endonuclease/exonuclease/phosphatase family domain-containing protein 1-like

Overview
Nameendonuclease/exonuclease/phosphatase family domain-containing protein 1-like
Smed IDSMED30026496
Length (bp)1290
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like (SMED30026496) t-SNE clustered cells

Violin plots show distribution of expression levels for endonuclease/exonuclease/phosphatase family domain-containing protein 1-like (SMED30026496) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like (SMED30026496) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for endonuclease/exonuclease/phosphatase family domain-containing protein 1-like (SMED30026496) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026496

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026496SMESG000041739.1 SmedASXL_011267SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026496SMESG000041739.1 SmedASXL_011267SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30026496SMESG000041739.1 dd_Smed_v6_15723_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30026496SMESG000041739.1 SMED30026496smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30026496SMESG000041739.1 SMED_10882_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30026496SMESG000041739.1 SMED_10882_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Human
Match: EEPD1 (endonuclease/exonuclease/phosphatase family domain containing 1 [Source:HGNC Symbol;Acc:HGNC:22223])

HSP 1 Score: 175.252 bits (443), Expect = 1.889e-48
Identity = 103/299 (34.45%), Postives = 166/299 (55.52%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXX---XXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            RP    F G  + +PV+R+A+WN+   + EK  NPGV  V+C+T+LEN++ L+A+QE++++EA+E  C ELN PTL  I+  +  R  W  V++++P  +  +G  Y   ++D + G+++  +    SS      K    +P+L    +      L   H+ A+T    + N S+   +   L++ A  + +T+K    VIILGDF   P    ++ L+++ F + I +   TN S K     KS DNIWI+KS +  +TG   ++ EGL +  IP N    WGG AS+H PV A+F+T
Sbjct:  245 RPSVEAFGGTRDGRPVLRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQELLDREALEKFCTELNQPTLPNIRKWKGPRGCWKAVVAEKPSSQLQKGAGYAGFLWDAAAGMELRDAGSQESSPSNGHGKLAGPSPYLGRFKVGSHDLTLVNLHLAALTLLGSE-NPSKNHSDGHRLASFAQTLQETLKGEKDVIILGDFGQGPDSNDYDILRKEKFHHLIPAHTFTNISTKNPQGSKSLDNIWISKSLKKVFTGHWAVVREGLTNPWIPDN--WSWGGVASEHCPVLAEFYT 540          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Human
Match: EEPD1 (endonuclease/exonuclease/phosphatase family domain containing 1 [Source:HGNC Symbol;Acc:HGNC:22223])

HSP 1 Score: 175.252 bits (443), Expect = 1.889e-48
Identity = 103/299 (34.45%), Postives = 166/299 (55.52%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXX---XXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            RP    F G  + +PV+R+A+WN+   + EK  NPGV  V+C+T+LEN++ L+A+QE++++EA+E  C ELN PTL  I+  +  R  W  V++++P  +  +G  Y   ++D + G+++  +    SS      K    +P+L    +      L   H+ A+T    + N S+   +   L++ A  + +T+K    VIILGDF   P    ++ L+++ F + I +   TN S K     KS DNIWI+KS +  +TG   ++ EGL +  IP N    WGG AS+H PV A+F+T
Sbjct:  245 RPSVEAFGGTRDGRPVLRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQELLDREALEKFCTELNQPTLPNIRKWKGPRGCWKAVVAEKPSSQLQKGAGYAGFLWDAAAGMELRDAGSQESSPSNGHGKLAGPSPYLGRFKVGSHDLTLVNLHLAALTLLGSE-NPSKNHSDGHRLASFAQTLQETLKGEKDVIILGDFGQGPDSNDYDILRKEKFHHLIPAHTFTNISTKNPQGSKSLDNIWISKSLKKVFTGHWAVVREGLTNPWIPDN--WSWGGVASEHCPVLAEFYT 540          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Zebrafish
Match: eepd1 (endonuclease/exonuclease/phosphatase family domain containing 1 [Source:NCBI gene;Acc:402965])

HSP 1 Score: 152.525 bits (384), Expect = 2.000e-40
Identity = 95/295 (32.20%), Postives = 161/295 (54.58%), Query Frame = 3
Query:  279 GLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXXXXXFIRN--------PFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTH---ECLKEKNFMYCIDSSLSTNTSKKS---GKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            G  + KPV+R+A+WN+   ++EK  NPGV  V+C+T+LEN++ L+A+Q++ ++EA++  C ELN PTL  ++  +++R  W   +S++P G      E+   ++D S GI++        S + +SF  N        P+L +  I  S   L    + A    ++    S TS++L+    L+  + +T+K    +++LG F + P     E L+++     +  S+ TN S ++    +S DNIW ++S    YTG   ++ EGL +  IP N    WGG AS+H PV A+FF
Sbjct:  238 GTRDGKPVVRVATWNLQRCSSEKANNPGVKEVVCMTLLENDIKLLAVQDLADREALDKFCAELNQPTLCSVRRWKSARGLWKCAVSEKPNGVSNSAPEFSGFLWDCSSGIEM------KDSAVLESFTTNGNGNPHPQPYLGHFYIGSSELTLVNVLLTAAPSPTENKRKS-TSDDLK-THKLSSGVQETLKGERDLLVLGHFGVAPDSSEMEILRKEKLSALLAPSVFTNISTRTPQGSRSLDNIWASRSLRKTYTGQCSVVREGLTNPWIPDN--WSWGGVASEHCPVVAEFF 522          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Xenopus
Match: thdl20 (thyroid hormone down-regulated protein (gene 20) [Source:Xenbase;Acc:XB-GENE-486810])

HSP 1 Score: 157.147 bits (396), Expect = 5.873e-42
Identity = 100/299 (33.44%), Postives = 165/299 (55.18%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSR-AWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIK---IXXXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVT-DSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            RP    F G    KPV+R+A+WN+ N + +K  NPGV  V+C+T+LEN++ L+A+QE+ +K+A+E +C ELN P+L  I+  +  R +W  V+S++P+    +  EY   ++D S GI+   ++ +  + ++   K     P++ +  +      L   H+   T ++ K  ND+  S      +T    + +T+K    VII+G F+L       + L+++ F   +  +  TN S K     KS DNIWI+KS +  +TG S ++ EGL +  IP N    WGG AS+H PV A+F+
Sbjct:  238 RPPVELFGGEREGKPVLRVATWNLQNCSLDKASNPGVREVVCMTLLENSVKLLAVQELSDKDALEKLCTELNQPSLPNIRKWKGIRGSWKCVISEKPLSSSSEKEEYFGFMWDVSAGIELKNVILAENMQTNGNGKHMYLQPYIAHFKVGTCDVALVNIHLFPPTVETVKHQNDTYKS------ATFGQTLQETLKSERDVIIMGCFSLPADASEFDSLRKEKFQNLLPPNTFTNISTKNPQGNKSLDNIWISKSLKKIFTGYSLVVREGLTNPWIPDN--WSWGGVASEHCPVLAEFY 528          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Xenopus
Match: thdl20 (thyroid hormone down-regulated protein (gene 20) [Source:Xenbase;Acc:XB-GENE-486810])

HSP 1 Score: 138.272 bits (347), Expect = 1.994e-35
Identity = 95/295 (32.20%), Postives = 149/295 (50.51%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSR-AWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPT---HECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            RP    F G    KPV+R+A+WN+ N + +K  NPGV  V+C+T+LEN++ L+A+QE+ +K+A+E +C ELN P+L  I+  +  R +W  V+S++P+       E GT                            +  LVN+++                ++ K  ND+  S      +T    + +T+K    VII+G F+L       + L+++ F   +  +  TN S K     KS DNIWI+KS +  +TG S ++ EGL +  IP N    WGG AS+H PV A+F+
Sbjct:  238 RPPVELFGGEREGKPVLRVATWNLQNCSLDKASNPGVREVVCMTLLENSVKLLAVQELSDKDALEKLCTELNQPSLPNIRKWKGIRGSWKCVISEKPLS---SSSEVGTC---------------------------DVALVNIHL-----------FPPTVETVKHQNDTYKS------ATFGQTLQETLKSERDVIIMGCFSLPADASEFDSLRKEKFQNLLPPNTFTNISTKNPQGNKSLDNIWISKSLKKIFTGYSLVVREGLTNPWIPDN--WSWGGVASEHCPVLAEFY 483          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Xenopus
Match: thdl20 (thyroid hormone down-regulated protein (gene 20) [Source:Xenbase;Acc:XB-GENE-486810])

HSP 1 Score: 119.013 bits (297), Expect = 1.327e-28
Identity = 88/298 (29.53%), Postives = 144/298 (48.32%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRAWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIK---IXXXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVT-DSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            RP    F G    KPV+R+A+WN+ N + +K  NPGV  V+C+T+LEN++ L+A+QE+ +K+A+E                                    +  EY   ++D S GI+   ++ +  + ++   K     P++ +  +      L   H+   T ++ K  ND+  S      +T    + +T+K    VII+G F+L       + L+++ F   +  +  TN S K     KS DNIWI+KS +  +TG S ++ EGL +  IP N    WGG AS+H PV A+F+
Sbjct:  238 RPPVELFGGEREGKPVLRVATWNLQNCSLDKASNPGVREVVCMTLLENSVKLLAVQELSDKDALE------------------------------------KKEEYFGFMWDVSAGIELKNVILAENMQTNGNGKHMYLQPYIAHFKVGTCDVALVNIHLFPPTVETVKHQNDTYKS------ATFGQTLQETLKSERDVIIMGCFSLPADASEFDSLRKEKFQNLLPPNTFTNISTKNPQGNKSLDNIWISKSLKKIFTGYSLVVREGLTNPWIPDN--WSWGGVASEHCPVLAEFY 491          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Mouse
Match: Eepd1 (endonuclease/exonuclease/phosphatase family domain containing 1 [Source:MGI Symbol;Acc:MGI:1914734])

HSP 1 Score: 160.999 bits (406), Expect = 2.530e-43
Identity = 96/298 (32.21%), Postives = 160/298 (53.69%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIK---IXXXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            RP    F G+ + +PV R+A+WN+   + EK  NPGV  V+C+T+LEN++ L+A+QE+++KEA+E  C ELN P L  I+  + SR  W  +++++P  +  +G  Y   ++D +  ++   I       S+  +K+   +PFL    +  +   L    + A+     + N S+   +   L   A  + +T+K    V+ILGDF   P    ++ L+ + F + + +   TN S +     KS DNIWI+KS +  +TG   ++ EGL +  IP N    WGG AS+H PV A+ +
Sbjct:  245 RPSVEAFGGMRDGRPVFRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQELLDKEALEKFCTELNQPILPNIRKWKGSRGCWRSIVAEKPSNQLQKGPCYSGFLWDTAANVELRDIPGRESSPSNGHAKAVGPSPFLARFKVGSNDLTLVNLQLTALALPGAE-NSSKNHSDGHRLLNFALTLQETLKGEKDVVILGDFGQGPDSNDYDILRREKFHHLVPAHTFTNISTRNPQGSKSVDNIWISKSLKKVFTGHWAVVREGLTNPWIPDN--WSWGGVASEHCPVLAELY 539          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q7L9B9|EEPD1_HUMAN (Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EEPD1 PE=1 SV=2)

HSP 1 Score: 175.252 bits (443), Expect = 9.070e-48
Identity = 103/299 (34.45%), Postives = 166/299 (55.52%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXX---XXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            RP    F G  + +PV+R+A+WN+   + EK  NPGV  V+C+T+LEN++ L+A+QE++++EA+E  C ELN PTL  I+  +  R  W  V++++P  +  +G  Y   ++D + G+++  +    SS      K    +P+L    +      L   H+ A+T    + N S+   +   L++ A  + +T+K    VIILGDF   P    ++ L+++ F + I +   TN S K     KS DNIWI+KS +  +TG   ++ EGL +  IP N    WGG AS+H PV A+F+T
Sbjct:  245 RPSVEAFGGTRDGRPVLRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQELLDREALEKFCTELNQPTLPNIRKWKGPRGCWKAVVAEKPSSQLQKGAGYAGFLWDAAAGMELRDAGSQESSPSNGHGKLAGPSPYLGRFKVGSHDLTLVNLHLAALTLLGSE-NPSKNHSDGHRLASFAQTLQETLKGEKDVIILGDFGQGPDSNDYDILRKEKFHHLIPAHTFTNISTKNPQGSKSLDNIWISKSLKKVFTGHWAVVREGLTNPWIPDN--WSWGGVASEHCPVLAEFYT 540          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q3MHJ7|EEPD1_BOVIN (Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Bos taurus OX=9913 GN=EEPD1 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 8.765e-44
Identity = 97/299 (32.44%), Postives = 162/299 (54.18%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXX---XXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            RP    F G  + +PV+R+A+WN+   + EK  NPGV  V+C+T+LEN++ L+A+QE++++EA+E  C ELN P L  I+  +  R  W  V+S+ P  +  +G  +   ++D + G+++  ++   SS      K    +P+L    +      L   H+  +T    + N S+   +    ++    + +T+K    VI+LGDF   P    ++ L+++ F + I +   TN S K     K+ DNIWI+KS +  +TG   ++ EGL +  IP N    WGG AS+H PV A+F+T
Sbjct:  247 RPSVEAFGGTRDGRPVLRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQELLDREALEKFCVELNQPILPNIRKWKGPRGCWKAVVSETPSTQLQKGAGFAGFLWDTAAGVELRDAAWQESSPGNGHGKPVGPSPYLARFKVGSHDLTLVNLHLATLTLPGGE-NLSKNHSDSHRWASFTQTLQETLKGEKDVIVLGDFGQGPDSSDYDILRKEKFHHLIPAHTFTNISTKNPQGSKALDNIWISKSLKKVFTGHWAVVREGLTNPWIPDN--WSWGGVASEHCPVLAEFYT 542          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q3TGW2|EEPD1_MOUSE (Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Mus musculus OX=10090 GN=Eepd1 PE=1 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.769e-42
Identity = 96/298 (32.21%), Postives = 160/298 (53.69%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIK---IXXXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            RP    F G+ + +PV R+A+WN+   + EK  NPGV  V+C+T+LEN++ L+A+QE+++KEA+E  C ELN P L  I+  + SR  W  +++++P  +  +G  Y   ++D +  ++   I       S+  +K+   +PFL    +  +   L    + A+     + N S+   +   L   A  + +T+K    V+ILGDF   P    ++ L+ + F + + +   TN S +     KS DNIWI+KS +  +TG   ++ EGL +  IP N    WGG AS+H PV A+ +
Sbjct:  245 RPSVEAFGGMRDGRPVFRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQELLDKEALEKFCTELNQPILPNIRKWKGSRGCWRSIVAEKPSNQLQKGPCYSGFLWDTAANVELRDIPGRESSPSNGHAKAVGPSPFLARFKVGSNDLTLVNLQLTALALPGAE-NSSKNHSDGHRLLNFALTLQETLKGEKDVVILGDFGQGPDSNDYDILRREKFHHLVPAHTFTNISTRNPQGSKSVDNIWISKSLKKVFTGHWAVVREGLTNPWIPDN--WSWGGVASEHCPVLAELY 539          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q5XI74|EEPD1_RAT (Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Eepd1 PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 6.731e-42
Identity = 96/298 (32.21%), Postives = 159/298 (53.36%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIK---IXXXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            RP    F G+ + +PV R+A+WN+   + EK  NPGV  V+C+T+LEN++ L+A+QE+++KEA+E  C ELN P L  I+  +  R  W  +++++P  +  +G  Y   ++D +  ++   I       S+  +K+   +PFL    +  +   L    + A+     + N S+   +   L   A  + +T+K    V+ILGDF   P    ++ L+ + F + I +   TN S +     KS DNIWI+KS +  +TG   ++ EGL +  IP N    WGG AS+H PV A+ +
Sbjct:  245 RPSVEAFGGMRDGRPVFRLATWNLQGCSVEKANNPGVREVVCMTLLENSIKLLAVQELLDKEALEKFCTELNQPILPNIRKWKGPRGCWRSIVAEKPSSQLQKGPCYSGFLWDTAANVELRDIPGQESSPSNGHAKTVGPSPFLARFKVGSNDLTLVNLQLTALALPGVE-NSSKNHSDGHRLLNFALTLQETLKGEKDVVILGDFGQGPDSSDYDILRREKFHHLIPAHTFTNISTRNPQGSKSVDNIWISKSLKKVFTGHWAVVREGLTNPWIPDN--WSWGGVASEHCPVLAELY 539          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. UniProt/SwissProt
Match: sp|Q6TEQ0|EEPD1_DANRE (Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Danio rerio OX=7955 GN=eepd1 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 2.806e-39
Identity = 94/295 (31.86%), Postives = 161/295 (54.58%), Query Frame = 3
Query:  279 GLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXXXXXFIRN--------PFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTH---ECLKEKNFMYCIDSSLSTNTSKKS---GKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            G  + KPV+R+A+WN+   ++EK  NPGV  V+C+T+LEN++ L+A+Q++ ++EA++  C ELN PTL  ++  +++R  W   +S++P G      E+   ++D S GI++        S + +SF  N        P+L +  I  S   L    + A    ++    S TS++L+    L+  + +T+K    ++++G F + P     E L+++     +  S+ TN S ++    +S DNIW ++S    YTG   ++ EGL +  IP N    WGG AS+H PV A+FF
Sbjct:  238 GTRDGKPVVRVATWNLQRCSSEKANNPGVKEVVCMTLLENDIKLLAVQDLADREALDKFCAELNQPTLCSVRRWKSARGLWKCAVSEKPNGVSNSAPEFSGFLWDCSSGIEM------KDSAVLESFTTNGNGNPHPQPYLGHFYIGSSELTLVNVLLTAAPSPTENKRKS-TSDDLK-THKLSSGVQETLKGERDLLVMGHFGVAPDSSEMEILRKEKLSALLAPSVFTNISTRTPQGSRSLDNIWASRSLRKTYTGQCSVVREGLTNPWIPDN--WSWGGVASEHCPVVAEFF 522          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. TrEMBL
Match: A0A1S3JKE9 (endonuclease/exonuclease/phosphatase family domain-containing protein 1-like OS=Lingula unguis OX=7574 GN=LOC106174028 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.572e-57
Identity = 106/287 (36.93%), Postives = 168/287 (58.54%), Query Frame = 3
Query:  288 NCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXX--XXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHE---CLKEKNFMYCIDSSLSTN---TSKKSGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            + +PV+RI SWNV +    K+ NPGV  VIC+T+LEN   ++ALQE+ ++E ++ +C+ELNNP +  +K  +  R  W  V+SD P G+ YQ  EY   IYD S+GI++++SS  + +     K F R PF+V    ++  ++    H+KA     + ++  R  EE+     + +AI + +     ++ILGDFNL P  E     ++  +   +D   +TN    + K  ++YDNIW++K  +  +TG SG+I EGL H+ IP +    WGG  +DH PVWA++FT
Sbjct:   87 DGRPVVRIGSWNVLSCCLNKIANPGVREVICMTVLENGFGILALQEIADREVLDKICDELNNPIIPNVKSWKGQRGHWKAVISDTPAGRMYQAPEYNGFIYDTSQGIEVVSSSLIERHRRGAPKQFARRPFMVVFKAKELDFVAVSVHLKATGLQMEDLD--RLQEEIGRCPLVLEAIQEQLPGERDIMILGDFNLGPEQEDFDAFRDAGYKNTVDEHTNTNINLRNLKGSRTYDNIWMSKQAQDVFTGQSGVIREGLTHQWIPHDDWF-WGGIVADHCPVWAEYFT 370          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. TrEMBL
Match: A0A1S3HCL7 (endonuclease/exonuclease/phosphatase family domain-containing protein 1-like OS=Lingula unguis OX=7574 GN=LOC106154090 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 2.907e-57
Identity = 106/287 (36.93%), Postives = 168/287 (58.54%), Query Frame = 3
Query:  288 NCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXX--XXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHE---CLKEKNFMYCIDSSLSTN---TSKKSGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            + +PV+RI SWNV +    K+ NPGV  VIC+T+LEN   ++ALQE+ ++E ++ +C+ELNNP +  +K  +  R  W  V+SD P G+ YQ  EY   IYD S+GI++++SS  + +     K F R PF+V    ++  ++    H+KA     + ++  R  EE+     + +AI + +     ++ILGDFNL P  E     ++  +   +D   +TN    + K  ++YDNIW++K  +  +TG SG+I EGL H+ IP +    WGG  +DH PVWA++FT
Sbjct:   87 DGRPVVRIGSWNVLSCCLNKIANPGVREVICMTVLENGFGILALQEIADREVLDKICDELNNPIIPNVKNWKGQRGHWKAVISDTPAGRMYQAPEYNGFIYDTSQGIEVVSSSLIERHRRGAPKQFARRPFMVVFKAKELDFVAVSVHLKATGLQMEDLD--RLQEEIGRCPLVLEAIQEQLPGERDIMILGDFNLGPEQEDFDAFRDAGYKNTVDEHTNTNINLRNLKGSRTYDNIWMSKQAQDVFTGQSGVIREGLTHQWIPHDDWF-WGGIVADHCPVWAEYFT 370          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. TrEMBL
Match: A0A1I8H219 (Endo/exonuclease/phosphatase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 4.327e-56
Identity = 106/320 (33.12%), Postives = 173/320 (54.06%), Query Frame = 3
Query:  192 NLSSSEINLLNQLRDGKEKFQRPKG-IEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKI-KLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXX-XXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTH---ECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
              S S++ LL + R     + RP     F  L+  +P +RIA+WN+N L  EK  NPGV+ VIC T+LEN +S++A+QE+    A++ +C+ELN P+L  + +     R  W   +S+ PVG+ +Q  E+G  ++     ++   ++         ++F R+PF+  ++I     L A  H+KA T        SRT  E + L  LADA+      + + ++LGDFNL P H   E L+   +   + +   TN S++     +SYDN+W +  C+  +TG + ++  GL+H  IP N    +GG  SDH PV+A+F++
Sbjct:  123 RFSESQLCLLAECRIFDRPYARPPTCAAFDSLLAGRPTVRIAAWNLNRLNLEKASNPGVMEVICCTLLENAISVLAVQELTEPAALQRICDELNQPSLPAVLRWRGGDRGHWTACVSEAPVGRAFQAAEFGGFLWRAGPQLRFRQAAPLEKPGAGGRAFTRSPFVAQLSIGGCRLLAASLHLKATTLGGDSAGTSRTESEADFLPDLADALASVAGPDARCLLLGDFNLAPDHAAFEPLRLMGYSGLLAADEPTNISRECPAGSRSYDNLWASPLCKRLFTGQAAVVRNGLFHPLIPAN--WSFGGPVSDHCPVYAEFYS 440          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. TrEMBL
Match: A0A267G934 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001509g7 PE=4 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 3.964e-55
Identity = 106/320 (33.12%), Postives = 174/320 (54.37%), Query Frame = 3
Query:  192 NLSSSEINLLNQLRDGKEKFQRPKG-IEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKI-KLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXX-XXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTH---ECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
              S S++ LL + R     + RP     F GL+  +P +RIA+WN+N L  EK  NPGV+ VIC T+LEN +S++A+QE+    A++ +C+ELN P+L  + +     R  W   +S+ PVG+ +Q  E+G  ++     ++   ++         ++F R+PF+  ++I     L A  H+KA T        +RT  E + L  LADA+      + + ++LGDFNL P H   E L+   +   + +   TN S++     +SYDN+W +  C+  +TG + ++  GL+H  IP N    +GG  SDH PV+A+F++
Sbjct:  300 RFSESQLCLLAECRIFDRPYARPPTCAAFDGLLAGRPTVRIAAWNLNRLNLEKASNPGVMEVICCTLLENAISVLAVQELTEPAALQRICDELNQPSLPAVLRWRGGDRGHWTACVSEAPVGRAFQAAEFGGFLWRAGPQLRFRQAAPLEKPGAGGRAFTRSPFVAQLSIGGCRLLAASLHLKATTLGGDSAGTARTESEADFLPDLADALASVAGSDARCLLLGDFNLAPDHAAFEPLRLMGYSGLLAADEPTNISRECPAGSRSYDNLWASPLCKRLFTGQAAVVRNGLFHPLIPAN--WSFGGPVSDHCPVYAEFYS 617          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. TrEMBL
Match: A0A1I8GVW4 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 2.932e-53
Identity = 106/320 (33.12%), Postives = 174/320 (54.37%), Query Frame = 3
Query:  192 NLSSSEINLLNQLRDGKEKFQRPKG-IEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKI-KLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXX-XXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTH---ECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
              S S++ LL + R     + RP     F GL+  +P +RIA+WN+N L  EK  NPGV+ VIC T+LEN +S++A+QE+    A++ +C+ELN P+L  + +     R  W   +S+ PVG+ +Q  E+G  ++     ++   ++         ++F R+PF+  ++I     L A  H+KA T        +RT  E + L  LADA+      + + ++LGDFNL P H   E L+   +   + +   TN S++     +SYDN+W +  C+  +TG + ++  GL+H  IP N    +GG  SDH PV+A+F++
Sbjct:  254 RFSESQLCLLAECRIFDRPYARPPTCAAFDGLLAGRPTVRIAAWNLNRLNLEKASNPGVMEVICCTLLENAISVLAVQELTEPAALQRICDELNQPSLPAVLRWRGGDRGHWTACVSEAPVGRAFQAAEFGGFLWRAGPQLRFRQAAPLEKPGAGGRAFTRSPFVAQLSIGGCRLLAASLHLKATTLGGDSAGTARTESEADFLPDLADALASVAGSDARCLLLGDFNLAPDHAAFEPLRLMGYSGLLAADEPTNISRECPAGSRSYDNLWASPLCKRLFTGQAAVVRNGLFHPLIPAN--WSFGGPVSDHCPVYAEFYS 571          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Cavefish
Match: eepd1 (endonuclease/exonuclease/phosphatase family domain containing 1 [Source:NCBI gene;Acc:103034718])

HSP 1 Score: 140.969 bits (354), Expect = 1.415e-36
Identity = 87/294 (29.59%), Postives = 157/294 (53.40%), Query Frame = 3
Query:  267 IEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXX---XXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHECLK---EKNFMYCIDSSLSTNTSKKSGK---SYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            +E R     KP+IR+A+W++   +++K  NPGV  V+C+T+LEN++ L+A+Q++ ++EA+   C ELN P+L  ++  ++ R  W   +S++P  +  +G EY   ++D S GI++  +  ++++            P+L +  I  S   L   H+K      K+ N  +   +      L   ++ ++K    V++LG F + P    L    ++  +  +  S+ TN S KS +   + DNIW +++ +  YTG   ++ EGL +  IP N    WGG AS+H PV A+F+
Sbjct:  186 VEERASHGKKPLIRVATWDLQRCSSDKANNPGVREVVCMTLLENHIKLLAVQDLADREALNKFCTELNQPSLFNVRKWKSPRGVWKCSVSEKPTAESSEGSEYSGFLWDSSVGIELKDTVVIDNAATNGNGNHGQTKPYLAHFYIGSSELTLVNVHLKTPAQ-KKEQNGRKHGTDRTKNHRLNATVHDSLKGVKDVLVLGGFGMPPDSAELDVLKKEKLLALLPPSVYTNISTKSPQGSSALDNIWASRTMKKIYTGECSVVREGLTNPWIPDN--WSWGGVASEHCPVMAEFY 476          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000343.1 (pep scaffold:Pmarinus_7.0:GL476842:637795:647834:1 gene:ENSPMAG00000000307.1 transcript:ENSPMAT00000000343.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.198 bits (352), Expect = 5.848e-38
Identity = 83/274 (30.29%), Postives = 141/274 (51.46%), Query Frame = 3
Query:  234 DGKEKFQRPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIK-LSQNSRAWGFVMSDEPVGKGY---------QGHEYGTLIYDKSKGIKIXXXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKK---SGKSYDNIWINKSCELYYTG 1007
            D      RP+   F G++  +P +R+ASWN+   + +K+ N GV  V+CLT+LE  + L+A+QE+ +K A++ +C ELN P+L  ++   +    W  V+S+ P G  Y         Q  EY   ++D S G+++L+   +     SK F R P+L      +  + L   H+KA    + ++   +   E+  L  L D + + +      ++LGDFNL P     + L+ + F  C+ + + TN S K     KSYDN+W++ + +  YTG
Sbjct:   96 DFPAPIPRPQVESFSGVVRGRPAVRVASWNLQCCSADKMDNNGVREVVCLTLLEQGIKLLAVQELADKVALQKLCAELNAPSLRSVRDWPRPQGDWRCVVSENPTGPMYQCACAYVRPQSMEYAGFLWDASSGLELLSEGLVGKKKGSKHFARYPYLGYFKAGRFDFTLVNVHLKATGLGNAELE--KLQLEIMKLPQLLDLLEEHLSGEKDTLLLGDFNLTPDASDFDALRSQGFKSCVPADVFTNISIKNLSGSKSYDNVWLSPAAQGLYTG 367          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009928.1 (pep scaffold:Pmarinus_7.0:GL490757:367:4404:1 gene:ENSPMAG00000008977.1 transcript:ENSPMAT00000009928.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 2.203e-19
Identity = 69/252 (27.38%), Postives = 120/252 (47.62%), Query Frame = 3
Query:  402 LSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQN--SRAWGFVMSDEP---VGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXXXXXFIR---NPFLVNVNIQK-SFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNP---THECLKEKNFMYCIDSSLSTNTSKKSGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            + L+A+Q+V+++ ++E +C E+N P   ++   +     +W  V+S+ P    G+G  G      ++D   GI++LA+S L+             +PFL +       F LL +   +A T  +    D      L  +     A+++ IK    V+++G F+ +P     + L++  F +C+    +T     +G   DNIWIN + +  +TG +  + EGL    IP      WGG AS H PVWA+F  
Sbjct:    1 IKLLAVQDVMDRASLEKICMEMNEPITPQVSGWEPLLRGSWRGVLSEPPQKLPGQGRLG-----FLWDTDTGIELLAASSLHLRHRDALGHDAHISPFLGHFTAGGFEFILLNVHTRRAATADAAPAEDPSVRRAL--VEQCLRALDEHIKEERAVLLMGGFSCSPEDAAFDALRDAGFRHCLPPGEATELG--AGGCVDNIWINPAIQRIFTGRACAVREGLCSSWIPDG--WEWGGAASRHCPVWAEFMA 241          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004464.1 (pep scaffold:Pmarinus_7.0:GL489854:2401:5339:-1 gene:ENSPMAG00000004062.1 transcript:ENSPMAT00000004464.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 2.680e-12
Identity = 62/249 (24.90%), Postives = 101/249 (40.56%), Query Frame = 3
Query:  408 LIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXX------XXXXXXXFIRNPFLVNVNIQKSFYLLAI-FHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKV--NHKVIILGDFNLNPTHECLKEKNFMYCIDSSLSTNTSKKSG-KSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            L+  Q      +V  +C ELN PT+  ++        W  V S E    G  G E    +++++ G+++L             S  + +  R P LV      +F   A+  HI   +  S+   D  T   +E  +T        ++V     V++LG          L     +   ++       K  G ++ D +W++ S +  +TG S ++  GL    IP      WGG  SDH PVWA+FFT
Sbjct:    1 LVVSQRSWPHTSVSQLCLELNEPTVPLVQSWAGQHGDWECVTSAERQPDG--GREILGFLWNRAAGVELLPLPAPPDCAGMIPSNGTGASCRVPLLVRQFKVGAFAFTAVNVHIWTCSAPSRPPVDV-TGGTVELPATCTPTTEPVLRVAGGWPVLVLGGLGAQ-AASALGGLPSVLPPEAFTDIGKEKPGGSRAADGVWVSSSVKERHTGGSAVVRAGLSSAWIPDG--WAWGGFVSDHCPVWAEFFT 243          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004471.1 (pep scaffold:Pmarinus_7.0:GL489854:2401:5306:-1 gene:ENSPMAG00000004062.1 transcript:ENSPMAT00000004471.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 3.755e-12
Identity = 59/236 (25.00%), Postives = 95/236 (40.25%), Query Frame = 3
Query:  441 AVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXX------XXXXXXXFIRNPFLVNVNIQKSFYLLAI-FHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHECLKEKNFMYCIDSSLSTNTSKKSG-KSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            +V  +C ELN PT+  ++        W  V S E    G  G E    +++++ G+++L             S  + +  R P LV      +F   A+  H++   D    +        L  LS   D +    K    V++LG          L     +   ++       K  G ++ D +W++ S +  +TG S ++  GL    IP      WGG  SDH PVWA+FFT
Sbjct:    1 SVSQLCLELNEPTVPLVQSWAGQHGDWECVTSAERQPDG--GREILGFLWNRAAGVELLPLPAPPDCAGMIPSNGTGASCRVPLLVRQFKVGAFAFTAVNVHVRPAADEGTAVQLPPLGPAL--LSPEIDGV----KGGWPVLVLGGLGAQ-AASALGGLPSVLPPEAFTDIGKEKPGGSRAADGVWVSSSVKERHTGGSAVVRAGLSSAWIPDG--WAWGGFVSDHCPVWAEFFT 225          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004461.1 (pep scaffold:Pmarinus_7.0:GL489854:2401:5339:-1 gene:ENSPMAG00000004062.1 transcript:ENSPMAT00000004461.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.244e-10
Identity = 59/252 (23.41%), Postives = 99/252 (39.29%), Query Frame = 3
Query:  408 LIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXX------XXXXXXXFIRNPFLVNVNIQKSFYLLAI-FH-----IKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHECLKEKNFMYCIDSSLSTNTSKKSG-KSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFT 1121
            L+  Q      +V  +C ELN PT+  ++        W  V S E    G  G E    +++++ G+++L             S  + +  R P LV      +F   A+  H     ++     S  ++ +  + EL    T        +     V++LG          L     +   ++       K  G ++ D +W++ S +  +TG S ++  GL    IP      WGG  SDH PVWA+FFT
Sbjct:    1 LVVSQRSWPHTSVSQLCLELNEPTVPLVQSWAGQHGDWECVTSAERQPDG--GREILGFLWNRAAGVELLPLPAPPDCAGMIPSNGTGASCRVPLLVRQFKVGAFAFTAVNVHNSVNEMRQCGRPSPPVDVTGGTVELPATCTPTTEPVLRVAGGWPVLVLGGLGAQ-AASALGGLPSVLPPEAFTDIGKEKPGGSRAADGVWVSSSVKERHTGGSAVVRAGLSSAWIPDG--WAWGGFVSDHCPVWAEFFT 247          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Nematostella
Match: EDO30448 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0R6])

HSP 1 Score: 50.0618 bits (118), Expect = 1.191e-6
Identity = 26/79 (32.91%), Postives = 45/79 (56.96%), Query Frame = 3
Query:  294 KPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRAWGFVM 530
            + V+R+ SWN+    ++K  N GV  VIC TILEN ++++ +QE+ +++A            LTK ++ + +   G VM
Sbjct:  267 RDVVRLMSWNLQCFNSDKASNEGVCEVICKTILENGVNIVVIQEIGDEDA------------LTKGRVMEGTVMEGIVM 333          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Medaka
Match: eepd1 (endonuclease/exonuclease/phosphatase family domain containing 1 [Source:NCBI gene;Acc:101158460])

HSP 1 Score: 127.872 bits (320), Expect = 9.631e-32
Identity = 87/296 (29.39%), Postives = 155/296 (52.36%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA-WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIX-XXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTH---ECLKEKNFMYCIDSSLSTNTSKKS---GKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            RP       L + +PV+R+A+W++   + +K  NPGV  V+C+T+LEN++ L+A+Q+++++EA+E  C ELN  TL  ++  +  R  W  ++S+ P         Y   ++D S GI +  A    +            +L    +  S   L   H++A  +S+   ++ R ++E      L  +I +T+K   ++++LG+F   P     + L+++ F   + S+  TN S +S    +  DNIW+++S +  Y+G   ++ EGL +  IP N    WGG ASDH P+ A+ F
Sbjct:  230 RPNVEPSPSLRDGRPVVRVATWSLQACSCDKANNPGVKEVVCMTLLENDIKLLAVQDLLDREALEKFCVELNQGTLGSVRRWRQPRGLWKSIVSENPSTHVDAAVTYSGFLWDSSAGIDLKNAVILDSGVVSGNQLYPRLYLARFLVGSSELTLVNVHLQAAGESN---SNHRGADEARR-QLLPPSIQETLKGGKELLLLGNFGCGPQSSELDLLRKEKFCALVPSTQFTNISTRSPQGNRCLDNIWLSRSLKKIYSGHCMVVREGLTNPWIPDN--WSWGGVASDHCPIVAELF 519          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Medaka
Match: eepd1 (endonuclease/exonuclease/phosphatase family domain containing 1 [Source:NCBI gene;Acc:101158460])

HSP 1 Score: 95.1301 bits (235), Expect = 9.704e-21
Identity = 77/295 (26.10%), Postives = 141/295 (47.80%), Query Frame = 3
Query:  255 RPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRAWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXXXX-XFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTH---ECLKEKNFMYCIDSSLSTNTSKKS---GKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFF 1118
            RP       L + +PV+R+A+W++   + +K  NPGV  V+C+T+LEN++ L+A+Q+++++EA+E                                    +   Y   ++D S GI +  +  L+S  +S        +L    +  S   L   H++A  +S+   ++ R ++E      L  +I +T+K    +++  +F   P     + L+++ F   + S+  TN S +S    +  DNIW+++S +  Y+G   ++ EGL +  IP N    WGG ASDH P+ A+ F
Sbjct:  230 RPNVEPSPSLRDGRPVVRVATWSLQACSCDKANNPGVKEVVCMTLLENDIKLLAVQDLLDREALE------------------------------------KAVTYSGFLWDSSAGIDLKNAVILDSGVVSGNQLYPRLYLARFLVGSSELTLVNVHLQAAGESN---SNHRGADEARR-QLLPPSIQETLKGKELLLLG-NFGCGPQSSELDLLRKEKFCALVPSTQFTNISTRSPQGNRCLDNIWLSRSLKKIYSGHCMVVREGLTNPWIPDN--WSWGGVASDHCPIVAELF 481          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000041739.1 (SMESG000041739.1)

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 354/354 (100.00%), Postives = 354/354 (100.00%), Query Frame = 3
Query:   66 MGASLCKSCIPXXXXXXXXXXXXXXSQTKHERPFTNQYLLNENLSSSEINLLNQLRDGKEKFQRPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRAWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHECLKEKNFMYCIDSSLSTNTSKKSGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFTRL 1127
            MGASLCKSCIPKRKKLKDDNNVLNKSQTKHERPFTNQYLLNENLSSSEINLLNQLRDGKEKFQRPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRAWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKILASSQLNSSTLSKSFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHECLKEKNFMYCIDSSLSTNTSKKSGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFTRL
Sbjct:    1 MGASLCKSCIPKRKKLKDDNNVLNKSQTKHERPFTNQYLLNENLSSSEINLLNQLRDGKEKFQRPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRAWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKILASSQLNSSTLSKSFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHECLKEKNFMYCIDSSLSTNTSKKSGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFTRL 354          
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Planmine SMEST
Match: SMESG000041739.1 (SMESG000041739.1)

HSP 1 Score: 660.988 bits (1704), Expect = 0.000e+0
Identity = 354/357 (99.16%), Postives = 354/357 (99.16%), Query Frame = 3
Query:   66 MGASLCKSCIPXXXXXXXXXXXXXXSQTKHERPFTNQYLLNENLSSSEINLLNQLRDGKEKFQRPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRAWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKIXXXXXXXXXXXXXXFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHEC---LKEKNFMYCIDSSLSTNTSKKSGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFTRL 1127
            MGASLCKSCIPKRKKLKDDNNVLNKSQTKHERPFTNQYLLNENLSSSEINLLNQLRDGKEKFQRPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRAWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKILASSQLNSSTLSKSFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHEC   LKEKNFMYCIDSSLSTNTSKKSGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFTRL
Sbjct:    1 MGASLCKSCIPKRKKLKDDNNVLNKSQTKHERPFTNQYLLNENLSSSEINLLNQLRDGKEKFQRPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGVLTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRAWGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKILASSQLNSSTLSKSFIRNPFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAINQTIKVNHKVIILGDFNLNPTHECFKGLKEKNFMYCIDSSLSTNTSKKSGKSYDNIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADFFTRL 357          
The following BLAST results are available for this feature:
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
EEPD11.889e-4834.45endonuclease/exonuclease/phosphatase family domain... [more]
EEPD11.889e-4834.45endonuclease/exonuclease/phosphatase family domain... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eepd12.000e-4032.20endonuclease/exonuclease/phosphatase family domain... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
thdl205.873e-4233.44thyroid hormone down-regulated protein (gene 20) [... [more]
thdl201.994e-3532.20thyroid hormone down-regulated protein (gene 20) [... [more]
thdl201.327e-2829.53thyroid hormone down-regulated protein (gene 20) [... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Eepd12.530e-4332.21endonuclease/exonuclease/phosphatase family domain... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7L9B9|EEPD1_HUMAN9.070e-4834.45Endonuclease/exonuclease/phosphatase family domain... [more]
sp|Q3MHJ7|EEPD1_BOVIN8.765e-4432.44Endonuclease/exonuclease/phosphatase family domain... [more]
sp|Q3TGW2|EEPD1_MOUSE1.769e-4232.21Endonuclease/exonuclease/phosphatase family domain... [more]
sp|Q5XI74|EEPD1_RAT6.731e-4232.21Endonuclease/exonuclease/phosphatase family domain... [more]
sp|Q6TEQ0|EEPD1_DANRE2.806e-3931.86Endonuclease/exonuclease/phosphatase family domain... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JKE91.572e-5736.93endonuclease/exonuclease/phosphatase family domain... [more]
A0A1S3HCL72.907e-5736.93endonuclease/exonuclease/phosphatase family domain... [more]
A0A1I8H2194.327e-5633.13Endo/exonuclease/phosphatase domain-containing pro... [more]
A0A267G9343.964e-5533.13Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GVW42.932e-5333.13Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
eepd11.415e-3629.59endonuclease/exonuclease/phosphatase family domain... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000343.15.848e-3830.29pep scaffold:Pmarinus_7.0:GL476842:637795:647834:1... [more]
ENSPMAT00000009928.12.203e-1927.38pep scaffold:Pmarinus_7.0:GL490757:367:4404:1 gene... [more]
ENSPMAT00000004464.12.680e-1224.90pep scaffold:Pmarinus_7.0:GL489854:2401:5339:-1 ge... [more]
ENSPMAT00000004471.13.755e-1225.00pep scaffold:Pmarinus_7.0:GL489854:2401:5306:-1 ge... [more]
ENSPMAT00000004461.11.244e-1023.41pep scaffold:Pmarinus_7.0:GL489854:2401:5339:-1 ge... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO304481.191e-632.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eepd19.631e-3229.39endonuclease/exonuclease/phosphatase family domain... [more]
eepd19.704e-2126.10endonuclease/exonuclease/phosphatase family domain... [more]
back to top
BLAST of endonuclease/exonuclease/phosphatase family domain-containing protein 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000041739.10.000e+0100.00SMESG000041739.1[more]
SMESG000041739.10.000e+099.16SMESG000041739.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026496 ID=SMED30026496|Name=endonuclease/exonuclease/phosphatase family domain-containing protein 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1290bp
AATCATATAATACTTAAAAATTTCGATTAATTTTTAAAATAATTTTAATT
TTTAAAATTTAATTTATGGGAGCCTCATTGTGCAAATCTTGTATTCCTAA
AAGAAAGAAGCTAAAGGATGATAATAATGTTTTGAATAAAAGCCAGACAA
AGCACGAAAGACCTTTTACCAATCAATATTTGTTAAATGAAAATTTATCA
TCATCCGAAATTAATTTGCTAAATCAATTACGAGATGGTAAAGAAAAATT
CCAAAGACCTAAAGGCATTGAATTTAGAGGATTAATTAATTGCAAACCCG
TAATTAGAATTGCATCTTGGAATGTTAATAATTTAACAACCGAAAAAGTT
ATGAATCCAGGAGTGTTAACAGTGATTTGCTTAACCATATTAGAGAATAA
TTTATCCTTGATTGCGTTACAAGAAGTTATTAACAAAGAAGCTGTAGAAA
TTGTTTGCAACGAGTTAAACAATCCAACTTTGACCAAGATCAAACTAAGC
CAGAATTCACGGGCATGGGGTTTTGTCATGTCGGATGAACCGGTCGGCAA
AGGGTACCAGGGCCATGAATATGGCACCTTGATTTATGATAAATCAAAAG
GAATAAAAATCCTCGCCTCAAGTCAACTGAATTCGAGCACTCTATCGAAA
TCCTTTATCAGAAATCCTTTTCTGGTTAATGTAAATATTCAGAAAAGCTT
TTATTTGTTGGCGATATTTCATATCAAAGCAGTCACTGATTCAAGTAAAA
AGATAAACGATAGCAGAACGAGTGAAGAGCTGGAAGATTTGTCAACGTTG
GCTGACGCAATAAACCAAACAATAAAAGTGAATCACAAAGTGATAATTCT
AGGAGATTTCAATTTAAATCCGACACATGAATGTCTGAAAGAGAAGAATT
TCATGTATTGCATTGATTCCAGTTTGTCGACTAACACGAGCAAGAAATCC
GGCAAATCCTATGACAATATCTGGATCAACAAGTCATGCGAACTGTATTA
CACGGGATCATCTGGAATCATCAGCGAAGGCCTTTATCACAAGCATATCC
CAAAAAATGGCATGATGGGCTGGGGCGGATGTGCCAGTGATCACCGCCCG
GTTTGGGCCGATTTCTTCACCCGTCTATAAAATGTTTATCGATGGTTTCT
TGGTGCAATTAGATAGCAAATCATATTTTCGTGTATAATATATTTTAATA
CGATTTATTAAAAAGATTGAAACAAATTTAAATGTTTATCAGTTGAATGG
TTGAACATATTTTATATTATAACTGCTGTAAAGATTATTT
back to top

protein sequence of SMED30026496-orf-1

>SMED30026496-orf-1 ID=SMED30026496-orf-1|Name=SMED30026496-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=355bp
MGASLCKSCIPKRKKLKDDNNVLNKSQTKHERPFTNQYLLNENLSSSEIN
LLNQLRDGKEKFQRPKGIEFRGLINCKPVIRIASWNVNNLTTEKVMNPGV
LTVICLTILENNLSLIALQEVINKEAVEIVCNELNNPTLTKIKLSQNSRA
WGFVMSDEPVGKGYQGHEYGTLIYDKSKGIKILASSQLNSSTLSKSFIRN
PFLVNVNIQKSFYLLAIFHIKAVTDSSKKINDSRTSEELEDLSTLADAIN
QTIKVNHKVIILGDFNLNPTHECLKEKNFMYCIDSSLSTNTSKKSGKSYD
NIWINKSCELYYTGSSGIISEGLYHKHIPKNGMMGWGGCASDHRPVWADF
FTRL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036691Endo/exonu/phosph_ase_sf
IPR005135Endo/exonuclease/phosphatase
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0004519endonuclease activity
GO:0004527exonuclease activity
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0090305nucleic acid phosphodiester bond hydrolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036691Endonuclease/exonuclease/phosphatase superfamilyGENE3DG3DSA:3.60.10.10coord: 80..350
e-value: 2.7E-38
score: 134.2
IPR036691Endonuclease/exonuclease/phosphatase superfamilySUPERFAMILYSSF56219DNase I-likecoord: 80..352
NoneNo IPR availablePANTHERPTHR21180:SF33ENDONUCLEASE/EXONUCLEASE/PHOSPHATASE FAMILY DOMAIN-CONTAINING PROTEIN 1coord: 19..352
NoneNo IPR availablePANTHERPTHR21180FAMILY NOT NAMEDcoord: 19..352
NoneNo IPR availableCDDcd10283MnuA_DNase1-likecoord: 80..350
e-value: 4.0059E-39
score: 137.915