Prospero-like protein

Overview
NameProspero-like protein
Smed IDSMED30026498
Length (bp)1790
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Prospero-like protein (SMED30026498) t-SNE clustered cells

Violin plots show distribution of expression levels for Prospero-like protein (SMED30026498) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Prospero-like protein (SMED30026498) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Prospero-like protein (SMED30026498) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026498

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30026498SMESG000032751.1 SmedASXL_000673SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30026498SMESG000032751.1 dd_Smed_v4_22331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026498SMESG000032751.1 dd_Smed_v4_22331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30026498SMESG000032751.1 dd_Smed_v4_22331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026498SMESG000032751.1 dd_Smed_v4_22331_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30026498SMESG000032751.1 dd_Smed_v6_22331_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Prospero-like protein vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 182.185 bits (461), Expect = 1.642e-48
Identity = 85/158 (53.80%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  580 LSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 737          
BLAST of Prospero-like protein vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 182.185 bits (461), Expect = 1.642e-48
Identity = 85/158 (53.80%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  580 LSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 737          
BLAST of Prospero-like protein vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 182.185 bits (461), Expect = 1.642e-48
Identity = 85/158 (53.80%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  580 LSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 737          
BLAST of Prospero-like protein vs. Ensembl Human
Match: PROX1 (prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9459])

HSP 1 Score: 182.185 bits (461), Expect = 1.642e-48
Identity = 85/158 (53.80%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  580 LSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 737          
BLAST of Prospero-like protein vs. Ensembl Human
Match: PROX2 (prospero homeobox 2 [Source:HGNC Symbol;Acc:HGNC:26715])

HSP 1 Score: 164.466 bits (415), Expect = 5.002e-43
Identity = 77/151 (50.99%), Postives = 104/151 (68.87%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNW 1374
            L P HL+KAKLMF +TRYP+S +LK +FPD+ F +  T+Q++KWFSNFREFYY +MEK+ +++IS G+     L V    ELF+ L  H+NK    EVP  F+    +TL+EFF A S G++   SWKKPIYK I+KLD  +PE FK  ++
Sbjct:  440 LNPGHLKKAKLMFFFTRYPSSNLLKVYFPDVQFNRCITSQMIKWFSNFREFYYIQMEKSARQAISDGVTNPKMLVVLRNSELFQALNMHYNKGNDFEVPDCFLEIASLTLQEFFRAVSAGRDSDPSWKKPIYKIISKLDSDIPEIFKSSSY 590          
BLAST of Prospero-like protein vs. Ensembl Celegans
Match: pros-1 (Homeobox protein prospero homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:P34522])

HSP 1 Score: 189.119 bits (479), Expect = 3.322e-52
Identity = 87/155 (56.13%), Postives = 118/155 (76.13%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            LTP+HLRKAKLMF YTRYPNS +LK++FPDI F K NTAQLVKWFSNFREFYY++MEK  +++++ GI   +++FV+++ ELFK L TH+N+N  I+ P   +  VQ TLREF +A   GK++  SWKK IYK I +L+  +P+FFK+ N++  L
Sbjct:  438 LTPMHLRKAKLMFFYTRYPNSNLLKSYFPDIRFNKNNTAQLVKWFSNFREFYYNQMEKFARQALAEGITDRNDIFVSKDSELFKVLNTHYNRNNHIKAPDRLVFVVQETLREFHDAIKQGKDIEPSWKKTIYKVINRLEDQIPDFFKEPNFLERL 592          
BLAST of Prospero-like protein vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304607)

HSP 1 Score: 197.208 bits (500), Expect = 3.094e-53
Identity = 88/160 (55.00%), Postives = 117/160 (73.12%), Query Frame = 1
Query:  907 PKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            P   TLTP+HLRKAKLMF + RYP+S +LK +FPDI F K NTAQLVKWFSNFREFYY +MEK  +++++ GIK   +L +  + EL++ L  H+N+N  IEVP+ F   V+ TLREFF A   GK+  QSWKK IYK I+++D P+PE+FK  N++ +L
Sbjct: 1214 PTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1373          
BLAST of Prospero-like protein vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304605)

HSP 1 Score: 194.897 bits (494), Expect = 2.052e-52
Identity = 87/156 (55.77%), Postives = 116/156 (74.36%), Query Frame = 1
Query:  919 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            TLTP+HLRKAKLMF + RYP+S +LK +FPDI F K NTAQLVKWFSNFREFYY +MEK  +++++ GIK   +L +  + EL++ L  H+N+N  IEVP+ F   V+ TLREFF A   GK+  QSWKK IYK I+++D P+PE+FK  N++ +L
Sbjct: 1247 TLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1402          
BLAST of Prospero-like protein vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304606)

HSP 1 Score: 194.897 bits (494), Expect = 2.189e-52
Identity = 88/160 (55.00%), Postives = 117/160 (73.12%), Query Frame = 1
Query:  907 PKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            P   TLTP+HLRKAKLMF + RYP+S +LK +FPDI F K NTAQLVKWFSNFREFYY +MEK  +++++ GIK   +L +  + EL++ L  H+N+N  IEVP+ F   V+ TLREFF A   GK+  QSWKK IYK I+++D P+PE+FK  N++ +L
Sbjct: 1375 PTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1534          
BLAST of Prospero-like protein vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304604)

HSP 1 Score: 194.897 bits (494), Expect = 2.381e-52
Identity = 88/160 (55.00%), Postives = 117/160 (73.12%), Query Frame = 1
Query:  907 PKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            P   TLTP+HLRKAKLMF + RYP+S +LK +FPDI F K NTAQLVKWFSNFREFYY +MEK  +++++ GIK   +L +  + EL++ L  H+N+N  IEVP+ F   V+ TLREFF A   GK+  QSWKK IYK I+++D P+PE+FK  N++ +L
Sbjct: 1675 PTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1834          
BLAST of Prospero-like protein vs. Ensembl Fly
Match: pros (gene:FBgn0004595 transcript:FBtr0304603)

HSP 1 Score: 194.512 bits (493), Expect = 2.871e-52
Identity = 88/160 (55.00%), Postives = 117/160 (73.12%), Query Frame = 1
Query:  907 PKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            P   TLTP+HLRKAKLMF + RYP+S +LK +FPDI F K NTAQLVKWFSNFREFYY +MEK  +++++ GIK   +L +  + EL++ L  H+N+N  IEVP+ F   V+ TLREFF A   GK+  QSWKK IYK I+++D P+PE+FK  N++ +L
Sbjct: 1514 PTSSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1673          
BLAST of Prospero-like protein vs. Ensembl Zebrafish
Match: prox1a (prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980526-397])

HSP 1 Score: 191.045 bits (484), Expect = 6.301e-52
Identity = 100/215 (46.51%), Postives = 132/215 (61.40%), Query Frame = 1
Query:  751 RTKVTDSRLMKRVSIEATTNMHVADESVLETCIDTRCXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            RTK++ + L    SI  T   H  +E +  + I + C      S     +    +  L+P HL+KAKLMF YTRYP+S MLK FF D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  S EL V+ +CELF+ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  528 RTKMSSNHLSHHRSISPT---HPGNEGLSLSLIKSECGDLQDMSDISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGSEELSVSRDCELFRALNMHYNKANDFEVPERFLEVAQITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 739          
BLAST of Prospero-like protein vs. Ensembl Zebrafish
Match: prox1a (prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980526-397])

HSP 1 Score: 191.045 bits (484), Expect = 6.301e-52
Identity = 100/215 (46.51%), Postives = 132/215 (61.40%), Query Frame = 1
Query:  751 RTKVTDSRLMKRVSIEATTNMHVADESVLETCIDTRCXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            RTK++ + L    SI  T   H  +E +  + I + C      S     +    +  L+P HL+KAKLMF YTRYP+S MLK FF D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  S EL V+ +CELF+ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  528 RTKMSSNHLSHHRSISPT---HPGNEGLSLSLIKSECGDLQDMSDISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGSEELSVSRDCELFRALNMHYNKANDFEVPERFLEVAQITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 739          
BLAST of Prospero-like protein vs. Ensembl Zebrafish
Match: prox2 (prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-081003-3])

HSP 1 Score: 168.318 bits (425), Expect = 1.176e-44
Identity = 78/154 (50.65%), Postives = 109/154 (70.78%), Query Frame = 1
Query:  916 YTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWM 1377
            ++LTP HL+KAKLMF YTRYP+S +LKNFFPD+ F +  T+QL+KWFSNFREFYY +MEK  +++I  G+    ++ V+ E ELF+ L  H+NK    +VP  F+   ++TL+EF+ A S+ K+   SWKK IYK I KLD  +PE FK  +++
Sbjct:  430 HSLTPNHLKKAKLMFFYTRYPSSNLLKNFFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIIDGVTDVKDISVSRESELFRALNMHYNKANDFQVPDRFLEVAEVTLQEFYSAISLSKDSDPSWKKAIYKVICKLDSDVPEEFKSPSYL 583          
BLAST of Prospero-like protein vs. Ensembl Zebrafish
Match: prox2 (prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-081003-3])

HSP 1 Score: 167.162 bits (422), Expect = 3.448e-44
Identity = 78/152 (51.32%), Postives = 107/152 (70.39%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWM 1377
            LTP HL+KAKLMF YTRYP+S +LKNFFPD+ F +  T+QL+KWFSNFREFYY +MEK  +++I  G+    ++ V+ E ELF+ L  H+NK    +VP  F+   ++TL+EF+ A S+ K+   SWKK IYK I KLD  +PE FK  +++
Sbjct:  431 LTPNHLKKAKLMFFYTRYPSSNLLKNFFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIIDGVTDVKDISVSRESELFRALNMHYNKANDFQVPDRFLEVAEVTLQEFYSAISLSKDSDPSWKKAIYKVICKLDSDVPEEFKSPSYL 582          
BLAST of Prospero-like protein vs. Ensembl Zebrafish
Match: prox3 (prospero homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-050107-3])

HSP 1 Score: 145.591 bits (366), Expect = 2.032e-36
Identity = 68/150 (45.33%), Postives = 100/150 (66.67%), Query Frame = 1
Query:  919 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSE--LFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFK 1362
             L+P HL+KAKLMF YTRYP+S  LK +FPD+ F +  T+QL+KWFSNFREF+Y +ME+  +++    +  + E  L +  + EL++ L  H+NK+   +VP+ F+   ++ LREFF A   G++    WKK IYK I KLD P+P+ F+
Sbjct:  493 GLSPCHLKKAKLMFFYTRYPSSSTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAAREVLTSARERALRLGRDTELYRILNMHYNKSNDYQVPERFVEISEVALREFFTAIQSGRDADPCWKKSIYKIICKLDSPVPDSFR 642          
BLAST of Prospero-like protein vs. Ensembl Xenopus
Match: PROX1 (prospero homeobox 1 [Source:NCBI gene;Acc:100134995])

HSP 1 Score: 181.415 bits (459), Expect = 2.713e-48
Identity = 85/158 (53.80%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK FF D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ GI  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +P+ F+  N + EL  E
Sbjct:  582 LSPNHLKKAKLMFFYTRYPSSNMLKTFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGITSTEELCITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPDIFRSPNCLQELLHE 739          
BLAST of Prospero-like protein vs. Ensembl Mouse
Match: Prox1 (prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:97772])

HSP 1 Score: 182.185 bits (461), Expect = 1.053e-48
Identity = 85/158 (53.80%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  580 LSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 737          
BLAST of Prospero-like protein vs. Ensembl Mouse
Match: Prox1 (prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:97772])

HSP 1 Score: 182.185 bits (461), Expect = 1.053e-48
Identity = 85/158 (53.80%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  580 LSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 737          
BLAST of Prospero-like protein vs. Ensembl Mouse
Match: Prox1 (prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:97772])

HSP 1 Score: 182.185 bits (461), Expect = 1.053e-48
Identity = 85/158 (53.80%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  580 LSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 737          
BLAST of Prospero-like protein vs. Ensembl Mouse
Match: Prox2 (prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:1920672])

HSP 1 Score: 166.392 bits (420), Expect = 6.421e-44
Identity = 78/155 (50.32%), Postives = 107/155 (69.03%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            L+P HL+KAKLMF +TRYP+S +LK +FPD+ F +  T+Q++KWFSNFREFYY +MEK  ++++S GI  +  L V  + ELF+ L TH+NK    EVP  F+    +TL+EFF A   GK+   SWKKPIYK I+KLD  +PE  K  +++  L
Sbjct:  436 LSPGHLKKAKLMFFFTRYPSSSLLKAYFPDVQFNRCITSQMIKWFSNFREFYYIQMEKYARQALSDGITNAQALAVLRDSELFRVLNTHYNKGNDFEVPDCFLEIAALTLKEFFRAVLAGKDSDPSWKKPIYKVISKLDSDVPEMLKSPSFLPGL 590          
BLAST of Prospero-like protein vs. Ensembl Mouse
Match: Prox2 (prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:1920672])

HSP 1 Score: 166.392 bits (420), Expect = 6.421e-44
Identity = 78/155 (50.32%), Postives = 107/155 (69.03%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            L+P HL+KAKLMF +TRYP+S +LK +FPD+ F +  T+Q++KWFSNFREFYY +MEK  ++++S GI  +  L V  + ELF+ L TH+NK    EVP  F+    +TL+EFF A   GK+   SWKKPIYK I+KLD  +PE  K  +++  L
Sbjct:  436 LSPGHLKKAKLMFFFTRYPSSSLLKAYFPDVQFNRCITSQMIKWFSNFREFYYIQMEKYARQALSDGITNAQALAVLRDSELFRVLNTHYNKGNDFEVPDCFLEIAALTLKEFFRAVLAGKDSDPSWKKPIYKVISKLDSDVPEMLKSPSFLPGL 590          
BLAST of Prospero-like protein vs. UniProt/SwissProt
Match: sp|P34522|PROS1_CAEEL (Homeobox protein prospero homolog 1 OS=Caenorhabditis elegans OX=6239 GN=pros-1 PE=2 SV=2)

HSP 1 Score: 189.119 bits (479), Expect = 4.226e-51
Identity = 87/155 (56.13%), Postives = 118/155 (76.13%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            LTP+HLRKAKLMF YTRYPNS +LK++FPDI F K NTAQLVKWFSNFREFYY++MEK  +++++ GI   +++FV+++ ELFK L TH+N+N  I+ P   +  VQ TLREF +A   GK++  SWKK IYK I +L+  +P+FFK+ N++  L
Sbjct:  438 LTPMHLRKAKLMFFYTRYPNSNLLKSYFPDIRFNKNNTAQLVKWFSNFREFYYNQMEKFARQALAEGITDRNDIFVSKDSELFKVLNTHYNRNNHIKAPDRLVFVVQETLREFHDAIKQGKDIEPSWKKTIYKVINRLEDQIPDFFKEPNFLERL 592          
BLAST of Prospero-like protein vs. UniProt/SwissProt
Match: sp|Q9U6A1|PROS_DROVI (Homeobox protein prospero OS=Drosophila virilis OX=7244 GN=pros PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.454e-50
Identity = 87/156 (55.77%), Postives = 116/156 (74.36%), Query Frame = 1
Query:  919 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            TLTP+HLRKAKLMF + RYP+S +LK +FPDI F K NTAQLVKWFSNFREFYY +MEK  +++++ GIK   +L +  + EL++ L  H+N+N  IEVP+ F   V+ TLREFF A   GK+  QSWKK IYK I+++D P+PE+FK  N++ +L
Sbjct: 1400 TLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVEQTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1555          
BLAST of Prospero-like protein vs. UniProt/SwissProt
Match: sp|P29617|PROS_DROME (Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3)

HSP 1 Score: 191.43 bits (485), Expect = 3.073e-50
Identity = 87/156 (55.77%), Postives = 116/156 (74.36%), Query Frame = 1
Query:  919 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLEL 1386
            TLTP+HLRKAKLMF + RYP+S +LK +FPDI F K NTAQLVKWFSNFREFYY +MEK  +++++ GIK   +L +  + EL++ L  H+N+N  IEVP+ F   V+ TLREFF A   GK+  QSWKK IYK I+++D P+PE+FK  N++ +L
Sbjct: 1547 TLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTEGIKTPDDLLIAGDSELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQL 1702          
BLAST of Prospero-like protein vs. UniProt/SwissProt
Match: sp|Q91018|PROX1_CHICK (Prospero homeobox protein 1 OS=Gallus gallus OX=9031 GN=PROX1 PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 4.197e-48
Identity = 90/192 (46.88%), Postives = 121/192 (63.02%), Query Frame = 1
Query:  820 ADESVLETCIDTRCXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            A E +  + I + C      S     +    +  L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  545 AAEGLSLSLIKSECGDLQDMSEISPYSGSAMQEGLSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 736          
BLAST of Prospero-like protein vs. UniProt/SwissProt
Match: sp|P48437|PROX1_MOUSE (Prospero homeobox protein 1 OS=Mus musculus OX=10090 GN=Prox1 PE=1 SV=2)

HSP 1 Score: 182.185 bits (461), Expect = 7.367e-48
Identity = 85/158 (53.80%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK +F D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL +T +CEL++ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  580 LSPNHLKKAKLMFFYTRYPSSNMLKTYFSDVKFNRCITSQLIKWFSNFREFYYIQMEKYARQAINDGVTSTEELSITRDCELYRALNMHYNKANDFEVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 737          
BLAST of Prospero-like protein vs. TrEMBL
Match: H9CXU6 (PROX-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 1.320e-94
Identity = 162/236 (68.64%), Postives = 193/236 (81.78%), Query Frame = 1
Query:  724 QCSTSKRRKRTKVTDSRLMKR-VSIEATTNMHVADESVLETC----IDTRCXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKEENGASHS 1416
            + S++++RKRTKVTD+RL +R  S+    N+H  + ++ ET          S+SSQSS SE+   DPK+YTLTPIHLRKAKLMFLYTRYPNSQMLK++FPDI FYKQNTAQLVKWFSNFREFYY+EMEKAVQR++S+GI+ + ++ VT E ELFKNLMTHFNK +QI VP EF+ TVQITLREFFEA S GKNLHQSWKKPIYK IAKLDQ LPEFFKD NWM+ELAK+EN + +S
Sbjct:  247 KSSSNRKRKRTKVTDTRLPRRNTSLGNFPNLH--ESTIPETTRFSNYLNPPSNSSQSSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLNS 480          
BLAST of Prospero-like protein vs. TrEMBL
Match: A0A183AEI2 (Prospero domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5367 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 2.265e-65
Identity = 102/162 (62.96%), Postives = 130/162 (80.25%), Query Frame = 1
Query:  907 PKKY-TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELA 1389
            PK+Y TLTP+HLRKAKLMF YTRYPNS ++K +FPD+ FYK NTAQLVKWFSNFREFYY +MEK  + +IS G++ + E+ VT + EL++ L  H+N+N+Q+EVP+ F I V+ TLREFF A   GK+  QSWKKPIYK IA++DQP+PEFFK+ NWM +LA
Sbjct:    7 PKRYYTLTPVHLRKAKLMFFYTRYPNSTLIKMYFPDVKFYKNNTAQLVKWFSNFREFYYIQMEKFARVAISEGVRSAEEIHVTTDSELYRALNLHYNRNQQLEVPEHFRIVVEATLREFFNALMTGKDAEQSWKKPIYKIIARMDQPVPEFFKNPNWMEQLA 168          
BLAST of Prospero-like protein vs. TrEMBL
Match: A0A074ZP01 (Prospero domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_07444 PE=4 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.230e-64
Identity = 99/157 (63.06%), Postives = 125/157 (79.62%), Query Frame = 1
Query:  919 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELA 1389
            TLTP+HLRKAKLMF YTRYPNS ++K +FPD+ FYK NTAQLVKWFSNFREFYY +MEK  + +IS G++ + E+ VT + EL++ L  H+N+N+Q+EVP  F I V+ TLREFF A   GK+  QSWKKPIYK IA++DQP+PEFFK+ NWM +LA
Sbjct:   37 TLTPVHLRKAKLMFFYTRYPNSTLIKMYFPDVKFYKNNTAQLVKWFSNFREFYYIQMEKFARVAISEGVRSADEIHVTTDSELYRALNLHYNRNQQLEVPDHFRIVVEATLREFFNALMTGKDTEQSWKKPIYKIIARMDQPVPEFFKNPNWMEQLA 193          
BLAST of Prospero-like protein vs. TrEMBL
Match: A0A1S8WHF4 (Prospero domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_10339 PE=4 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 1.405e-64
Identity = 99/157 (63.06%), Postives = 125/157 (79.62%), Query Frame = 1
Query:  919 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELA 1389
            TLTP+HLRKAKLMF YTRYPNS ++K +FPD+ FYK NTAQLVKWFSNFREFYY +MEK  + +IS G++ + E+ VT + EL++ L  H+N+N+Q+EVP  F I V+ TLREFF A   GK+  QSWKKPIYK IA++DQP+PEFFK+ NWM +LA
Sbjct:   32 TLTPVHLRKAKLMFFYTRYPNSTLIKMYFPDVKFYKNNTAQLVKWFSNFREFYYIQMEKFARVAISEGVRSADEIHVTTDSELYRALNLHYNRNQQLEVPDHFRIVVEATLREFFNALMTGKDTEQSWKKPIYKIIARMDQPVPEFFKNPNWMEQLA 188          
BLAST of Prospero-like protein vs. TrEMBL
Match: A0A4S2KFM3 (Prospero domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010997 PE=4 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 2.522e-59
Identity = 99/157 (63.06%), Postives = 126/157 (80.25%), Query Frame = 1
Query:  919 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELA 1389
            TLTP+HLRKAKLMF YTRYPNS ++K +FPD+ FYK NTAQLVKWFSNFREFYY +MEK  + +IS G++ + E+ VT + EL++ L  H+N+N+Q+EVP  F I V+ TLREFF+A   GK+  QSWKKPIYK IA++DQP+PEFFK+ NWM +LA
Sbjct:  817 TLTPVHLRKAKLMFFYTRYPNSTLIKMYFPDVKFYKNNTAQLVKWFSNFREFYYIQMEKFARVAISEGVRTADEIHVTTDSELYRALNLHYNRNQQLEVPDHFRIVVEATLREFFKALMTGKDTEQSWKKPIYKIIARMDQPVPEFFKNPNWMEQLA 973          
BLAST of Prospero-like protein vs. Ensembl Cavefish
Match: prox1a (prospero homeobox protein 1 [Source:NCBI gene;Acc:103040734])

HSP 1 Score: 181.03 bits (458), Expect = 1.938e-48
Identity = 86/158 (54.43%), Postives = 111/158 (70.25%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK FF D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  S EL V+ +CEL++ L  H+NK    EVP+ F+   QITL+EFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  583 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVAGSEELTVSRDCELYRALNMHYNKANDFEVPERFLEVAQITLQEFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 740          
BLAST of Prospero-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000012572.2 (prospero homeobox protein 1-like [Source:NCBI gene;Acc:103022569])

HSP 1 Score: 179.489 bits (454), Expect = 1.005e-47
Identity = 94/215 (43.72%), Postives = 129/215 (60.00%), Query Frame = 1
Query:  751 RTKVTDSRLMKRVSIEATTNMHVADESVLETCIDTRCXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            RTK+  +  +      + T+     ES+  + I + C      S     +    +  L+P HL+KAKLMF YTRYP+S MLK FF D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + E+ V+ + ELF+ L  H+NK    EVP+ F+   QITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  570 RTKMASNHHLGHHRSCSPTHPGSTAESLSLSLIKSECGDLQDMSDISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGADEISVSRDSELFRALNMHYNKANDFEVPERFLEVAQITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 784          
BLAST of Prospero-like protein vs. Ensembl Cavefish
Match: prox2 (prospero homeobox 2 [Source:NCBI gene;Acc:103029539])

HSP 1 Score: 164.851 bits (416), Expect = 4.117e-43
Identity = 78/152 (51.32%), Postives = 105/152 (69.08%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWM 1377
            LTP HL+KAKLMF YTRYP+S +LK FFPD+ F +  T+QL+KWFSNFREFYY +MEK  +++I  G+    ++ VT + ELF+ L  H+NK    +VP  F+   +ITL EF+ A S+ K+   SWKK IYK I KLD  +PE FK  +++
Sbjct:  516 LTPNHLKKAKLMFFYTRYPSSNVLKTFFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIVDGVSDVKDMAVTRDSELFRALNMHYNKANDFQVPDRFLEVAEITLHEFYNAISLNKDSDPSWKKAIYKVICKLDSDVPEEFKSPSYL 667          
BLAST of Prospero-like protein vs. Ensembl Cavefish
Match: prox3 (prospero homeobox protein 1-like [Source:NCBI gene;Acc:103040122])

HSP 1 Score: 149.828 bits (377), Expect = 7.511e-38
Identity = 70/149 (46.98%), Postives = 100/149 (67.11%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSE--LFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFK 1362
            L+P HL+KAKLMF YTRYP+S  LK +FPD+ F +  T+QL+KWFSNFREF+Y +ME+  +++   G+  S +  L ++   ELF+ L  H+NK+   +VP  F+   ++ LREFF A   G++    WKK IYK I KLD P+P+ F+
Sbjct:  519 LSPCHLKKAKLMFFYTRYPSSNTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAAREGLPTSRDRVLRLSRNSELFRILNMHYNKSNDYQVPDRFVEVSELALREFFAAIQGGRDTDPCWKKSIYKIICKLDSPVPDSFR 667          
BLAST of Prospero-like protein vs. Ensembl Cavefish
Match: prox3 (prospero homeobox protein 1-like [Source:NCBI gene;Acc:103040122])

HSP 1 Score: 149.443 bits (376), Expect = 9.658e-38
Identity = 70/149 (46.98%), Postives = 100/149 (67.11%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSE--LFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFK 1362
            L+P HL+KAKLMF YTRYP+S  LK +FPD+ F +  T+QL+KWFSNFREF+Y +ME+  +++   G+  S +  L ++   ELF+ L  H+NK+   +VP  F+   ++ LREFF A   G++    WKK IYK I KLD P+P+ F+
Sbjct:  545 LSPCHLKKAKLMFFYTRYPSSNTLKTYFPDVKFNRCVTSQLIKWFSNFREFFYIQMERFARQAAREGLPTSRDRVLRLSRNSELFRILNMHYNKSNDYQVPDRFVEVSELALREFFAAIQGGRDTDPCWKKSIYKIICKLDSPVPDSFR 693          
BLAST of Prospero-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007312.1 (pep scaffold:Pmarinus_7.0:GL481361:690:12474:1 gene:ENSPMAG00000006606.1 transcript:ENSPMAT00000007312.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 6.938e-31
Identity = 53/98 (54.08%), Postives = 72/98 (73.47%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEV 1215
            LTP HL+KAKLMF Y+RYP+S MLK +FPD+ F +  T+QL+KWFSNFREFYY +MEK  + +++ G+  + EL VT + ELF+ L  H+NK    +V
Sbjct:    4 LTPGHLKKAKLMFYYSRYPSSTMLKIYFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARAALADGVTSAEELTVTRDSELFRALNVHYNKANDFQV 101          
BLAST of Prospero-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007316.1 (pep scaffold:Pmarinus_7.0:GL481361:12253:13226:1 gene:ENSPMAG00000006606.1 transcript:ENSPMAT00000007316.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 7.277e-15
Identity = 31/69 (44.93%), Postives = 45/69 (65.22%), Query Frame = 1
Query: 1033 TAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITV 1239
            T+QL+KWFSNFREFYY +MEK  + +++ G+  + EL VT + ELF+ L  H+NK    ++      TV
Sbjct:   10 TSQLIKWFSNFREFYYIQMEKFARAALADGVTSAEELTVTRDSELFRALNVHYNKANDFQINTYMYATV 78          
BLAST of Prospero-like protein vs. Ensembl Medaka
Match: prox1 (prospero homeobox 1 [Source:NCBI gene;Acc:100302041])

HSP 1 Score: 181.415 bits (459), Expect = 2.313e-48
Identity = 86/158 (54.43%), Postives = 110/158 (69.62%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            L+P HL+KAKLMF YTRYP+S MLK FF D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL V+ +CELF+ L  H+NK    EVP  F+   +ITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  E
Sbjct:  663 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELSVSRDCELFRALNMHYNKANDFEVPDRFLEVAEITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHE 820          
BLAST of Prospero-like protein vs. Ensembl Medaka
Match: prox1 (prospero homeobox 1 [Source:NCBI gene;Acc:100302041])

HSP 1 Score: 181.415 bits (459), Expect = 2.736e-48
Identity = 85/160 (53.12%), Postives = 112/160 (70.00%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKEEN 1401
            L+P HL+KAKLMF YTRYP+S MLK FF D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL V+ +CELF+ L  H+NK    EVP  F+   +ITLREFF A   GK++  SWKK IYK I KLD  +PE FK  N + EL  +++
Sbjct:  663 LSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELSVSRDCELFRALNMHYNKANDFEVPDRFLEVAEITLREFFNAIVAGKDVDPSWKKAIYKVICKLDSEVPEIFKSPNCLQELLHDDS 822          
BLAST of Prospero-like protein vs. Ensembl Medaka
Match: prox1b (prospero-related homeobox protein 1b [Source:NCBI gene;Acc:100302040])

HSP 1 Score: 180.259 bits (456), Expect = 1.048e-47
Identity = 90/200 (45.00%), Postives = 123/200 (61.50%), Query Frame = 1
Query:  796 EATTNMHVADESVLETCIDTRCXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            +++ N H   ES+  + I + C      +     +    +  L+P HL+KAKLMF YTRYP+S MLK FF D+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL V  + ELF+ L  H+NK    EVP  F+   Q+TLREFF A   GK+   SWKK IYK I KLD  +PE FK  N + EL ++
Sbjct:  684 QSSPNQH-GSESLSLSLIKSECGDLQDMADISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELTVGRDAELFRALNMHYNKANDFEVPDRFLEVAQVTLREFFNAIVAGKDADPSWKKAIYKVICKLDSEVPEVFKSPNCLQELLRD 882          
BLAST of Prospero-like protein vs. Ensembl Medaka
Match: prox1b (prospero-related homeobox protein 1b [Source:NCBI gene;Acc:100302040])

HSP 1 Score: 172.94 bits (437), Expect = 2.849e-45
Identity = 90/208 (43.27%), Postives = 123/208 (59.13%), Query Frame = 1
Query:  796 EATTNMHVADESVLETCIDTRCXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDII--------FYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKE 1395
            +++ N H   ES+  + I + C      +     +    +  L+P HL+KAKLMF YTRYP+S MLK FF D+         F +  T+QL+KWFSNFREFYY +MEK  +++I+ G+  + EL V  + ELF+ L  H+NK    EVP  F+   Q+TLREFF A   GK+   SWKK IYK I KLD  +PE FK  N + EL ++
Sbjct:  684 QSSPNQH-GSESLSLSLIKSECGDLQDMADISPYSGSTIQEGLSPNHLKKAKLMFFYTRYPSSNMLKMFFSDVKSNGKQILKFNRCITSQLIKWFSNFREFYYIQMEKFARQAINDGVTGAEELTVGRDAELFRALNMHYNKANDFEVPDRFLEVAQVTLREFFNAIVAGKDADPSWKKAIYKVICKLDSEVPEVFKSPNCLQELLRD 890          
BLAST of Prospero-like protein vs. Ensembl Medaka
Match: prox2 (prospero homeobox 2 [Source:NCBI gene;Acc:101167581])

HSP 1 Score: 164.081 bits (414), Expect = 5.012e-43
Identity = 77/152 (50.66%), Postives = 104/152 (68.42%), Query Frame = 1
Query:  922 LTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWM 1377
            LTP HL+KAKLMF YTRYP+S +LK +FPD+ F +  T+QL+KWFSNFREFYY +MEK  +++I+ GI+   ++ V+ + ELF+ L  H+NK     VP  F+   +ITL EF+ A S  K+   SWKK IYK I K+D  +PE FK  + M
Sbjct:  477 LTPSHLKKAKLMFFYTRYPSSNVLKTYFPDVKFNRCITSQLIKWFSNFREFYYIQMEKFARQAIADGIRDVKDITVSRDSELFRALNMHYNKANDFHVPDRFLEVAEITLHEFYNAISASKDSDSSWKKSIYKVICKMDSEVPEEFKTSSCM 628          
BLAST of Prospero-like protein vs. Planmine SMEST
Match: SMESG000032751.1 (SMESG000032751.1)

HSP 1 Score: 850.121 bits (2195), Expect = 0.000e+0
Identity = 444/446 (99.55%), Postives = 445/446 (99.78%), Query Frame = 1
Query:   82 MTSYKKSRYSPGEGAKYSVLSFLEGHEKTDFKEQPLDLSIKTDKYSGAKDVINFPDGSDLSETHSKENPRNPVFGICDAINFGKMHTFIXXXXXXXXXXXKTEIHSTNLDFHKNLDEAFRKRSELSYLSQFNNYESLNSAWKFAFRHTGQFQFTEQCLTMPSVLFPAIQESRRYFPDLSMRMIHKFPPRETLDKLSNSLIMXXXXXXXXXXXXPQCSTSKRRKRTKVTDSRLMKRVSIEATTNMHVADESVLETCIDTRCXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKEENGASHSS 1419
            MTSYKKSRYSPGEGAKYSVLSFLEGHEKTDFKEQPLDLSIKTDKYSGAKDVINFPDGSDLS+THSKENPRNPVFGICDAINFGKMHTFIQSLLSQSSDSDKTEIHSTNLDFHKNLDEAFRKRSELSYLSQFNNYESLNSAWKFAFRHTGQFQFTEQCLTMPSVLFPAIQESRRYFPDLSMRMIHKFPPRETLDKLSNSLIMSERENISRISESPQCSTSKRRKRTKVTDSRLMKRVSIEAT NMHVADESVLETCIDTRCSSSSQSSASEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKEENGASHSS
Sbjct:    1 MTSYKKSRYSPGEGAKYSVLSFLEGHEKTDFKEQPLDLSIKTDKYSGAKDVINFPDGSDLSKTHSKENPRNPVFGICDAINFGKMHTFIQSLLSQSSDSDKTEIHSTNLDFHKNLDEAFRKRSELSYLSQFNNYESLNSAWKFAFRHTGQFQFTEQCLTMPSVLFPAIQESRRYFPDLSMRMIHKFPPRETLDKLSNSLIMSERENISRISESPQCSTSKRRKRTKVTDSRLMKRVSIEATANMHVADESVLETCIDTRCSSSSQSSASEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKEENGASHSS 446          
BLAST of Prospero-like protein vs. Planmine SMEST
Match: SMESG000068287.1 (SMESG000068287.1)

HSP 1 Score: 308.145 bits (788), Expect = 3.672e-98
Identity = 162/236 (68.64%), Postives = 193/236 (81.78%), Query Frame = 1
Query:  724 QCSTSKRRKRTKVTDSRLMKR-VSIEATTNMHVADESVLETC----IDTRCXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKEENGASHS 1416
            + S++++RKRTKVTD+RL +R  S+    N+H  + ++ ET          S+SSQSS SE+   DPK+YTLTPIHLRKAKLMFLYTRYPNSQMLK++FPDI FYKQNTAQLVKWFSNFREFYY+EMEKAVQR++S+GI+ + ++ VT E ELFKNLMTHFNK +QI VP EF+ TVQITLREFFEA S GKNLHQSWKKPIYK IAKLDQ LPEFFKD NWM+ELAK+EN + +S
Sbjct:  247 KSSSNRKRKRTKVTDTRLPRRNTSLGNFPNLH--ESTIPETTRFSNYLNPPSNSSQSSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDSLNS 480          
BLAST of Prospero-like protein vs. Planmine SMEST
Match: SMESG000068287.1 (SMESG000068287.1)

HSP 1 Score: 306.22 bits (783), Expect = 7.906e-96
Identity = 163/234 (69.66%), Postives = 192/234 (82.05%), Query Frame = 1
Query:  730 STSKRRKRTKVTDSRLMKR-VSIEATTNMHVADESVLETCIDTR-------CXXXXXXXXXEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKEENGA 1407
            S++++RKRTKVTD+RL +R  S+    N+H  + ++ ET   TR        S+SSQSS SE+   DPK+YTLTPIHLRKAKLMFLYTRYPNSQMLK++FPDI FYKQNTAQLVKWFSNFREFYY+EMEKAVQR++S+GI+ + ++ VT E ELFKNLMTHFNK +QI VP EF+ TVQITLREFFEA S GKNLHQSWKKPIYK IAKLDQ LPEFFKD NWM+ELAK+EN +
Sbjct:  249 SSNRKRKRTKVTDTRLPRRNTSLGNFPNLH--ESTIPET---TRFSNYLNPPSNSSQSSHSEETPGDPKRYTLTPIHLRKAKLMFLYTRYPNSQMLKSYFPDITFYKQNTAQLVKWFSNFREFYYNEMEKAVQRAVSNGIQQAKDIDVTVESELFKNLMTHFNKKKQIVVPCEFLTTVQITLREFFEAISAGKNLHQSWKKPIYKTIAKLDQMLPEFFKDMNWMMELAKDENDS 477          
BLAST of Prospero-like protein vs. Planmine SMEST
Match: SMESG000035419.1 (SMESG000035419.1)

HSP 1 Score: 169.088 bits (427), Expect = 1.652e-47
Identity = 77/157 (49.04%), Postives = 116/157 (73.89%), Query Frame = 1
Query:  919 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSE--LFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLE 1383
            +LT  HLRKAKLMFLY RYPNS +LK+FFPDI F K +TAQLVKWFSNFREF+Y ++EK ++ +I + ++++ E  + +  +CE+++ L+ H+++  QI++P  F+  ++ TL  F++A   G++   SWKKPIYK IA++D  +PEFFK   W+L+
Sbjct:  152 SLTSQHLRKAKLMFLYVRYPNSSILKDFFPDITFDKNSTAQLVKWFSNFREFFYIQLEKYIRTNIIN-LRFTDENDVKIDMDCEIYRTLVNHYDRTNQIQIPTNFLQVLKTTLWHFYQAIVTGRDRDHSWKKPIYKIIARMDITVPEFFKHTQWLLD 307          
BLAST of Prospero-like protein vs. Planmine SMEST
Match: SMESG000012837.1 (SMESG000012837.1)

HSP 1 Score: 170.244 bits (430), Expect = 2.386e-47
Identity = 87/152 (57.24%), Postives = 107/152 (70.39%), Query Frame = 1
Query:  919 TLTPIHLRKAKLMFLYTRYPNSQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKYSSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVGKNLHQSWKKPIYKNIAKLDQPLPEFFKDFNW 1374
             L P HLRKAKLMF YTRYP+S  LK+ FPDI F K NTAQLVKWFSNFREFYY ++EK  ++ +S G K   EL      +L++ L+ H+N+N QI VPKEF + V+ TL EF+ A   GK+  QSWKK IYK IA+LDQ  P +FK+ NW
Sbjct:  201 VLGPNHLRKAKLMFFYTRYPSSSFLKSQFPDIKFEKSNTAQLVKWFSNFREFYYIQIEKFARQILSEG-KLFGELDKLMHEDLYRILVIHYNRNNQIMVPKEFSLVVKTTLEEFYLAIGSGKDKEQSWKKVIYKKIARLDQDTPSYFKNPNW 351          
The following BLAST results are available for this feature:
BLAST of Prospero-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PROX11.642e-4853.80prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX11.642e-4853.80prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX11.642e-4853.80prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX11.642e-4853.80prospero homeobox 1 [Source:HGNC Symbol;Acc:HGNC:9... [more]
PROX25.002e-4350.99prospero homeobox 2 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Prospero-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pros-13.322e-5256.13Homeobox protein prospero homolog 1 [Source:UniPr... [more]
back to top
BLAST of Prospero-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pros3.094e-5355.00gene:FBgn0004595 transcript:FBtr0304607[more]
pros2.052e-5255.77gene:FBgn0004595 transcript:FBtr0304605[more]
pros2.189e-5255.00gene:FBgn0004595 transcript:FBtr0304606[more]
pros2.381e-5255.00gene:FBgn0004595 transcript:FBtr0304604[more]
pros2.871e-5255.00gene:FBgn0004595 transcript:FBtr0304603[more]
back to top
BLAST of Prospero-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prox1a6.301e-5246.51prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980... [more]
prox1a6.301e-5246.51prospero homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980... [more]
prox21.176e-4450.65prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
prox23.448e-4451.32prospero homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-0810... [more]
prox32.032e-3645.33prospero homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-0501... [more]
back to top
BLAST of Prospero-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PROX12.713e-4853.80prospero homeobox 1 [Source:NCBI gene;Acc:10013499... [more]
back to top
BLAST of Prospero-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prox11.053e-4853.80prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:977... [more]
Prox11.053e-4853.80prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:977... [more]
Prox11.053e-4853.80prospero homeobox 1 [Source:MGI Symbol;Acc:MGI:977... [more]
Prox26.421e-4450.32prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:192... [more]
Prox26.421e-4450.32prospero homeobox 2 [Source:MGI Symbol;Acc:MGI:192... [more]
back to top
BLAST of Prospero-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34522|PROS1_CAEEL4.226e-5156.13Homeobox protein prospero homolog 1 OS=Caenorhabdi... [more]
sp|Q9U6A1|PROS_DROVI2.454e-5055.77Homeobox protein prospero OS=Drosophila virilis OX... [more]
sp|P29617|PROS_DROME3.073e-5055.77Homeobox protein prospero OS=Drosophila melanogast... [more]
sp|Q91018|PROX1_CHICK4.197e-4846.88Prospero homeobox protein 1 OS=Gallus gallus OX=90... [more]
sp|P48437|PROX1_MOUSE7.367e-4853.80Prospero homeobox protein 1 OS=Mus musculus OX=100... [more]
back to top
BLAST of Prospero-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXU61.320e-9468.64PROX-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
A0A183AEI22.265e-6562.96Prospero domain-containing protein OS=Echinostoma ... [more]
A0A074ZP011.230e-6463.06Prospero domain-containing protein OS=Opisthorchis... [more]
A0A1S8WHF41.405e-6463.06Prospero domain-containing protein (Fragment) OS=O... [more]
A0A4S2KFM32.522e-5963.06Prospero domain-containing protein OS=Opisthorchis... [more]
back to top
BLAST of Prospero-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prox1a1.938e-4854.43prospero homeobox protein 1 [Source:NCBI gene;Acc:... [more]
ENSAMXT00000012572.21.005e-4743.72prospero homeobox protein 1-like [Source:NCBI gene... [more]
prox24.117e-4351.32prospero homeobox 2 [Source:NCBI gene;Acc:10302953... [more]
prox37.511e-3846.98prospero homeobox protein 1-like [Source:NCBI gene... [more]
prox39.658e-3846.98prospero homeobox protein 1-like [Source:NCBI gene... [more]
back to top
BLAST of Prospero-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007312.16.938e-3154.08pep scaffold:Pmarinus_7.0:GL481361:690:12474:1 gen... [more]
ENSPMAT00000007316.17.277e-1544.93pep scaffold:Pmarinus_7.0:GL481361:12253:13226:1 g... [more]
back to top
BLAST of Prospero-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prospero-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Prospero-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prox12.313e-4854.43prospero homeobox 1 [Source:NCBI gene;Acc:10030204... [more]
prox12.736e-4853.13prospero homeobox 1 [Source:NCBI gene;Acc:10030204... [more]
prox1b1.048e-4745.00prospero-related homeobox protein 1b [Source:NCBI ... [more]
prox1b2.849e-4543.27prospero-related homeobox protein 1b [Source:NCBI ... [more]
prox25.012e-4350.66prospero homeobox 2 [Source:NCBI gene;Acc:10116758... [more]
back to top
BLAST of Prospero-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032751.10.000e+099.55SMESG000032751.1[more]
SMESG000068287.13.672e-9868.64SMESG000068287.1[more]
SMESG000068287.17.906e-9669.66SMESG000068287.1[more]
SMESG000035419.11.652e-4749.04SMESG000035419.1[more]
SMESG000012837.12.386e-4757.24SMESG000012837.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026498 ID=SMED30026498|Name=Prospero-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1790bp
GTTGAGCGTTTGATTTCAAGAACGAAGTGACTGATTTTAGCGGAAAATTA
AATTTTTCAGAAAAGCTTTTCAAAATTTGAAATGACTAGCTACAAAAAAA
GCCGTTATTCTCCCGGTGAAGGTGCTAAGTATTCAGTTTTAAGTTTTCTT
GAAGGTCACGAAAAAACAGACTTTAAAGAACAGCCTCTCGATCTATCAAT
AAAGACAGACAAGTATTCCGGTGCCAAAGATGTGATAAATTTCCCGGATG
GTTCAGATCTAAGTGAGACTCATTCCAAAGAAAATCCCAGAAATCCCGTA
TTTGGAATTTGCGATGCCATCAATTTCGGGAAAATGCACACCTTCATACA
GTCGCTTCTTTCACAGAGTTCTGACAGCGACAAAACTGAGATTCATTCTA
CAAATTTAGATTTTCATAAAAATCTCGACGAGGCCTTCAGGAAGCGATCT
GAATTGAGTTATTTGAGCCAATTTAATAACTATGAGTCGCTGAACTCGGC
CTGGAAATTCGCATTCCGCCATACGGGCCAGTTCCAATTCACAGAGCAAT
GCCTGACAATGCCATCAGTATTGTTCCCAGCAATTCAGGAGTCTCGGCGC
TATTTCCCCGATTTATCAATGAGAATGATACACAAATTCCCACCCCGAGA
AACCCTAGACAAACTATCTAACTCCTTGATAATGAGTGAACGAGAAAATA
TATCTAGAATATCCGAGAGTCCTCAATGTTCCACGAGTAAAAGGAGAAAA
AGAACCAAAGTCACAGATTCTCGGCTGATGAAGCGAGTGTCGATCGAGGC
AACAACAAACATGCATGTGGCCGACGAGTCTGTTTTGGAGACCTGCATAG
ATACCCGATGTTCCAGCTCCTCTCAGTCGTCAGCATCCGAGGATTTGACA
AACGACCCAAAGAAATACACTCTGACACCGATCCATTTGAGGAAGGCCAA
ATTAATGTTCCTCTACACCAGGTACCCTAATTCACAGATGCTCAAGAATT
TCTTTCCCGACATCATATTCTACAAGCAGAACACGGCTCAATTGGTGAAA
TGGTTCAGCAATTTCCGCGAGTTCTACTACAGCGAGATGGAAAAGGCCGT
CCAGCGCTCCATTTCCAGCGGCATCAAATACTCGTCGGAATTGTTTGTCA
CCGAAGAATGCGAGCTATTCAAAAATCTCATGACTCATTTCAATAAAAAC
CGTCAAATCGAGGTCCCAAAAGAATTCATGATTACAGTTCAAATTACTCT
CAGAGAATTTTTCGAGGCCTTTTCAGTTGGGAAAAATCTCCATCAGTCGT
GGAAAAAACCAATATACAAAAATATTGCCAAACTCGATCAGCCACTGCCT
GAATTCTTCAAAGATTTCAACTGGATGCTGGAGCTAGCGAAGGAGGAAAA
TGGTGCCAGTCATTCCAGTTGAAGTTGCGGAACCTGCTGACAGTTTTCCA
GTGATTTGTCTGTTGTGCGCCGAGTGGCGTGCTCCACTCACTTGTTAATA
GCAGCTAGTAATTGAACGCCTCAGACTCCAAGACATCTCACGAGCTGGCT
CAACATTTCATCTGAGAAACGCGAACTCACTCAGCGGATAACTCACTGAC
GCATAAAAGACATTTTATTTCCTCTCTCACTGTTCAGGACTCCTCAGATT
GTATTATACGCCCAGAAGCAGCCACCGCCGTCCTCACTTTCTGCTGGATT
TGTAAAAATGCATTTCTAGTATTCATTTCGAGATTATTTTCCAGCGATTT
CATTTCGTTTTTGAAAATTGAGCTCCTCGTTACAAGCGAG
back to top

protein sequence of SMED30026498-orf-1

>SMED30026498-orf-1 ID=SMED30026498-orf-1|Name=SMED30026498-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=447bp
MTSYKKSRYSPGEGAKYSVLSFLEGHEKTDFKEQPLDLSIKTDKYSGAKD
VINFPDGSDLSETHSKENPRNPVFGICDAINFGKMHTFIQSLLSQSSDSD
KTEIHSTNLDFHKNLDEAFRKRSELSYLSQFNNYESLNSAWKFAFRHTGQ
FQFTEQCLTMPSVLFPAIQESRRYFPDLSMRMIHKFPPRETLDKLSNSLI
MSERENISRISESPQCSTSKRRKRTKVTDSRLMKRVSIEATTNMHVADES
VLETCIDTRCSSSSQSSASEDLTNDPKKYTLTPIHLRKAKLMFLYTRYPN
SQMLKNFFPDIIFYKQNTAQLVKWFSNFREFYYSEMEKAVQRSISSGIKY
SSELFVTEECELFKNLMTHFNKNRQIEVPKEFMITVQITLREFFEAFSVG
KNLHQSWKKPIYKNIAKLDQPLPEFFKDFNWMLELAKEENGASHSS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037131Homeo_prospero_dom_sf
IPR039350Prospero_homeodomain
IPR023082Homeo_prospero_dom
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023082Homeo-prospero domainPFAMPF05044HPDcoord: 280..432
e-value: 2.3E-63
score: 212.7
IPR023082Homeo-prospero domainPROSITEPS51818HOMEO_PROSPEROcoord: 278..436
score: 74.545
IPR037131Homeo-prospero domain superfamilyGENE3DG3DSA:1.10.10.500coord: 265..438
e-value: 5.9E-68
score: 229.7
IPR039350Prospero homeodomain familyPANTHERPTHR12198HOMEOBOX PROTEIN PROSPERO/PROX-1/CEH-26coord: 196..435
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 280..428