQRSKETQEELNEARVRVEKWNVDNSKSDRITRELRAQVDDLTEAVAAKDSQLAVLKVRLQEADQVLSSRTEALEALQSEKSRIMQDHNEGSSLQNQALQTLQERHEADATLKREQESYKQMQSEFATRLNKMEVERQNLAEAVTLAERKYSEERKKVDDLQQQVKLHRSSLESAKQELVDYKQKATRILQSKEKLINSLKEGSSFEGLDSSTASSMELEELRHERELQKEEIQKLMGQIHQLRSEL-------QDMEAQQVSEAESAREQLQDLQDQIAKQRASKQELETELDRMKQEFHYVEEDLHRTKNTLQSRIKDREEEIQKLRNQLTNKTLSNSSQS-ELESRLHQLTETLIQKQTLLESLSTEKNSLVFQLERLEQQLHSAATGPSSGSSINMS-----GVDSGE--GTRLRNVPVLFNDTETNLAGMYGKVRKAASSIDQFSIRLGIFLRRYPIARVFVIIYMALLHLWVMIVLLTYSPEMH 721          
BLAST of Golgin A5 vs. TrEMBL
Match: A0A5J4NIZ9 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002160 PE=4 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 4.203e-73
Identity = 225/705 (31.91%), Postives = 350/705 (49.65%), Query Frame = 3
Query:  102 MSWISDLAGKAENFLNNLDSSAAQALNKSQDNLDKNLQYNRKTEPSVIKEYDRFSQRGIDNY------SGDSIRS------LPLKKSLNKVSANPDEN--LFQFNHNSKMPRSGSDI--------LKSNNPD------------------------TYSDNCSSGYKT--------VNDDYVDKS--DELINMN---------IDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQLINSRKSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQ-LNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSED----LQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQT----------NQTD--QVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTE-----MELSVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQP 1955
            MSW+S+LA KAEN LN +DSS A ALN +           RK+  S   + DR  +  +  +      S D++ S      + ++ +   +   P E          +  PR  S I        L    P                         T  ++ SSGY T        VN+D+V  +   +L  +N         + N+  +ENKLLRSE+SSL+QE+S LL+RNHK+ E+NK LR Q+E++ +QLRD D + REL                +L V  SEI   +++   ++   + + L     N +                        +  L   +  LA T+N      + + RR++ L E+ + ++ Q+ V I  +L +YK KAS+IL MK+K+IASL+      E++ +    +ED    L ++LS ++ ECD+LREE+AR R+E++HR+   QEL+ QM TE ++LR NLDL E++ EREKQLRED DT+   L    R L++   ++KA+FH  L A + E+ R+RQM+S +QT           +TD   V+ LE+R+R LTDTL+ +Q  LDS  A  H+L+IRLER +     +  +V  + N ++     R      G      + + +  V +  +  V  LD+L++++    RR+P  RL + IY  +LHFW+LF  + + P
Sbjct:    1 MSWLSELASKAENLLNTIDSSTAGALNST---------LVRKSPTSWRLDADRTDRLNVQPHAEEIWHSSDAVESDSSSLFMDMQHTSVPLLGTPKETTAFHPVTDTTVHPRLASTIDSLLQPVRLDPPTPSNETRVEGYTTHLTSGLINTELRAATNDNSTSSGYHTLATEVHSVVNNDHVPSTVATDLAELNRHGRGRVQQMANDTRLENKLLRSEVSSLSQEVSDLLRRNHKATEENKELRGQIERLENQLRDSDFRVREL----------------QLTVKQSEISAASAKSEFTIDQPSPSEL---ELNVV------------------------REQLQSKEAALA-TLN----VELHECRRLNELAEKRVQLAQQQTVRITQELDQYKEKASHILTMKDKLIASLRSRGKSDEEQPAGSQMTEDVGNDLNRQLSTLQAECDILREEVARWRIEVDHRELSNQELEIQMQTERDALRHNLDLAEQRAEREKQLREDADTELIHLRFRQRELEDTMSKQKAEFHRQLVANESELGRLRQMLSRRQTMDNGSSEGGLTRTDPEHVLTLESRLRQLTDTLLARQDALDSVLAQNHALKIRLERAQSDNESLASAVGAEDNQLNAQTRVRLPFQTAGGYGCARLVLHNSIVPRPFRAPVACLDELAMRLTNICRRWPLTRLIWFIYFGLLHFWLLFASVLFLP 648          
BLAST of Golgin A5 vs. TrEMBL
Match: C3XR61 (Uncharacterized protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_154839 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.644e-72
Identity = 221/717 (30.82%), Postives = 359/717 (50.07%), Query Frame = 3
Query:  102 MSWISDLAGKAENFLNNLDSSAAQALNKSQDNLDKNLQYNRKTEPSVIK----EYDRF------------------SQRGIDNYSGDSIRSLPLKKSLNKVS-ANP------------DENLFQF-NHNSKMPRSGS--DILKSNNPDT-----------------YSDNCSSGYKTVNDDY---VDKSDELINMN--IDNNP--------SIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVL--------------HSEIQLINSRK-------SDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQK-----PN--IISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            MSWISD AGKAE  LN +D +AAQAL +++   +       +  P V +    E  R+                  S   +   S  +   +P   SL  +S  +P            DE LF+F N  +  P +    D+ ++  P +                 Y++  +S Y ++  +     D SD L   +   D+ P        ++EN LLRSE++SLNQE++SL+QR   + E+  R + +L+ +S      D+  REL S ++D+ E +  KD +LAVL               + ++ + S K       SDS G  + A  +   R K+   +  LK + E     + E +  Q  L+  +  +A+++ + +K   DDK+RI  LT  +  +     + + +L +YK KA+ ILQ KEK+I SL+    G+E           +  EL  +RHE DL RE+I    ++L+    +LQE + Q+ +E +  R  +  LE+ + +EKQLRED +T+   L +E R++QE+ +++K  F   L  ++EEI ++R  ++TK  + T Q  ELE R+ SLT++LIQKQ +L++   + +SL ++LER E +    Q      P   ++ GM  D      + ++ F+ ++         +K A NS+DK S+++G+FLRRYP ARLF I+Y ++LH WV+ V LTY PEIH
Sbjct:    1 MSWISDFAGKAEALLNKVDQTAAQAL-QAEGEGETGKSVPSQPAPGVQRSHHVETARYERPGPPEPPRMETQALHTSASMVSLSSPRTASGIPRVPSLGTISQGSPQRAYGRKKPRDEDEKLFEFLNSPNTFPAAEKKRDVTRAAEPSSTGGKHSRQSSDSSSVSAYTEGSTS-YSSMAVEAKGGSDGSDGLPTSSESSDDQPLRQQVSSLTLENNLLRSEVASLNQEMTSLIQRCKAAQEEVTRTKQRLDTMSSGASQTDRIIRELRSREEDLTEAITTKDAQLAVLKVRLDEADQELKAKRTMVEELQSEKDRILRDHSDSSGIHSQA--LDSLREKLHEAEAALKREQESYKIAQNEAMERQHKLEADRHSMAESLTSAQKQVQDDKKRISDLTVHMEKAKATAESARQELSDYKQKATRILQSKEKLINSLR--QGGSEVDSGAAGAGASVGLELEELRHERDLQREDIQHLSMQLDQARLELQEQESQLQSEIDMSRHQIRELEDHMSQEKQLREDAETELASLKQEMRYIQEEMVKQKTTFQTRLKDREEEIQKLRNQMTTKAMSTTTQS-ELEGRLHSLTESLIQKQTMLEALSTEKNSLVLQLERLEQQYRAAQPLAGKHPGHTVVGGM--DEEDGARVRSAPFLQVDPSGTSPINRVKRAANSIDKFSIRLGVFLRRYPTARLFVILYMVLLHLWVMIVLLTYTPEIH 708          
BLAST of Golgin A5 vs. TrEMBL
Match: A0A504YVB3 (Golgin subfamily A member 5 OS=Fasciola gigantica OX=46835 GN=FGIG_07063 PE=4 SV=1)

HSP 1 Score: 254.218 bits (648), Expect = 2.592e-71
Identity = 209/695 (30.07%), Postives = 343/695 (49.35%), Query Frame = 3
Query:  102 MSWISDLAGKAENFLNNLDSSAAQALNKSQDNLDK----NLQYNRKTEPSVIKEYDRFSQRGIDNYSGD------------SIRSLPLKK-------SLNKVSANP-------DENLFQFNHNSKMPRSGSDILKSNNPDTYSDNCSSGYKTVND-----------------------DYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMN---ETMKVKDQKLAVLHSEIQLINSRKSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQT------------------DQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNAD---RRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQP 1955
            MSWIS+ A KAE+ LN LDSSAA+A N ++  +      N    R   P V+KE D FS    D ++ D            S+     +K       S  K+S +P       D +L +   +S        + +S +        SSGY+TV+                         ++     ++      +  +ENKLLRSE+SS++QE+S LL+RNHK+ E+NK LR Q+E++++QLRD D + REL     + +    +    DQ  A +  ++ +            A A+L++                              +  L+ SK K A+ V   E S  + +R+ +I  ++  ++ ++   +  +L +YK KA++IL MKE +IASL+ A+    +  S    S+  ++ + +++ ECD+LREE++R R+E +HR+  +QEL+ QM +E ESLR++ DL E+  +RE+QLRED D++  QL R+ R  +    R+KAD+H  L+A + E+ R+RQ ++ + ++ T                  + V+ LE+R+R L+D L+ KQ VLDS  A  H+L+IRLER  ++   L       G N      R     G      + + + P+ ++++     LD + +++   LRR+P ARL F +YT  LH W+L+  L Y P
Sbjct:    1 MSWISEWANKAEHLLNTLDSSAAEAFNANRGRIPTSVFDNTASARSELPQVVKELD-FSSPNWDQFAHDPNTSSSAQYLSESVPGFSTQKHAASKLRSSPKLSMSPLKSTNVSDIHLDEILGDSGRTAESLSLSESGHVGNEEAASSSGYETVDSVRLPSVSVENQSCRPISVREADTKHLTPVRAILAQETVTDTKLENKLLRSEVSSMSQEVSGLLKRNHKAVEENKELRGQVERLTNQLRDSDTRVRELQVRMKEFSIDYTSRATMDQDFAQMKQQLTI------------AQADLLTA-----------------------------RGQLESSK-KHAEAV---ESSLQEARRQNEIAEKRAELAQKESSRLIKELAQYKEKAAHILTMKENLIASLRAAD---ANSMSPNETSDVDREMMESLQAECDMLREEVSRWRIEADHRELAMQELEVQMQSERESLRRDHDLAEQHAQRERQLREDADSELVQLKRQLREYENSMSRQKADWHAQLTASETELGRLRQTLARRHSSGTGHFLVDSSPTAELTRTDPEHVLSLESRLRQLSDNLLTKQDVLDSVLAQNHALKIRLERAHLDNESLASALSAPGDNQSDIYVRLPYQAGTYGCARLALHNSPIPRSVRPIPRFLDDMGIRLTNLLRRWPLARLLFFVYTAFLHLWLLWATLVYLP 646          
BLAST of Golgin A5 vs. TrEMBL
Match: A0A075AEM5 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06000 PE=4 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 3.170e-69
Identity = 208/714 (29.13%), Postives = 356/714 (49.86%), Query Frame = 3
Query:  102 MSWISDLAGKAENFLNNLDSSAAQALNKSQ------DNLDKNLQYNRKTE--------PSVIKEYDRFSQRGIDN-YSGDSIRSLPLKKSLNKVSA--NP------DENL----FQFNHNS-----KMPRSGSDILKSNNP---DTYSDNCSSGYKTVNDDYVDKSD--ELINMNIDN---------NPS---------------IENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQLINSRKSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLA---QTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKG--ANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTD--------------------QVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNADRRGNI----GMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSN 1973
            MSW++ LA KAEN LN +DS+AA AL  S          D++  Y   +E        P +I  +D  S R  ++ +  +S + L    +  + S    P      DE +    F F ++S      +P + +++  ++ P   D      SSGY+T+  D + + D   LI               NPS               +ENK+LRSE+SSL+QE+S LL+RNHK+ E+NK LR Q E++ ++LRD D + REL          ++VK+ +++   + ++ +NSR                                          +  +S L+D++ +L    + +   E +  D +R+ ++  +++ ++ Q+   I  +L +YK KA+ IL MKE++IASL+G  A +G+E + S  + SE  +  L+ +R ECD+L EE +R R+E+EHR+  +QEL+ QM TE E+LR NL+L E++ EREKQLRED D++   L +  R L++   +++A+ H  L A + E+ R+RQ+++ +  + +D                     V+ LE+R+R LTDTL+ +Q  LDS  A  H+L+IRLER + +   L     +    ++ R  +      G      + + +  + + L    + LD  ++++    RR+P  R+ F++Y ++LH W+L   + + P   S++
Sbjct:    1 MSWLTGLASKAENLLNTIDSTAADALKSSPLRHTAGPRNDEDGVYTTPSESRSQTSDYPIIIPTFDADSDRRQEHVFPPESQKRLSTSATFPRASTPTTPKKPSTDDERIRSDPFTFLNDSTTKLLSVP-TTTELHTTSGPSSVDADVRTASSGYQTMPVDKIPEPDSQPLIVTEAGGTTNSHESFLNPSHTKVTQSRQSMSDLILENKILRSEVSSLSQEVSDLLRRNHKATEENKELRGQTERLENKLRDSDSRLREL---------QVRVKELEISTPDTNVESLNSR-----------------------------------------LVMMESELNDARRQLEVKQEALVTMETNVQDFQRQAELAEKRVQLAQQQTTRITQELAQYKEKATRILNMKEQLIASLRGETAGNGSETQISDTAESESSKMILT-LRAECDMLHEESSRWRIEVEHREMAMQELEMQMQTEREALRHNLELAEQRAEREKQLREDADSELAVLRKRQRDLEDASSKQRAELHGQLVASESELGRLRQLMTRRPVSSSDGQSSPATDNNSMVVTRTDPAHVLTLESRLRQLTDTLLSRQDALDSVLAQNHALKIRLERAKADNETLATALAVEDSQSNTRVRLPFHPAAGGYGCARLALHNSVIPRPLHPVASFLDSAAVRVTNVFRRWPLTRMIFLVYFILLHMWLLLASVIFLPSATSTS 662          
BLAST of Golgin A5 vs. TrEMBL
Match: G1NKD1 (Golgin A5 OS=Meleagris gallopavo OX=9103 GN=GOLGA5 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 9.258e-63
Identity = 217/737 (29.44%), Postives = 365/737 (49.53%), Query Frame = 3
Query:  102 MSWISDLAGKAENFLNNLDSSAAQALNKS---------QDNLDKNLQYNRKTEPSVIKEYDRFSQRGIDNYSGDSIRSL------------PLKKSLNKVSAN--------------------PD-ENLFQF-NHNSKMP--RSGSDILKSNNP---DTYSDNCSS--------------GYKTVNDDYVDKSDELINMNIDN----------NPSI----------------ENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQ----LINSR---------------KSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQK-----PNI----ISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            MSW++DLAGKAE+ LN +D  AA ALNK            NLD   +Y+  ++ +   +Y   S+    + + D+I++             P +++ ++V+++                    PD E LF F N + K P  R  S   KS  P    + + N SS                ++ +++  D SD  +   +D           NP +                EN+LLR+E+ SLNQE++SL+QR+ ++ E+  + R ++EK +      D+  REL +  DD+ E +  KD +LAVL   +Q    L++SR               +  S GS+     +   ++++   D  LK + E   +++ E     S ++  +  LA+ V   E+  +D+K+R D L +Q+ +   +  + + +L +YK KA+ ILQ KEK+I SLK  + G E   S  + +     EL  +RHE D  REEI +   +++    +LQ+++ Q  +E ES+R+ L  L+EQ+   K  +++ + +  +  +E R+ +E+  R K      +  ++EEI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L+S   + +SL  +LER E +L   Q      P+I    I G    R  N+ +  SD   ++     +   ++ A +S+D+ S+++GIFLRRYP AR+F IIY  +LH WV+ V LTY PE+H
Sbjct:    1 MSWLADLAGKAEDLLNRVDQGAASALNKKDAASNAAFDSKNLDSANEYSELSQHAKELKYQTSSKAAYISSAADNIKNQKATILAGTANVKPARRTNSEVASSVESVSTSRASSHFVRRKKSEPDDELLFDFLNSSEKEPNARMDSKKEKSKAPVQNHSRTSNISSVSTSTQSAVTTEDKSVRSKSNETPDSSDSGLGTQVDGTKDSSLSAVTNPGLSANDDVKSHELSNLRLENQLLRNEVQSLNQEMASLIQRSKETQEELNKSRERVEKWNVDHSKNDRMVRELRARVDDLTEAVGAKDSQLAVLKVRLQEADQLLSSRTEALEALQSEKSRIIQDHSEGSSLQNQALQTLQDRLRDADSTLKREQESYKQMQNEFAARLSKMEAERQNLAEGVTVAERKYLDEKKRADELQQQVKVIKNQLESAKQELADYKQKATRILQSKEKLINSLKEGS-GIEGLDSQTAST----MELEELRHERDTQREEIQKLMGQMQQMRTELQDMETQQVSEAESVREQLQDLQEQIAAHKMAKQEAEAELERQKQELRYTEEELYRTKNTLQSRIKDREEEIQKLRNQLTNKALSSSSQT-ELENRLHQLTETLIQKQTMLESLSTEKNSLVYQLERLEHQLKAFQGSSTNGPSINMAGIDGTEGARMRNVPVLFSD---VDTNIAGMYGRVRKAASSIDQFSIRLGIFLRRYPIARIFVIIYMALLHLWVMIVLLTYTPEMH 728          
BLAST of Golgin A5 vs. Ensembl Cavefish
Match: golga5 (golgin A5 [Source:NCBI gene;Acc:103034987])

HSP 1 Score: 210.305 bits (534), Expect = 4.885e-58
Identity = 158/552 (28.62%), Postives = 294/552 (53.26%), Query Frame = 3
Query:  396 SGSDILKSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEI----QLINSRKSD---------------SVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQK-----PNI----ISGMNADRRGN-IGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            S  D  + + P++     ++  +         + E     + +N  +EN+LLRSE++SLNQE++SL+QR   + E+  + R + +K + +    D+  R+L S+ DD+ E +  KD +LAVL   +    QL+ +R S                S G++  +  +   ++ +   +  LK + +   +++ E     + ++  +  LA+++ + E+   ++++R + L +Q   S       + +L +YK KAS ILQ KEK+I+SLK ++    D    G+ +  +  EL  +RHE +L REEI + + +++    ++QEL+ Q   E ES R+    L EQ  ++ + +++V+ +  +  +E ++++E+  R K+     +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   +  SL  +LER E +L  +Q      P+I    + G  A +R   +   + D  A       V   ++ A +++D+ S+++GIFLRRYP AR+F I+Y  +LH WV+ V LTY PE+H
Sbjct:  191 SARDFSQGDTPESSDSGLAAALEPPPATVDSAAPEEQVGQVLSNLRLENQLLRSEVTSLNQEMASLVQRAKNTQEELNQARARSDKWNSEQSRTDRAVRDLRSQVDDLTEALSAKDGQLAVLKVRLDEADQLLKARSSALEEAQNERSRILQDHSEGNSLQSQALQTMQDCVRESEAALKREQDSYRQMQSEFAARLAKIEAERQTLAESLTSAERRVTEERQRAEELQQQAKSSRSAADYAKQELHDYKNKASRILQSKEKLISSLKESSG--LDVLDGGAGAAGV--ELEELRHEKELQREEIQKLQAQIQSLRSEIQELESQAVVEAESWREQQQDLLEQQAQQSRAKQEVEAELERCKQELQYVEEEQHRTKSSLQSRIKDREDEIQKLRNQLTNKALSNSSQA-ELEGRLHQLTETLIQKQTMLEALGTEKSSLIFQLERLEQQLKSVQGGQSSGPHINMAAVEGPGARQRNTPVLFSDHDSSATG-----VYGKVREAASTIDRFSIRLGIFLRRYPAARVFVIVYMALLHLWVMIVLLTYTPEMH 732          
BLAST of Golgin A5 vs. Ensembl Cavefish
Match: golga5 (golgin A5 [Source:NCBI gene;Acc:103034987])

HSP 1 Score: 210.69 bits (535), Expect = 5.129e-58
Identity = 158/552 (28.62%), Postives = 294/552 (53.26%), Query Frame = 3
Query:  396 SGSDILKSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEI----QLINSRKSD---------------SVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQK-----PNI----ISGMNADRRGN-IGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            S  D  + + P++     ++  +         + E     + +N  +EN+LLRSE++SLNQE++SL+QR   + E+  + R + +K + +    D+  R+L S+ DD+ E +  KD +LAVL   +    QL+ +R S                S G++  +  +   ++ +   +  LK + +   +++ E     + ++  +  LA+++ + E+   ++++R + L +Q   S       + +L +YK KAS ILQ KEK+I+SLK ++    D    G+ +  +  EL  +RHE +L REEI + + +++    ++QEL+ Q   E ES R+    L EQ  ++ + +++V+ +  +  +E ++++E+  R K+     +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   +  SL  +LER E +L  +Q      P+I    + G  A +R   +   + D  A       V   ++ A +++D+ S+++GIFLRRYP AR+F I+Y  +LH WV+ V LTY PE+H
Sbjct:  220 SARDFSQGDTPESSDSGLAAALEPPPATVDSAAPEEQVGQVLSNLRLENQLLRSEVTSLNQEMASLVQRAKNTQEELNQARARSDKWNSEQSRTDRAVRDLRSQVDDLTEALSAKDGQLAVLKVRLDEADQLLKARSSALEEAQNERSRILQDHSEGNSLQSQALQTMQDCVRESEAALKREQDSYRQMQSEFAARLAKIEAERQTLAESLTSAERRVTEERQRAEELQQQAKSSRSAADYAKQELHDYKNKASRILQSKEKLISSLKESSG--LDVLDGGAGAAGV--ELEELRHEKELQREEIQKLQAQIQSLRSEIQELESQAVVEAESWREQQQDLLEQQAQQSRAKQEVEAELERCKQELQYVEEEQHRTKSSLQSRIKDREDEIQKLRNQLTNKALSNSSQA-ELEGRLHQLTETLIQKQTMLEALGTEKSSLIFQLERLEQQLKSVQGGQSSGPHINMAAVEGPGARQRNTPVLFSDHDSSATG-----VYGKVREAASTIDRFSIRLGIFLRRYPAARVFVIVYMALLHLWVMIVLLTYTPEMH 761          
BLAST of Golgin A5 vs. Ensembl Cavefish
Match: golga5 (golgin A5 [Source:NCBI gene;Acc:103034987])

HSP 1 Score: 210.69 bits (535), Expect = 5.129e-58
Identity = 158/552 (28.62%), Postives = 294/552 (53.26%), Query Frame = 3
Query:  396 SGSDILKSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEI----QLINSRKSD---------------SVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQK-----PNI----ISGMNADRRGN-IGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIH 1964
            S  D  + + P++     ++  +         + E     + +N  +EN+LLRSE++SLNQE++SL+QR   + E+  + R + +K + +    D+  R+L S+ DD+ E +  KD +LAVL   +    QL+ +R S                S G++  +  +   ++ +   +  LK + +   +++ E     + ++  +  LA+++ + E+   ++++R + L +Q   S       + +L +YK KAS ILQ KEK+I+SLK ++    D    G+ +  +  EL  +RHE +L REEI + + +++    ++QEL+ Q   E ES R+    L EQ  ++ + +++V+ +  +  +E ++++E+  R K+     +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   +  SL  +LER E +L  +Q      P+I    + G  A +R   +   + D  A       V   ++ A +++D+ S+++GIFLRRYP AR+F I+Y  +LH WV+ V LTY PE+H
Sbjct:  220 SARDFSQGDTPESSDSGLAAALEPPPATVDSAAPEEQVGQVLSNLRLENQLLRSEVTSLNQEMASLVQRAKNTQEELNQARARSDKWNSEQSRTDRAVRDLRSQVDDLTEALSAKDGQLAVLKVRLDEADQLLKARSSALEEAQNERSRILQDHSEGNSLQSQALQTMQDCVRESEAALKREQDSYRQMQSEFAARLAKIEAERQTLAESLTSAERRVTEERQRAEELQQQAKSSRSAADYAKQELHDYKNKASRILQSKEKLISSLKESSG--LDVLDGGAGAAGV--ELEELRHEKELQREEIQKLQAQIQSLRSEIQELESQAVVEAESWREQQQDLLEQQAQQSRAKQEVEAELERCKQELQYVEEEQHRTKSSLQSRIKDREDEIQKLRNQLTNKALSNSSQA-ELEGRLHQLTETLIQKQTMLEALGTEKSSLIFQLERLEQQLKSVQGGQSSGPHINMAAVEGPGARQRNTPVLFSDHDSSATG-----VYGKVREAASTIDRFSIRLGIFLRRYPAARVFVIVYMALLHLWVMIVLLTYTPEMH 761          
BLAST of Golgin A5 vs. Ensembl Nematostella
Match: EDO46852 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP50])

HSP 1 Score: 95.5153 bits (236), Expect = 2.380e-20
Identity = 100/347 (28.82%), Postives = 169/347 (48.70%), Query Frame = 3
Query: 1023 TEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNADRRGN---IGMGNSD---------------FIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSNLNIPNAPNVPKG 2009
            T  L M+     A + ++K+YK KA  ILQ K+K+I++L+    G E   S G+ +     E   +  E D L+EE+ + R  +E    DLQ+ +     E +  ++ ++ LE  L+ E++ RE  + + RQ   + R  Q +  R K    + +  ++ EI R++  I+TK    T +  ELE RVR+LT+ LIQKQ V+++   + +SL ++LER E +   +Q        +A+R  N   + MG++D                +   + D   ++ +K AVN +DK  + +                       WVL V +TY+PEIH+S     N+P +P+G
Sbjct:  462 TAALKMAKANLEAARQEMKDYKEKAGRILQAKDKVISTLREGKQGDE---SMGAVTS---AEFDEVCQERDALKEELNQTRYRMEQVKTDLQDAEQHQQAEADIAQEKVEGLESALDEERKRREACEQEIRQHMEDLRFSQSELQRSKTSLMNQIQERETEIQRLKNQIATKALTSTSEA-ELENRVRALTENLIQKQTVIEALSTEKNSLVLQLERLEQQYRDVQ-------ASANRHMNATAMHMGDADDSDDNTLSRVKSIASVMPSQIND---SRRVKRAVNEIDKCRVLLH---------------------VWVLVVLMTYKPEIHTS-----NSPGLPQG 765          

HSP 2 Score: 55.0694 bits (131), Expect = 9.221e-8
Identity = 59/212 (27.83%), Postives = 97/212 (45.75%), Query Frame = 3
Query:  153 LDSSAAQALNKSQDNLDKNLQYNRKTEPSVIKEYDRFSQRGIDNYSGDSIRSLPLKKSLNKVSANPDENLFQFNHNS-KMPRSGSDILKSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQLIN 785
            L+S+A  A  K + +LD        +  S+ K  +  SQ  ID+  GD       +  + + S   D +L      S   P S  +I  ++ P + +    S  +     +   +D + N+ +      ENKLLR E+SSLN+E+ S LQR   +++  +     L+    QL   +   R+L   +DD NE +  KD +LAVL   IQ ++
Sbjct:  104 LNSNAPSAKEKKRSSLD--------SPNSIRKSIESPSQTSIDSRDGD-------EHVVTETSTPADISLRSTPEPSHPTPPSTLNIDPTHEPPSQTMEHESPNQAAPAVHHPGNDRVSNLEL------ENKLLRKEVSSLNEEMVSQLQRAKDAEKRAQETDRHLDHAQQQLSINEGIIRQLRQAEDDFNEALSAKDSQLAVLRVRIQEVD 294          
BLAST of Golgin A5 vs. Ensembl Medaka
Match: golga5 (golgin A5 [Source:NCBI gene;Acc:101164110])

HSP 1 Score: 209.92 bits (533), Expect = 7.478e-58
Identity = 149/502 (29.68%), Postives = 276/502 (54.98%), Query Frame = 3
Query:  534 IENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEI----QLINSRKSD---------------SVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQK-PNIISGMNADRRGNIGMG----NSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHS 1967
            +EN+LLRSE++SLNQE++S++QR     E+  + R + ++ + +    D+ +R+L S+ DD++E +  KD +LAVL   +    QL+ SR +                + GS+ ++  +   + ++   ++ ++ + E   +++ E       L+  +  LA+ +   E+   +D+ R+D L + +  +     + + + ++YK KA+ ILQ KEK+I SLK   +G+    +  S +  L  E+  +RHE +L REEI + + ++     ++Q+L+ Q   E ES R+    L+EQ   + + + +++ +  +  +E ++L+E++ R K      +  +++EI ++R  ++ K  + + Q  ELE R+  LT+TLIQKQ +L++   +  SL  +LER E +L   Q  P+    +N    G  G G    NS  +  +   P V   ++ A +++D+ S+++GIFLRRYP AR+F I+Y  +LH WV+ V LTY PE+H 
Sbjct:  249 LENQLLRSEVASLNQEMASVIQRAKDLQEELNQARLRADRWNSEQAQKDRAFRDLRSQVDDLSEALSAKDGQLAVLKVRLDEADQLLKSRNAALEEAQRETSRIMQDHTEGSSMNSQALETMQERLREAEKAVRREQESYRQMQTEYAGRMGKLEAERQTLAEALTAAERRAAEDRLRVDELQQAVRSAKAAAESAKQEFQDYKSKATRILQSKEKLINSLK---EGSGLDVTDSSRTTVL--EMEALRHEKELQREEIQKLQGQVSTLRAEIQDLEAQALAEAESWREQQMHLQEQEAAQSRAKRELEAEMERCRQELQYLEEEHHRTKTSLQSRIKDREDEIQKLRNQLTNKTLSSSSQT-ELENRLHQLTETLIQKQTMLEALGTEKSSLVFQLERLEQQLKSSQGGPSGGPAINMS--GLEGPGARQRNSPVLFSDHDAPGVYGKVRKAASTIDRFSIRLGIFLRRYPAARMFVILYMAVLHLWVMIVLLTYTPEMHG 742          
BLAST of Golgin A5 vs. Planmine SMEST
Match: SMESG000002765.1 (SMESG000002765.1)

HSP 1 Score: 1210.67 bits (3131), Expect = 0.000e+0
Identity = 637/637 (100.00%), Postives = 637/637 (100.00%), Query Frame = 3
Query:  102 MSWISDLAGKAENFLNNLDSSAAQALNKSQDNLDKNLQYNRKTEPSVIKEYDRFSQRGIDNYSGDSIRSLPLKKSLNKVSANPDENLFQFNHNSKMPRSGSDILKSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQLINSRKSDSVGSTADANLISDHRNKIIXXXXXXXXXXXXXXXXXXXXXNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNXXXXXXXXXXXXXXXXXVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSNLNIPNAPNVPKGN 2012
            MSWISDLAGKAENFLNNLDSSAAQALNKSQDNLDKNLQYNRKTEPSVIKEYDRFSQRGIDNYSGDSIRSLPLKKSLNKVSANPDENLFQFNHNSKMPRSGSDILKSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQLINSRKSDSVGSTADANLISDHRNKIILLDRELKLKSELLDKLEGEKLNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNLDLLEEQLEREKQLREDVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSNLNIPNAPNVPKGN
Sbjct:    1 MSWISDLAGKAENFLNNLDSSAAQALNKSQDNLDKNLQYNRKTEPSVIKEYDRFSQRGIDNYSGDSIRSLPLKKSLNKVSANPDENLFQFNHNSKMPRSGSDILKSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLLRSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELISEKDDMNETMKVKDQKLAVLHSEIQLINSRKSDSVGSTADANLISDHRNKIILLDRELKLKSELLDKLEGEKLNWQSSLDDSKIKLAQTVNNYEKSRVDDKRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGANDGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQELDHQMHTETESLRKNLDLLEEQLEREKQLREDVDTDYRQLTRENRHLQEKYMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDTLIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNADRRGNIGMGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFIIYTLILHFWVLFVFLTYQPEIHSSNLNIPNAPNVPKGN 637          
The following BLAST results are available for this feature:
BLAST of Golgin A5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
GOLGA59.114e-5530.73golgin A5 [Source:HGNC Symbol;Acc:HGNC:4428][more]
back to top
BLAST of Golgin A5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T24B1.13.380e-1625.86Golgin-84 [Source:UniProtKB/Swiss-Prot;Acc:P90970... [more]
back to top
BLAST of Golgin A5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Golgin841.127e-1827.22gene:FBgn0039188 transcript:FBtr0084629[more]
back to top
BLAST of Golgin A5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
golga51.242e-6031.90golgin A5 [Source:NCBI gene;Acc:406720][more]
back to top
BLAST of Golgin A5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde4d2.124e-5831.15phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1... [more]
pde4d5.748e-5831.62phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1... [more]
pde4d9.364e-5831.56phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1... [more]
pde4d5.794e-5431.05phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1... [more]
pde4d4.114e-4630.53phosphodiesterase 4D [Source:Xenbase;Acc:XB-GENE-1... [more]
back to top
BLAST of Golgin A5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Golga54.291e-5730.13golgi autoantigen, golgin subfamily a, 5 [Source:M... [more]
Golga54.291e-5730.13golgi autoantigen, golgin subfamily a, 5 [Source:M... [more]
Golga54.236e-1431.43golgi autoantigen, golgin subfamily a, 5 [Source:M... [more]
back to top
BLAST of Golgin A5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7SXE4|GOGA5_DANRE7.260e-5931.70Golgin subfamily A member 5 OS=Danio rerio OX=7955... [more]
sp|Q6GNT7|GOGA5_XENLA1.442e-5731.68Golgin subfamily A member 5 OS=Xenopus laevis OX=8... [more]
sp|Q9QYE6|GOGA5_MOUSE3.002e-5630.13Golgin subfamily A member 5 OS=Mus musculus OX=100... [more]
sp|Q8TBA6|GOGA5_HUMAN4.377e-5430.73Golgin subfamily A member 5 OS=Homo sapiens OX=960... [more]
sp|Q3ZU82|GOGA5_RAT6.963e-5030.18Golgin subfamily A member 5 OS=Rattus norvegicus O... [more]
back to top
BLAST of Golgin A5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NIZ94.203e-7331.91Uncharacterized protein OS=Paragonimus westermani ... [more]
C3XR611.644e-7230.82Uncharacterized protein (Fragment) OS=Branchiostom... [more]
A0A504YVB32.592e-7130.07Golgin subfamily A member 5 OS=Fasciola gigantica ... [more]
A0A075AEM53.170e-6929.13Uncharacterized protein OS=Opisthorchis viverrini ... [more]
G1NKD19.258e-6329.44Golgin A5 OS=Meleagris gallopavo OX=9103 GN=GOLGA5... [more]
back to top
BLAST of Golgin A5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
golga54.885e-5828.62golgin A5 [Source:NCBI gene;Acc:103034987][more]
golga55.129e-5828.62golgin A5 [Source:NCBI gene;Acc:103034987][more]
golga55.129e-5828.62golgin A5 [Source:NCBI gene;Acc:103034987][more]
back to top
BLAST of Golgin A5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Golgin A5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Golgin A5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO468522.380e-2028.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Golgin A5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
golga57.478e-5829.68golgin A5 [Source:NCBI gene;Acc:101164110][more]
back to top
BLAST of Golgin A5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002765.10.000e+0100.00SMESG000002765.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026514 ID=SMED30026514|Name=Golgin A5|organism=Schmidtea mediterranea sexual|type=transcript|length=2073bp
GTTAAATATACATTATAAGTTTAAAATTATTCCATAATAATTTACTAACA
TTAATTTATACTACATTTCTCAATAGTTTTTATAAAAAAGTTATTCTGGA
AATGTCTTGGATTAGTGATTTGGCAGGTAAAGCTGAAAATTTTCTCAATA
ATCTCGATAGCTCAGCTGCTCAAGCATTAAACAAGAGCCAAGATAATTTG
GATAAAAATTTACAGTACAATCGAAAAACGGAACCATCAGTTATCAAAGA
ATATGATAGATTTAGTCAACGTGGTATAGATAATTACAGTGGTGATTCTA
TTAGGTCTTTGCCTTTAAAAAAATCCTTGAATAAGGTATCTGCTAATCCT
GATGAAAATCTCTTTCAATTTAATCATAATTCTAAAATGCCTCGAAGTGG
ATCTGACATTCTAAAATCTAATAATCCTGACACTTATTCGGATAACTGTT
CCAGTGGATATAAAACCGTGAATGATGACTATGTGGATAAATCTGATGAG
TTAATCAATATGAACATAGATAATAATCCATCCATTGAAAATAAATTGCT
TCGAAGTGAAATTTCTTCACTTAATCAAGAAATATCATCACTACTACAAA
GAAATCATAAATCAGATGAAGATAACAAACGCTTAAGAAATCAACTAGAA
AAGGTTTCCCATCAATTGCGGGATTGTGACAAAAAATATCGAGAATTAAT
CAGTGAAAAAGATGATATGAACGAAACAATGAAGGTAAAAGATCAAAAAC
TAGCGGTTTTGCATTCGGAAATACAATTGATTAATTCCCGTAAATCAGAT
TCGGTGGGATCGACTGCCGATGCAAATTTAATCAGTGATCATCGGAATAA
AATAATTTTACTCGATCGAGAGCTGAAATTGAAAAGTGAACTTTTGGATA
AACTGGAAGGAGAGAAATTGAATTGGCAAAGCAGCCTCGATGACTCTAAA
ATTAAATTGGCGCAAACTGTCAACAATTACGAGAAATCCCGAGTTGACGA
TAAACGCCGCATCGATATATTAACGGAGCAATTGAATATGTCCAATCAGA
AAAGGGTGGCTATTCAAAATGACCTGAAAGAGTACAAAGTAAAAGCGTCA
AATATTCTCCAAATGAAAGAAAAGATCATTGCTAGTCTGAAAGGAGCCAA
TGACGGAACTGAAGACAAATATTCATTTGGCTCGTATTCAGAGGATTTAC
AACAAGAATTGTCCAATATGCGACACGAATGCGATTTATTGAGAGAAGAA
ATCGCTAGATGTCGCGTTGAGTTGGAACACAGAGATTTTGATTTGCAGGA
GTTGGACCATCAAATGCACACCGAGACGGAATCGTTACGCAAGAATCTTG
ATTTACTAGAAGAACAATTAGAACGGGAAAAACAGCTTAGAGAGGACGTT
GATACAGATTACCGGCAATTAACACGTGAAAATCGGCATTTACAAGAGAA
ATATATGAGAGAAAAGGCAGATTTCCATGATCACTTGTCTGCCAAGGATG
AGGAAATCAATCGAATGAGACAGATGATATCGACGAAACAAACCAATCAA
ACCGATCAAGTTATGGAATTAGAAGCACGAGTCCGATCATTGACCGATAC
TCTCATTCAGAAACAAGCAGTTCTTGACTCGAACAAAGCAGATTACCATT
CATTACAAATTAGACTCGAACGTACTGAGATGGAGCTTAGTGTCTTACAG
AAGCCGAATATTATCTCTGGGATGAACGCTGATCGCCGAGGAAATATTGG
AATGGGAAATAGCGATTTCATTGCTATCAATATGCAGGATCCACCGGTAA
CAAAAAACCTCAAAACGGCTGTTAATAGTTTGGATAAATTAAGCTTGAAA
ATTGGAATATTTCTAAGACGCTATCCACCTGCTCGACTGTTCTTCATCAT
TTACACTTTGATCCTTCATTTCTGGGTGCTATTCGTCTTCCTCACTTATC
AGCCGGAAATTCATTCATCAAATTTAAATATTCCAAACGCACCAAATGTT
CCCAAGGGCAATTAATTGATTTACTAATGATTTCTTATTGACGGTGAATA
AATTATTTTATCCAATGAAAAAA
back to top

protein sequence of SMED30026514-orf-1

>SMED30026514-orf-1 ID=SMED30026514-orf-1|Name=SMED30026514-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=638bp
MSWISDLAGKAENFLNNLDSSAAQALNKSQDNLDKNLQYNRKTEPSVIKE
YDRFSQRGIDNYSGDSIRSLPLKKSLNKVSANPDENLFQFNHNSKMPRSG
SDILKSNNPDTYSDNCSSGYKTVNDDYVDKSDELINMNIDNNPSIENKLL
RSEISSLNQEISSLLQRNHKSDEDNKRLRNQLEKVSHQLRDCDKKYRELI
SEKDDMNETMKVKDQKLAVLHSEIQLINSRKSDSVGSTADANLISDHRNK
IILLDRELKLKSELLDKLEGEKLNWQSSLDDSKIKLAQTVNNYEKSRVDD
KRRIDILTEQLNMSNQKRVAIQNDLKEYKVKASNILQMKEKIIASLKGAN
DGTEDKYSFGSYSEDLQQELSNMRHECDLLREEIARCRVELEHRDFDLQE
LDHQMHTETESLRKNLDLLEEQLEREKQLREDVDTDYRQLTRENRHLQEK
YMREKADFHDHLSAKDEEINRMRQMISTKQTNQTDQVMELEARVRSLTDT
LIQKQAVLDSNKADYHSLQIRLERTEMELSVLQKPNIISGMNADRRGNIG
MGNSDFIAINMQDPPVTKNLKTAVNSLDKLSLKIGIFLRRYPPARLFFII
YTLILHFWVLFVFLTYQPEIHSSNLNIPNAPNVPKGN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: biological process
TermDefinition
GO:0007030Golgi organization
GO:0048193Golgi vesicle transport
Vocabulary: INTERPRO
TermDefinition
IPR019177Golgin_subfamily_A_member_5
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0042803protein homodimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 508..528
NoneNo IPR availableCOILSCoilCoilcoord: 147..209
NoneNo IPR availableCOILSCoilCoilcoord: 363..390
NoneNo IPR availableCOILSCoilCoilcoord: 409..457
NoneNo IPR availablePANTHERPTHR13815:SF5GOLGIN SUBFAMILY A MEMBER 5coord: 1..621
NoneNo IPR availableTMHMMTMhelixcoord: 594..616
IPR019177Golgin subfamily A member 5PFAMPF09787Golgin_A5coord: 321..621
e-value: 1.0E-74
score: 251.8
IPR019177Golgin subfamily A member 5PANTHERPTHR13815GOLGIN-84coord: 1..621