ATP-dependent DNA helicase PIF1

Overview
NameATP-dependent DNA helicase PIF1
Smed IDSMED30026473
Length (bp)4681
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent DNA helicase PIF1 (SMED30026473) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent DNA helicase PIF1 (SMED30026473) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent DNA helicase PIF1 (SMED30026473) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent DNA helicase PIF1 (SMED30026473) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026473

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30026473SMESG000079839.1 dd_Smed_v4_12558_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Human
Match: TRAPPC9 (trafficking protein particle complex 9 [Source:HGNC Symbol;Acc:HGNC:30832])

HSP 1 Score: 76.6406 bits (187), Expect = 3.503e-13
Identity = 97/423 (22.93%), Postives = 170/423 (40.19%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKN----PPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLS-------KSMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPIKINSNFNRGQ 2296
            GR+ K   D  L  G   DS  +Y +++  LR VND LWL  A EGLC + ++Y +P  T              +R+     L  + +      N + P     + +   +S ++ +      PE     ++ +KY   IS Y     +K +N   I  ++ IKA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     +  G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L N +       + + +     +       LP ++      LP  L P +      +    KS FI++PI  +   NRG+
Sbjct:   56 GRMRKHVGDLCLQAGMLQDSLVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGG---------KSGARRFQGSTLPAEAA------NRHRPGALTTNGINPDTSTEIGRAKNCLSPE-----DIIDKYKEAISYY-----SKYKNAGVIELEACIKAVRVLAIQKRSMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IAEPGWRA-----------CYKLLLETLPGYSLSLDPKDFS-RGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF-LLQTMLDFLSDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTKLPIVRHVKLLNLPASLRPHKMKSLLGQNVSTKSPFIYSPIIAH---NRGE 427          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Human
Match: TRAPPC9 (trafficking protein particle complex 9 [Source:HGNC Symbol;Acc:HGNC:30832])

HSP 1 Score: 76.6406 bits (187), Expect = 4.116e-13
Identity = 101/425 (23.76%), Postives = 166/425 (39.06%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVL----SINNNMNSPDQSDFSFLKK--FSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASV-------MNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPIKINSNFNRGQ 2296
            GR+ K   D  L  G   DS  +Y +++  LR VND LWL  A EGLC + ++Y +P  T           +    +  +      Q VL    ++  N  +PD S      K   S  D+              +KY   IS Y     +K +N   I  ++ IKA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     +  G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L N +         + L   +         LP ++      LP  L P +      +    KS FI++PI  +   NRG+
Sbjct:  301 GRMRKHVGDLCLQAGMLQDSLVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKSGARRFQGSTLPAEAANRHRPGAQEVLIDPGALTTNGINPDTSTEIGRAKNCLSPEDII-------------DKYKEAISYY-----SKYKNAGVIELEACIKAVRVLAIQKRSMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IAEPGWRA-----------CYKLLLETLPGYSLSLDPKDFS-RGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF-LLQTMLDFLSDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTKLPIVRHVKLLNLPASLRPHKMKSLLGQNVSTKSPFIYSPIIAH---NRGE 681          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Human
Match: TRAPPC9 (trafficking protein particle complex 9 [Source:HGNC Symbol;Acc:HGNC:30832])

HSP 1 Score: 75.8702 bits (185), Expect = 6.361e-13
Identity = 102/426 (23.94%), Postives = 171/426 (40.14%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQA-------LDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASV-------MNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPIKINSNFNRGQ 2296
            GR+ K   D  L  G   DS  +Y +++  LR VND LWL  A EGLC + ++Y +P  T           S L     ++ R   + ++  D   L+  N +N    ++    K   S       PE     ++ +KY   IS Y     +K +N   I  ++ IKA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     +  G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L N +         + L   +         LP ++      LP  L P +      +    KS FI++PI  +   NRG+
Sbjct:  203 GRMRKHVGDLCLQAGMLQDSLVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKSGARRFQGSTLPAEAANRHRP-GAQEVLIDPGALT-TNGINPDTSTEIGRAKNCLS-------PE-----DIIDKYKEAISYY-----SKYKNAGVIELEACIKAVRVLAIQKRSMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IAEPGWRA-----------CYKLLLETLPGYSLSLDPKDFS-RGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF-LLQTMLDFLSDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTKLPIVRHVKLLNLPASLRPHKMKSLLGQNVSTKSPFIYSPIIAH---NRGE 583          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Human
Match: TRAPPC9 (trafficking protein particle complex 9 [Source:HGNC Symbol;Acc:HGNC:30832])

HSP 1 Score: 75.8702 bits (185), Expect = 6.361e-13
Identity = 102/426 (23.94%), Postives = 171/426 (40.14%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQA-------LDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASV-------MNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPIKINSNFNRGQ 2296
            GR+ K   D  L  G   DS  +Y +++  LR VND LWL  A EGLC + ++Y +P  T           S L     ++ R   + ++  D   L+  N +N    ++    K   S       PE     ++ +KY   IS Y     +K +N   I  ++ IKA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     +  G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L N +         + L   +         LP ++      LP  L P +      +    KS FI++PI  +   NRG+
Sbjct:  203 GRMRKHVGDLCLQAGMLQDSLVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKSGARRFQGSTLPAEAANRHRP-GAQEVLIDPGALT-TNGINPDTSTEIGRAKNCLS-------PE-----DIIDKYKEAISYY-----SKYKNAGVIELEACIKAVRVLAIQKRSMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IAEPGWRA-----------CYKLLLETLPGYSLSLDPKDFS-RGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF-LLQTMLDFLSDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTKLPIVRHVKLLNLPASLRPHKMKSLLGQNVSTKSPFIYSPIIAH---NRGE 583          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Zebrafish
Match: TRAPPC9 (si:dkey-218f9.10 [Source:ZFIN;Acc:ZDB-GENE-070705-374])

HSP 1 Score: 75.0998 bits (183), Expect = 6.437e-13
Identity = 59/217 (27.19%), Postives = 100/217 (46.08%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSEL---VVFLNDKSRQLISG--QLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFR 1708
            GR+ K   D  L  G   D+  +Y +A+  LR VND LWL  A EGLC + +++ +P  T          V    D  ++   G  ++  D   L+  N +++   ++    K   S +            ++ EKY   IS Y      K ++   I  ++ IKA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRSVNDFLWLGAALEGLCSASVIFHYPGGTAGKSGARKPGVSSAADAGKRHRPGAQEVLIDPGALT-ANGISADTSTEIGRAKNCLSQE------------DIIEKYKEAISYY-----GKYKSAGVIELEACIKAVRVLAIQKRAMEASEFLQNAVYINLGQLSEEEKIQRYSVLSELYELIGFHR 401          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Zebrafish
Match: TRAPPC9 (si:dkey-218f9.10 [Source:ZFIN;Acc:ZDB-GENE-070705-374])

HSP 1 Score: 74.7146 bits (182), Expect = 7.826e-13
Identity = 59/217 (27.19%), Postives = 100/217 (46.08%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSEL---VVFLNDKSRQLISG--QLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFR 1708
            GR+ K   D  L  G   D+  +Y +A+  LR VND LWL  A EGLC + +++ +P  T          V    D  ++   G  ++  D   L+  N +++   ++    K   S +            ++ EKY   IS Y      K ++   I  ++ IKA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRSVNDFLWLGAALEGLCSASVIFHYPGGTAGKSGARKPGVSSAADAGKRHRPGAQEVLIDPGALT-ANGISADTSTEIGRAKNCLSQE------------DIIEKYKEAISYY-----GKYKSAGVIELEACIKAVRVLAIQKRAMEASEFLQNAVYINLGQLSEEEKIQRYSVLSELYELIGFHR 401          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Xenopus
Match: emc1 (ER membrane protein complex subunit 1 [Source:Xenbase;Acc:XB-GENE-1010282])

HSP 1 Score: 75.485 bits (184), Expect = 6.982e-13
Identity = 95/415 (22.89%), Postives = 170/415 (40.96%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDS----ELVVFLNDKSRQLISG--QLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSK-------SMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPI 2266
            GR+ K   D  L  G   D+  +Y +A+  LR VND +WL  A EGLC + +++ +P  T         + V    D  ++   G  ++  D   LS  N +N    ++    K   S D            ++ EKY   IS Y K   +K   +  I  ++ +KA R    Q R ++A+ FL+ +V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L + +         + + +  ++       LP ++      LP  L P++      +    KS FI++PI
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFVWLGAALEGLCSASVIHHYPGGTGGKAGTQRRQSVTLSADSFKRHRPGAQEVLIDPGALS-TNGINMDASTEIGRAKNCLSPD------------DIIEKYKEAISCYGK---SKAAGV--IELEACVKAVRVLAIQKRSMEASEFLQNVVYINLRQLSEEEKIQRYSVLSELYELIGFRR-----KSSFFKRVAAMQCVAPS-----IVEPGWKA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHKGWAAVQMRLLHELVYASRRMGNPALAVRHLSF-LLQTMLDFLSDQEKKDVAQSLESYTSKCPGTMDPITLPEGLILPPVPFTKLPIVRSVKLLDLPVILRPQKVKNLLGQKLSTKSPFIYSPI 576          

HSP 2 Score: 52.7582 bits (125), Expect = 6.503e-6
Identity = 32/118 (27.12%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  101 YKQSVFDHASLTIAVSLNGDENQKLNFDLLNQIRSNFDFINNRNSDIMKKIFFNYKQDFSSKEKEWENFQAHHRPFGLLFISEFKSGTDFKKILDLYISEKERLDASIYESRLIFIYN 454
            Y Q   DH +L + V   G    +  F + N++ S    +N  N+   + +F  Y+  +  +  EW +FQ H +  GL+ I+E  S  D    +  +  +KE   +++Y+SRL F++ 
Sbjct:    6 YMQCAEDHQTLLVVVQSIGVIKNENFFKIYNRVSSVCQ-VNPMNTQ--RLLFIRYRHQYPVENNEWGDFQTHRKVVGLISIAECGSARDLPPTILKFEQQKEAYSSTLYDSRL-FVFG 119          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Xenopus
Match: emc1 (ER membrane protein complex subunit 1 [Source:Xenbase;Acc:XB-GENE-1010282])

HSP 1 Score: 75.485 bits (184), Expect = 7.101e-13
Identity = 93/413 (22.52%), Postives = 165/413 (39.95%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDS----ELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSK-------SMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPI 2266
            GR+ K   D  L  G   D+  +Y +A+  LR VND +WL  A EGLC + +++ +P  T         + V    D  ++   G L T        N +N    ++    K   S D            ++ EKY   IS Y K     +     I  ++ +KA R    Q R ++A+ FL+ +V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L + +         + + +  ++       LP ++      LP  L P++      +    KS FI++PI
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFVWLGAALEGLCSASVIHHYPGGTGGKAGTQRRQSVTLSADSFKRHRPGALST--------NGINMDASTEIGRAKNCLSPD------------DIIEKYKEAISCYGKSKAAGV-----IELEACVKAVRVLAIQKRSMEASEFLQNVVYINLRQLSEEEKIQRYSVLSELYELIGFRR-----KSSFFKRVAAMQCVAPS-----IVEPGWKA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHKGWAAVQMRLLHELVYASRRMGNPALAVRHLSF-LLQTMLDFLSDQEKKDVAQSLESYTSKCPGTMDPITLPEGLILPPVPFTKLPIVRSVKLLDLPVILRPQKVKNLLGQKLSTKSPFIYSPI 567          

HSP 2 Score: 52.373 bits (124), Expect = 8.331e-6
Identity = 32/118 (27.12%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  101 YKQSVFDHASLTIAVSLNGDENQKLNFDLLNQIRSNFDFINNRNSDIMKKIFFNYKQDFSSKEKEWENFQAHHRPFGLLFISEFKSGTDFKKILDLYISEKERLDASIYESRLIFIYN 454
            Y Q   DH +L + V   G    +  F + N++ S    +N  N+   + +F  Y+  +  +  EW +FQ H +  GL+ I+E  S  D    +  +  +KE   +++Y+SRL F++ 
Sbjct:    6 YMQCAEDHQTLLVVVQSIGVIKNENFFKIYNRVSSVCQ-VNPMNTQ--RLLFIRYRHQYPVENNEWGDFQTHRKVVGLISIAECGSARDLPPTILKFEQQKEAYSSTLYDSRL-FVFG 119          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Xenopus
Match: emc1 (ER membrane protein complex subunit 1 [Source:Xenbase;Acc:XB-GENE-1010282])

HSP 1 Score: 75.485 bits (184), Expect = 7.440e-13
Identity = 94/415 (22.65%), Postives = 168/415 (40.48%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDS----ELVVFLNDKSRQLISG--QLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSK-------SMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPI 2266
            GR+ K   D  L  G   D+  +Y +A+  LR VND +WL  A EGLC + +++ +P  T         + V    D  ++   G  ++  D   LS  N +N    ++    K   S D            ++ EKY   IS Y K     +     I  ++ +KA R    Q R ++A+ FL+ +V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L + +         + + +  ++       LP ++      LP  L P++      +    KS FI++PI
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFVWLGAALEGLCSASVIHHYPGGTGGKAGTQRRQSVTLSADSFKRHRPGAQEVLIDPGALS-TNGINMDASTEIGRAKNCLSPD------------DIIEKYKEAISCYGKSKAAGV-----IELEACVKAVRVLAIQKRSMEASEFLQNVVYINLRQLSEEEKIQRYSVLSELYELIGFRR-----KSSFFKRVAAMQCVAPS-----IVEPGWKA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHKGWAAVQMRLLHELVYASRRMGNPALAVRHLSF-LLQTMLDFLSDQEKKDVAQSLESYTSKCPGTMDPITLPEGLILPPVPFTKLPIVRSVKLLDLPVILRPQKVKNLLGQKLSTKSPFIYSPI 576          

HSP 2 Score: 51.9878 bits (123), Expect = 9.642e-6
Identity = 32/118 (27.12%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  101 YKQSVFDHASLTIAVSLNGDENQKLNFDLLNQIRSNFDFINNRNSDIMKKIFFNYKQDFSSKEKEWENFQAHHRPFGLLFISEFKSGTDFKKILDLYISEKERLDASIYESRLIFIYN 454
            Y Q   DH +L + V   G    +  F + N++ S    +N  N+   + +F  Y+  +  +  EW +FQ H +  GL+ I+E  S  D    +  +  +KE   +++Y+SRL F++ 
Sbjct:    6 YMQCAEDHQTLLVVVQSIGVIKNENFFKIYNRVSSVCQ-VNPMNTQ--RLLFIRYRHQYPVENNEWGDFQTHRKVVGLISIAECGSARDLPPTILKFEQQKEAYSSTLYDSRL-FVFG 119          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Xenopus
Match: emc1 (ER membrane protein complex subunit 1 [Source:Xenbase;Acc:XB-GENE-1010282])

HSP 1 Score: 75.485 bits (184), Expect = 7.549e-13
Identity = 93/413 (22.52%), Postives = 165/413 (39.95%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDS----ELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSK-------SMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPI 2266
            GR+ K   D  L  G   D+  +Y +A+  LR VND +WL  A EGLC + +++ +P  T         + V    D  ++   G L T        N +N    ++    K   S D            ++ EKY   IS Y K     +     I  ++ +KA R    Q R ++A+ FL+ +V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L + +         + + +  ++       LP ++      LP  L P++      +    KS FI++PI
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFVWLGAALEGLCSASVIHHYPGGTGGKAGTQRRQSVTLSADSFKRHRPGALST--------NGINMDASTEIGRAKNCLSPD------------DIIEKYKEAISCYGKSKAAGV-----IELEACVKAVRVLAIQKRSMEASEFLQNVVYINLRQLSEEEKIQRYSVLSELYELIGFRR-----KSSFFKRVAAMQCVAPS-----IVEPGWKA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHKGWAAVQMRLLHELVYASRRMGNPALAVRHLSF-LLQTMLDFLSDQEKKDVAQSLESYTSKCPGTMDPITLPEGLILPPVPFTKLPIVRSVKLLDLPVILRPQKVKNLLGQKLSTKSPFIYSPI 567          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Xenopus
Match: emc1 (ER membrane protein complex subunit 1 [Source:Xenbase;Acc:XB-GENE-1010282])

HSP 1 Score: 75.0998 bits (183), Expect = 1.060e-12
Identity = 94/415 (22.65%), Postives = 168/415 (40.48%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDS----ELVVFLNDKSRQLISG--QLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSK-------SMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPI 2266
            GR+ K   D  L  G   D+  +Y +A+  LR VND +WL  A EGLC + +++ +P  T         + V    D  ++   G  ++  D   LS  N +N    ++    K   S D            ++ EKY   IS Y K     +     I  ++ +KA R    Q R ++A+ FL+ +V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L + +         + + +  ++       LP ++      LP  L P++      +    KS FI++PI
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFVWLGAALEGLCSASVIHHYPGGTGGKAGTQRRQSVTLSADSFKRHRPGAQEVLIDPGALS-TNGINMDASTEIGRAKNCLSPD------------DIIEKYKEAISCYGKSKAAGV-----IELEACVKAVRVLAIQKRSMEASEFLQNVVYINLRQLSEEEKIQRYSVLSELYELIGFRR-----KSSFFKRVAAMQCVAPS-----IVEPGWKA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHKGWAAVQMRLLHELVYASRRMGNPALAVRHLSF-LLQTMLDFLSDQEKKDVAQSLESYTSKCPGTMDPITLPEGLILPPVPFTKLPIVRSVKLLDLPVILRPQKVKNLLGQKLSTKSPFIYSPI 576          

HSP 2 Score: 52.373 bits (124), Expect = 9.156e-6
Identity = 32/118 (27.12%), Postives = 58/118 (49.15%), Query Frame = 2
Query:  101 YKQSVFDHASLTIAVSLNGDENQKLNFDLLNQIRSNFDFINNRNSDIMKKIFFNYKQDFSSKEKEWENFQAHHRPFGLLFISEFKSGTDFKKILDLYISEKERLDASIYESRLIFIYN 454
            Y Q   DH +L + V   G    +  F + N++ S    +N  N+   + +F  Y+  +  +  EW +FQ H +  GL+ I+E  S  D    +  +  +KE   +++Y+SRL F++ 
Sbjct:    6 YMQCAEDHQTLLVVVQSIGVIKNENFFKIYNRVSSVCQ-VNPMNTQ--RLLFIRYRHQYPVENNEWGDFQTHRKVVGLISIAECGSARDLPPTILKFEQQKEAYSSTLYDSRL-FVFG 119          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Mouse
Match: Trappc9 (trafficking protein particle complex 9 [Source:MGI Symbol;Acc:MGI:1923760])

HSP 1 Score: 78.9518 bits (193), Expect = 5.030e-14
Identity = 97/423 (22.93%), Postives = 174/423 (41.13%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKN----PPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLS-------KSMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPIKINSNFNRGQ 2296
            GR+ K   D  L  G   D+  +Y +++  LR VND LWL  A EGLC + ++Y +P  T              +R+L    L ++ +      N + P     + +   +S ++ +      PE     ++ +KY   IS Y     +K +N   I  ++ +KA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L N +       + + + D   +       LP ++      LP  L P +      +    KS FI++PI  +   NRG+
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGG---------KTGARRLQGSSLPSEAA------NRHRPGALTTNGINPDTSTEIGRAKNCLSPE-----DIIDKYKEAISYY-----SKYKNAGVIELEACVKAVRVLAIQKRGMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IAEPGWRA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF-LLQTMLDFLSDQEKKDVTQSLENYTAKCPGTMEPITLPDGLTLPPVPFTKLPIVRCVKLLSLPTSLRPHKVKSLLGQSMSTKSPFIYSPIIAH---NRGE 574          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Mouse
Match: Trappc9 (trafficking protein particle complex 9 [Source:MGI Symbol;Acc:MGI:1923760])

HSP 1 Score: 77.7962 bits (190), Expect = 9.307e-14
Identity = 99/425 (23.29%), Postives = 170/425 (40.00%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVL----SINNNMNSPDQSDFSFLKK--FSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLS-------KSMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPIKINSNFNRGQ 2296
            GR+ K   D  L  G   D+  +Y +++  LR VND LWL  A EGLC + ++Y +P  T        +  +    +  +      Q VL    ++  N  +PD S      K   S  D+              +KY   IS Y     +K +N   I  ++ +KA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L N +       + + + D   +       LP ++      LP  L P +      +    KS FI++PI  +   NRG+
Sbjct:   15 GRMRKHVGDLCLQAGMLQDALVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKTGARRLQGSSLPSEAANRHRPGAQEVLIDPGALTTNGINPDTSTEIGRAKNCLSPEDII-------------DKYKEAISYY-----SKYKNAGVIELEACVKAVRVLAIQKRGMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IAEPGWRA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF-LLQTMLDFLSDQEKKDVTQSLENYTAKCPGTMEPITLPDGLTLPPVPFTKLPIVRCVKLLSLPTSLRPHKVKSLLGQSMSTKSPFIYSPIIAH---NRGE 395          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Mouse
Match: Trappc9 (trafficking protein particle complex 9 [Source:MGI Symbol;Acc:MGI:1923760])

HSP 1 Score: 77.411 bits (189), Expect = 1.326e-13
Identity = 99/425 (23.29%), Postives = 170/425 (40.00%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVL----SINNNMNSPDQSDFSFLKK--FSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLS-------KSMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPIKINSNFNRGQ 2296
            GR+ K   D  L  G   D+  +Y +++  LR VND LWL  A EGLC + ++Y +P  T        +  +    +  +      Q VL    ++  N  +PD S      K   S  D+              +KY   IS Y     +K +N   I  ++ +KA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L N +       + + + D   +       LP ++      LP  L P +      +    KS FI++PI  +   NRG+
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKTGARRLQGSSLPSEAANRHRPGAQEVLIDPGALTTNGINPDTSTEIGRAKNCLSPEDII-------------DKYKEAISYY-----SKYKNAGVIELEACVKAVRVLAIQKRGMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IAEPGWRA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF-LLQTMLDFLSDQEKKDVTQSLENYTAKCPGTMEPITLPDGLTLPPVPFTKLPIVRCVKLLSLPTSLRPHKVKSLLGQSMSTKSPFIYSPIIAH---NRGE 583          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Mouse
Match: Trappc9 (trafficking protein particle complex 9 [Source:MGI Symbol;Acc:MGI:1923760])

HSP 1 Score: 74.3294 bits (181), Expect = 6.673e-13
Identity = 58/216 (26.85%), Postives = 102/216 (47.22%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKN----PPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFR 1708
            GR+ K   D  L  G   D+  +Y +++  LR VND LWL  A EGLC + ++Y +P  T              +R+L    L ++ +      N + P     + +   +S ++ +      PE     ++ +KY   IS Y     +K +N   I  ++ +KA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGG---------KTGARRLQGSSLPSEAA------NRHRPGALTTNGINPDTSTEIGRAKNCLSPE-----DIIDKYKEAISYY-----SKYKNAGVIELEACVKAVRVLAIQKRGMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR 393          
BLAST of ATP-dependent DNA helicase PIF1 vs. UniProt/SwissProt
Match: sp|Q3U0M1|TPPC9_MOUSE (Trafficking protein particle complex subunit 9 OS=Mus musculus OX=10090 GN=Trappc9 PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 7.690e-13
Identity = 99/425 (23.29%), Postives = 170/425 (40.00%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVL----SINNNMNSPDQSDFSFLKK--FSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLS-------KSMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPIKINSNFNRGQ 2296
            GR+ K   D  L  G   D+  +Y +++  LR VND LWL  A EGLC + ++Y +P  T        +  +    +  +      Q VL    ++  N  +PD S      K   S  D+              +KY   IS Y     +K +N   I  ++ +KA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L N +       + + + D   +       LP ++      LP  L P +      +    KS FI++PI  +   NRG+
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKTGARRLQGSSLPSEAANRHRPGAQEVLIDPGALTTNGINPDTSTEIGRAKNCLSPEDII-------------DKYKEAISYY-----SKYKNAGVIELEACVKAVRVLAIQKRGMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IAEPGWRA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF-LLQTMLDFLSDQEKKDVTQSLENYTAKCPGTMEPITLPDGLTLPPVPFTKLPIVRCVKLLSLPTSLRPHKVKSLLGQSMSTKSPFIYSPIIAH---NRGE 583          
BLAST of ATP-dependent DNA helicase PIF1 vs. UniProt/SwissProt
Match: sp|Q32PH0|TPPC9_BOVIN (Trafficking protein particle complex subunit 9 OS=Bos taurus OX=9913 GN=TRAPPC9 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.011e-12
Identity = 64/219 (29.22%), Postives = 100/219 (45.66%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQA-------LDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFR 1708
            GR+ K   D  L  G   DS  +Y +++  LR VND LWL  A EGLC + ++Y +P  T           S L     ++ R    G L T        N +N+   ++    K   S       PE     ++ EKY   IS Y     +K +N   I  ++ +KA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R
Sbjct:  203 GRMRKHVGDLCLQAGMLQDSLVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKAGARRFPGSALPAEAANRHR---PGALTT--------NGINADTSTEIGRAKNCLS-------PE-----DIIEKYKEAISYY-----SKYKNAGVIELEACVKAVRVLAIQKRSMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR 393          

HSP 2 Score: 54.6842 bits (130), Expect = 9.012e-6
Identity = 32/118 (27.12%), Postives = 64/118 (54.24%), Query Frame = 2
Query:  101 YKQSVFDHASLTIAVSLNGDENQKLNFDLLNQIRSNFDFINNRNSDIMKKIFFNYKQDFSSKEKEWENFQAHHRPFGLLFISEFKSGTDFKKILDLYISEKERLDASIYESRLIFIYN 454
            Y Q   DH +L + V   G  +++  F +  +I S+   I+ R+S   + ++  Y+  +  +  EW +FQ H +  GL+ I++  S  D+ +I + +  +KE   +++Y+SRL F++ 
Sbjct:    6 YMQCAEDHQTLLVVVQPVGIVSEENFFRIYKRI-SSVSQISVRDSQ--RALYIRYRHHYPPENSEWGDFQTHRKVVGLITITDCFSAKDWPQIFEKFHVQKEIYGSTLYDSRL-FVFG 119          
BLAST of ATP-dependent DNA helicase PIF1 vs. UniProt/SwissProt
Match: sp|Q96Q05|TPPC9_HUMAN (Trafficking protein particle complex subunit 9 OS=Homo sapiens OX=9606 GN=TRAPPC9 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 2.410e-12
Identity = 101/425 (23.76%), Postives = 166/425 (39.06%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVL----SINNNMNSPDQSDFSFLKK--FSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASV-------MNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPIKINSNFNRGQ 2296
            GR+ K   D  L  G   DS  +Y +++  LR VND LWL  A EGLC + ++Y +P  T           +    +  +      Q VL    ++  N  +PD S      K   S  D+              +KY   IS Y     +K +N   I  ++ IKA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     +  G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L N +         + L   +         LP ++      LP  L P +      +    KS FI++PI  +   NRG+
Sbjct:  203 GRMRKHVGDLCLQAGMLQDSLVHYHMSVELLRSVNDFLWLGAALEGLCSASVIYHYPGGTGGKSGARRFQGSTLPAEAANRHRPGAQEVLIDPGALTTNGINPDTSTEIGRAKNCLSPEDII-------------DKYKEAISYY-----SKYKNAGVIELEACIKAVRVLAIQKRSMEASEFLQNAVYINLRQLSEEEKIQRYSILSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IAEPGWRA-----------CYKLLLETLPGYSLSLDPKDFS-RGTHRGWAAVQMRLLHELVYASRRMGNPALSVRHLSF-LLQTMLDFLSDQEKKDVAQSLENYTSKCPGTMEPIALPGGLTLPPVPFTKLPIVRHVKLLNLPASLRPHKMKSLLGQNVSTKSPFIYSPIIAH---NRGE 583          
BLAST of ATP-dependent DNA helicase PIF1 vs. UniProt/SwissProt
Match: sp|Q6PA97|TPPC9_XENLA (Trafficking protein particle complex subunit 9 OS=Xenopus laevis OX=8355 GN=trappc9 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.538e-12
Identity = 94/415 (22.65%), Postives = 167/415 (40.24%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQA-----LDSELVVFLNDKSRQLISGQ-LKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSK-------SMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQP----SKPCKEKSVFIFTPI 2266
            GR+ K   D  L  G   D+  +Y +A+  LR VND +WL  A EGLC + +++ +P  T       L   + +  +   R     Q +  D   LS  N +N    ++    K   S D            ++ EKY   IS Y K     +     I  ++ +KA R    Q + +DA+ FL+ +V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA       I E  +             C  L  E + G  LSL     + +G  +G+ +++M ++ EL    + +      +  L   +L      +   E + + + L + +         + + +  ++       LP ++      LP  L P++      +    KS FI++PI
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFVWLGAALEGLCSASVIHHYPGGTGGKAGTQLRQSVTMSADSFKRHRPGAQEVLIDPGALS-TNGINMDASTEIGRAKNCLSPD------------DIIEKYKEAISYYGKSKAAGV-----IELEACVKAVRVLAIQKKSMDASEFLQNVVYINLRQLSEEEKIQRYSVLSELYELIGFHR-----KSAFFKRVAAMQCVAPS-----IVEPGWKA-----------CYKLLLETLPGYSLSLDPKDFS-KGTHKGWAAVQMRLLHELVYASRRMGNPALAVRHLSF-LLQTMLDFLSDQEKKDVAQSLESYTSKCPGTMDPITLPEGLVLPPVPFTKLPIVRSVKLLDLPVILRPQKVKNLLGQKLSTKSPFIYSPI 576          
BLAST of ATP-dependent DNA helicase PIF1 vs. TrEMBL
Match: V3ZRV9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_130513 PE=4 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 1.509e-25
Identity = 120/459 (26.14%), Postives = 203/459 (44.23%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLK-TDQSVLSINNNMNSPDQSDFSFLKKFSSNDL--FKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKIQNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNL-------SKSMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIP-KQPSKPCKEKSVFIFTPI-KINSNFNRGQSAEPVIWICGEECEIVLIFDNLIYLPIHLSNVAFQLTNTE 2416
            GRL K  AD  L  G   ++  +YQ AI  LR VND LW+ G  EGL  S ++   P  + A                I   L  TD+ + +IN + N   +++FS +   +  DL    N P + N  ++ EKY   I+ Y     +K +    I  ++ +KA R  +GQ ++L A++FL+ +V  DL   + DK Q   TLA LY+Q+GF R     K      +    CVA    +   ++Q + +L+  L    +             +L   N    G   ++G+ +L+  I+ EL    + +      +  +   +L   F  +   E  + +  L +L       ++S+ + + Q++    +   P +K      LP +L P ++ + P K+  VFIFTPI + + + N  QS    +W+  E CE+ L   N +   + +S +A      E
Sbjct:  208 GRLRKHLADLCLQAGMPGEAILHYQTAIDLLRNVNDFLWIGGCYEGLSSSSVIMAHPKISAAAS--------------IKRNLSFTDKRMAAINLDKNKAGRTNFSGVGFANGLDLADIPNGPGL-NPEDIIEKYREAITHY-----SKFKTAGKIEMEASLKACRVLIGQRKYLQASDFLQNVVYIDLKVSEEDKIQRFGTLATLYTQIGFHR-----KAGFFKRIAGMQCVAP---QTSAWQQCYQLLLQTLQGYKI-------------FLETRNTQTTGSDSNKGWPTLRHRILTELVYAARRMGNPQLAVRHMSF-LLHTMFEHLSTAERREAVTGLMSLTSKCEGSAQSIALDNGQILPPVPLTKFPLVKSFTIMNLPPHLQPIEKNTDPNKKPDVFIFTPIQQTDKDSNSLQSKVSFVWVKDEICEVELYVVNPLPDELRISYMALLTEGVE 624          
BLAST of ATP-dependent DNA helicase PIF1 vs. TrEMBL
Match: A0A026WDD9 (Protein brunelleschi OS=Ooceraea biroi OX=2015173 GN=X777_05939 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.337e-20
Identity = 126/489 (25.77%), Postives = 214/489 (43.76%), Query Frame = 2
Query: 1049 NKNNKSRLYLGRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFL-KMVKSDLLKIQNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDI-LNDLNV---KCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLAL-GLSILDNWFHLIPRDEYEKMIRELNNLSKS-------MLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQPSKPCKEKSVFIFTPIKINS--NFNRGQSAEPVIWICGEECEIVLIFDNLIYLPIHLSNVAFQLTNT----ETGSQVWLPSEGSSI 2458
            ++NNK R  +GR+ K   D  L  G   D+   Y  A   L+ VND LWL  A EGLC + +L  +PN  ++L  +    L + S    S Q +  Q++ ++      P       +K         N P I    E+S+KY   I  Y K     I     I  ++  KA+R  + Q+  L AA++L  +V  +L   + +K     TL+ LY+  GF                         DRK  +  R +    +  N+ N    +C +L  +  SG  LSL   ++   G  +G+  +++ ++ EL +     N   N  LA   L+ L  + HL P DE ++   +L N+S+        +++    ++  A+++N+PK K    + +  +L P++  +  ++   F+FTPI   S    N  +S    +W+ G+ CE+ +   N +   +H+SN+   LTN          + LP+E   I
Sbjct:  225 SRNNKKRC-VGRMTKHLGDLCLQAGLPSDALNNYNSAANILQAVNDWLWLGAAYEGLCAASVLVLYPNMCRSLPLQRNSSLQEGSP---SKQRRESQAIAAL------PSPPSIEVVK--------ANMPHILLPEEISKKYREAIVHYSKYQYAGI-----IETEASFKATRISIEQNCTLQAASYLNNVVLINLHLSEQEKIDRFTTLSDLYTSFGF-------------------------DRKASFCLRLAATRHVSQNNPNPDWQQCYNLMLQATSGFKLSLDPVNMPPAG-QKGWPIIQIQVINELVAAA---NRMGNPALATRHLTFLTMYNHLTP-DERKETALQLQNVSQQCEGAPVPLVLDSGTVIPPANLLNIPKTKSFSLKNMQPHLQPQKIERVKEDHGPFLFTPINFGSLERKNTSKSKVDYLWVEGDICEVSMQLINPLPFELHVSNMRL-LTNGVVFESIPESISLPAESGPI 659          
BLAST of ATP-dependent DNA helicase PIF1 vs. TrEMBL
Match: A0A2J7Q972 (Uncharacterized protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G01987 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 2.898e-20
Identity = 106/421 (25.18%), Postives = 186/421 (44.18%), Query Frame = 2
Query: 1049 NKNNKSRLYLGRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNL---SELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKIQNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASVM-------NLPKLKQTIFRKLPDYLIPKQPSKPCKEKSVFIFTPIKINS 2278
            +++N+ R  +GR+ K   D SL  G   ++  YY  A+  L+ VND LWL GA EGLC + ++  +PN +++   +    L + S           Q   SI+ N         S     S  +L +   E+QN+    ++ ++Y   I  Y K L   I     I  ++  KA+R  V Q   L A+ FL+ ++  +L   + +K Q   +L+ LY+Q+GF R                 C      R+L   +  S      N    +C  L  + +SG+ LSL        G  QG+ +L++ ++ EL    + + ++      +   +   W HL+P ++ + +  +L  L+         +VLN+ ++       NLP+++  + R L   L P++  K  ++   F+FTPI   S
Sbjct:  269 SRSNRKRC-VGRMTKHLGDLSLQAGLVTEALSYYSSAVDILKAVNDWLWLGGAYEGLCAASVILLYPNLSRSFPLQRNASLQEGS--------PGKQRSSSISTN---------SLPSGMSPAELQQ---EVQNVLSPEDIPKRYREAIIHYSKYLNAGI-----IEMEACFKAARIAVEQGGTLQASTFLQNVIFINLTLSETEKIQRFTSLSDLYTQIGFHR-------------KASFC------RRLAATRHVSAQNPQPN--WSQCYQLMLQALSGHKLSLDPTEFPRGGL-QGWPALQIQLLQELVVAARRMGHTALATRHMTFLLQTMWEHLLPTEQRD-LALQLQVLAAQCEGAPVPLVLNSGIVIPPANLTNLPQIRSFVLRNLEPQLRPQKIEKLKEDSGPFLFTPIHFGS 640          
BLAST of ATP-dependent DNA helicase PIF1 vs. TrEMBL
Match: A0A2J7Q982 (Protein brunelleschi OS=Cryptotermes secundus OX=105785 GN=B7P43_G01987 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.196e-20
Identity = 106/421 (25.18%), Postives = 186/421 (44.18%), Query Frame = 2
Query: 1049 NKNNKSRLYLGRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNL---SELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKIQNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASVM-------NLPKLKQTIFRKLPDYLIPKQPSKPCKEKSVFIFTPIKINS 2278
            +++N+ R  +GR+ K   D SL  G   ++  YY  A+  L+ VND LWL GA EGLC + ++  +PN +++   +    L + S           Q   SI+ N         S     S  +L +   E+QN+    ++ ++Y   I  Y K L   I     I  ++  KA+R  V Q   L A+ FL+ ++  +L   + +K Q   +L+ LY+Q+GF R                 C      R+L   +  S      N    +C  L  + +SG+ LSL        G  QG+ +L++ ++ EL    + + ++      +   +   W HL+P ++ + +  +L  L+         +VLN+ ++       NLP+++  + R L   L P++  K  ++   F+FTPI   S
Sbjct:  224 SRSNRKRC-VGRMTKHLGDLSLQAGLVTEALSYYSSAVDILKAVNDWLWLGGAYEGLCAASVILLYPNLSRSFPLQRNASLQEGS--------PGKQRSSSISTN---------SLPSGMSPAELQQ---EVQNVLSPEDIPKRYREAIIHYSKYLNAGI-----IEMEACFKAARIAVEQGGTLQASTFLQNVIFINLTLSETEKIQRFTSLSDLYTQIGFHR-------------KASFC------RRLAATRHVSAQNPQPN--WSQCYQLMLQALSGHKLSLDPTEFPRGGL-QGWPALQIQLLQELVVAARRMGHTALATRHMTFLLQTMWEHLLPTEQRD-LALQLQVLAAQCEGAPVPLVLNSGIVIPPANLTNLPQIRSFVLRNLEPQLRPQKIEKLKEDSGPFLFTPIHFGS 595          
BLAST of ATP-dependent DNA helicase PIF1 vs. TrEMBL
Match: A0A0J7KQ70 (Protein brunelleschi-like protein OS=Lasius niger OX=67767 GN=RF55_7506 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 3.271e-20
Identity = 151/630 (23.97%), Postives = 271/630 (43.02%), Query Frame = 2
Query: 1049 NKNNKSRLYLGRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFL-KMVKSDLLKIQNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDI-LNDLNV---KCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKS-------MLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQPSKPCKEKSVFIFTPIKINS--NFNRGQSAEPVIWICGEECEIVLIFDNLIYLPIHLSNVAFQLTNTETGSQVWLPSEGSSIHYLPAHDKNINCHFVIVPNPQRIS----LGXXXXXXXXXXXXXXXXXLFQPHKLVTDVVLQSTSVPEIKLYPMMPQLRIMSSISETMNNSNFNLCKYPLNTIFCSNIDLYLNEILEFSLFLSNESKELDIDQIVCIIDELELNISS 2884
            ++NNK R  +GR+ K   D  L  G   D+   Y  A   L+ VND LWL  A EGLC + +L  +PN  ++L  +    L + S    S Q +  Q++ ++      P       +K    + L    PE     E+S+KY   I  Y K     I     I  ++  KA+R  + Q+  L AA++L  +V  +L   + +K     TL+ LY+  GF                         DRK  +  R +    +  N+ N    +C +L  +  SG  LSL    ++ +G  +G+ ++++ I+ EL +    +         L   +L   ++ +   E + +  +L N+S+        +++    ++  A+++N+PK K  I R +  +L P++  +  ++   F+FTPI   S    N  +S    +W+ G+ CE+ +   N +   +H+SN+   LTN      V   S   SI  LPA    I     +   P+ I     LG    T    S   + ++    H   T           +++ P +P++ + +S+ +T + S+ +      N +  ++I LY  E  E ++ ++N      I Q+   I+ +EL++ S
Sbjct:  208 SRNNKKRC-VGRMTKHLGDLCLQAGLPADALNNYNSAANILQAVNDWLWLGAAYEGLCAASVLVLYPNMCRSLPLQRNSSLQEGSP---SKQRRGSQAIATV-----LPSPPSIEIVKASMPHILL---PE-----EISKKYREAIVHYSKYQYAGI-----IETEASFKATRISIEQNCTLQAASYLNNVVLINLPLSEQEKIDRFTTLSDLYTSFGF-------------------------DRKASFCLRLAATRHVSQNNPNPDWQQCYNLMLQATSGFKLSLDPVDMSPDG-QRGWPAIQIQIINELVAAANRMGNPALATRHLTF-LLQTMYNHLTSIERKDIALQLQNVSQQCEGAPVPLVLDSGTVIPPANLLNIPKTKSFILRNMQPHLQPQKIERIKEDHGPFLFTPINFGSLERKNTSKSKVDYLWVEGDVCEVSMQLINPLPFELHVSNMRL-LTNG-----VVFESIPESIS-LPAESGPIA--VTLAGRPKEIGDLEILGFSTHTLGVKSNCRLRHMEGMLHPQYT-----------VEVIPALPRIDVATSLPQTASFSSGD------NIVTSASISLYGGESAECTITITN------IGQVP--IEMVELSVQS 754          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Cavefish
Match: si:dkey-218f9.10 (trafficking protein particle complex 9 [Source:HGNC Symbol;Acc:HGNC:30832])

HSP 1 Score: 86.2705 bits (212), Expect = 2.083e-16
Identity = 100/423 (23.64%), Postives = 171/423 (40.43%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSEL---VVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVK-CTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSI------LDNWFHLIPRDEYEKMIRELNNLSKS-------MLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQ----PSKPCKEKSVFIFTPIKINS 2278
            GR+ K   D  L  G   D+  +Y +A+  LR VND LWL  A EGLC + +++ +P  T    S     +    D  ++   G L T        + +++   S+    K   S +            ++ EKY   IS Y      K +N   I  ++ +KA R    Q R ++A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R     K      +    CVA                   + D   K C  L  E + G  LSL     + +G  +G+ +++M ++ EL        Y++  +   GLS+      L      +   E +++ + L N +         + + D   +       LP +K      LP  L P +    P +     S FI++PI ++S
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRSVNDFLWLGAALEGLCSASVIFHYPGGTAGKSSARKPSISTATDTGKRHRPGALTT--------SGISADTSSEIGRAKNCLSQE------------DIIEKYKEAISYY-----GKYKNAGVIELEACVKAVRVLAIQKRAMEASEFLQNAVYINLGQLSEEEKIQRYSVLSELYELIGFHR-----KSAFFKRVAAMQCVAP-----------------TIPDPGWKACYRLLLETLPGYSLSLDPKDFS-KGTHRGWAAVQMRLLHELV-------YASRRMGNPGLSVRHLSFLLQTMLDFLSDQEKKEVTQSLENYTSKCPGGMNVITLPDGLKLPPVPFTKLPIVKSVSLLNLPASLRPHKVKGLPGQGVATASPFIYSPITLHS 570          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Medaka
Match: si:dkey-218f9.10 (trafficking protein particle complex 9 [Source:NCBI gene;Acc:101164574])

HSP 1 Score: 73.9442 bits (180), Expect = 1.314e-12
Identity = 61/217 (28.11%), Postives = 102/217 (47.00%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSEL---VVFLNDKSRQLISG--QLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFR 1708
            GR+ K   D  L  G   D+  +Y +A+  LR VND LWL GA EGLC + +++ +P  T    +     V    D  ++   G  ++  D   L+  + +++   ++    K   S       PE     ++ EKY   IS Y      K +N   I  ++ +KA R    Q R  +A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFLWLGGALEGLCSASVIFHYPGGTAGKAAGCKPSVCQPVDAGKRHRPGAQEVLIDPGALT-ASGISADTSAEIGRAKNCLS-------PE-----DIIEKYKEAISYY-----GKHKNAGVIELEACVKAVRVLAIQKRAREASEFLQNAVYINLGQLSEEEKIQRYSILSELYELIGFHR 401          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Medaka
Match: si:dkey-218f9.10 (trafficking protein particle complex 9 [Source:NCBI gene;Acc:101164574])

HSP 1 Score: 73.559 bits (179), Expect = 1.393e-12
Identity = 61/217 (28.11%), Postives = 102/217 (47.00%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSEL---VVFLNDKSRQLISG--QLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFR 1708
            GR+ K   D  L  G   D+  +Y +A+  LR VND LWL GA EGLC + +++ +P  T    +     V    D  ++   G  ++  D   L+  + +++   ++    K   S       PE     ++ EKY   IS Y      K +N   I  ++ +KA R    Q R  +A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFLWLGGALEGLCSASVIFHYPGGTAGKAAGCKPSVCQPVDAGKRHRPGAQEVLIDPGALT-ASGISADTSAEIGRAKNCLS-------PE-----DIIEKYKEAISYY-----GKHKNAGVIELEACVKAVRVLAIQKRAREASEFLQNAVYINLGQLSEEEKIQRYSILSELYELIGFHR 401          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Medaka
Match: si:dkey-218f9.10 (trafficking protein particle complex 9 [Source:NCBI gene;Acc:101164574])

HSP 1 Score: 73.1738 bits (178), Expect = 1.790e-12
Identity = 60/215 (27.91%), Postives = 98/215 (45.58%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSEL---VVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFR 1708
            GR+ K   D  L  G   D+  +Y +A+  LR VND LWL GA EGLC + +++ +P  T    +     V    D  ++   G L          + +++   ++    K   S       PE     ++ EKY   IS Y      K +N   I  ++ +KA R    Q R  +A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFLWLGGALEGLCSASVIFHYPGGTAGKAAGCKPSVCQPVDAGKRHRPGALTA--------SGISADTSAEIGRAKNCLS-------PE-----DIIEKYKEAISYY-----GKHKNAGVIELEACVKAVRVLAIQKRAREASEFLQNAVYINLGQLSEEEKIQRYSILSELYELIGFHR 392          
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Medaka
Match: si:dkey-218f9.10 (trafficking protein particle complex 9 [Source:NCBI gene;Acc:101164574])

HSP 1 Score: 73.1738 bits (178), Expect = 2.297e-12
Identity = 60/215 (27.91%), Postives = 98/215 (45.58%), Query Frame = 2
Query: 1079 GRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSEL---VVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLK-MVKSDLLKI-QNDKEQYHNTLAQLYSQMGFFR 1708
            GR+ K   D  L  G   D+  +Y +A+  LR VND LWL GA EGLC + +++ +P  T    +     V    D  ++   G L          + +++   ++    K   S       PE     ++ EKY   IS Y      K +N   I  ++ +KA R    Q R  +A+ FL+  V  +L ++ + +K Q ++ L++LY  +GF R
Sbjct:  203 GRMRKHVGDLCLQAGMLQDALVHYHMAVELLRAVNDFLWLGGALEGLCSASVIFHYPGGTAGKAAGCKPSVCQPVDAGKRHRPGALTA--------SGISADTSAEIGRAKNCLS-------PE-----DIIEKYKEAISYY-----GKHKNAGVIELEACVKAVRVLAIQKRAREASEFLQNAVYINLGQLSEEEKIQRYSILSELYELIGFHR 392          
BLAST of ATP-dependent DNA helicase PIF1 vs. Planmine SMEST
Match: SMESG000079839.1 (SMESG000079839.1)

HSP 1 Score: 2631.28 bits (6819), Expect = 0.000e+0
Identity = 1401/1404 (99.79%), Postives = 1402/1404 (99.86%), Query Frame = 2
Query:   83 MSYTVYYKQSVFDHASLTIAVSLNGDENQKLNFDLLNQIRSNFDFINNRNSDIMKKIFFNYKQDFSSKEKEWENFQAHHRPFGLLFISEFKSGTDFKKILDLYISEKERLDASIYESRLIFIYNENTKSFGNFIKRTLNTNGDISSSVDSETGEMVLGDVLCTDFSEELKYIQDCFIQNELIWQCRSTIRVSRMNSTIXXXXXXXXXXXXXWKINSLSSENPTQLSPPCDNSLKSFETTSFEEKSFDSEIRNFLKSIFEKVLYSLNSREAFLNNKLEQTRNKQSNIEAXXXXXXXXXXXXXEFNLSDPXXXXXXXXQEESRFNKNNKSRLYLGRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLKMVKSDLLKIQNDKEQYHNTLAQLYSQMGFFRXXXXXXXXXXXXXXXXXCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQPSKPCKEKSVFIFTPIKINSNFNRGQSAEPVIWICGEECEIVLIFDNLIYLPIHLSNVAFQLTNTETGSQVWLPSEGSSIHYLPAHDKNINCHFVIVPNPQRISLGXXXXXXXXXXXXXXXXXLFQPHKLVTDVVLQSTSVPEIKLYPMMPQLRIMSSISETMNNSNFNLCKYPLNTIFCSNIDLYLNEILEFSLFLSNESKELDIDQIVCIIDELELNISSKTLISRFADQEFSNRKSSIHRLLSFPVNSLEKFLPIKSINSLKDYVNLNSDNLSLPTDAIVKFRIDTTNEEFNHELLERFSMSDPENLEVLWSGQLKLTVQYWSNHITNYXXXXXXXXXXXXXXXXXXQKENLPLSNTYRESVCLFNCQIMTGLSLINFYLDDQLNLVLSLMNFTRNKMNVEIFWRDVKIQKSYIVTPSNDYRADFCDSKQMHRNSSTELFSHISNLVIPFEVLSLKSTMDEGFIKSEEDLTRYIQKYLKISWIMKDKTLDKVRQGFVNLTWCNCYISQSAFKNVSGSELGHRVLFSTNDLIKIWMHENVKLEMQFVYNEPTTPVLPDETGITIHLYDGIEYDILCSFKDEWPSFMCESHLTSITLLPCASSNKISTPSFSSSESDNGKLQRFLFAGNNIVYLQKNSIPLTRMRGFIMFLLPGSYCVSCQLVISDSVDCHKVFTNIFVLFESEKHQINVI 4294
            MSYTVYYKQSVFDHASLTIAVSLNGDENQKLNFDLLNQIRSNFDFINNRNSDIMKKIFFNYKQDFSSKEKEWENFQAHHRPFGLLFISEFKSGTDFKKILDLYISEKERLDASIYESRLIFIYNENTKSFGNFIKRTLNTNGDISSSVDSETGEMVLGDVLCTDFSEELKYIQDCFIQNELIWQCRSTIRVSRMNSTISLNGSSCSSVSNNWKINSLSSENPTQL PPCDNSLKSFETTSFEEKSFDSEIRNFLKSIFEKVLYSLNSREAFLNNKLEQTRNKQSNIEAVSDSGSVVSLDDGEFNLSDPLDLDLKKLQEESRFNKNNKSRLYLGRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLKMVKSDLLKIQNDKEQYHNTLAQLYSQMGFFRKSSLHKYKKSLLMHHKLCVAKGPDRKLIYEQRFSVLIDILNDLNVK TDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQPSKPCKEKSVFIFTPIKINSNFNRGQSAEPVIWICGEECEIVLIFDNLIYLPIHLSNVAFQLT+TETGSQVWLPSEGSSIHYLPAHDKNINCHFVIVPNPQRISLGNYNITNISYSITSIANILFQPHKLVTDVVLQSTSVPEIKLYPMMPQLRIMSSISETMNNSNFNLCKYPLNTIFCSNIDLYLNEILEFSLFLSNESKELDIDQIVCIIDELELNISSKTLISRFADQEFSNRKSSIHRLLSFPVNSLEKFLPIKSINSLKDYVNLNSDNLSLPTDAIVKFRIDTTNEEFNHELLERFSMSDPENLEVLWSGQLKLTVQYWSNHITNYDSNDNISVNSDVDDVVVVQKENLPLSNTYRESVCLFNCQIMTGLSLINFYLDDQLNLVLSLMNFTRNKMNVEIFWRDVKIQKSYIVTPSNDYRADFCDSKQMHRNSSTELFSHISNLVIPFEVLSLKSTMDEGFIKSEEDLTRYIQKYLKISWIMKDKTLDKVRQGFVNLTWCNCYISQSAFKNVSGSELGHRVLFSTNDLIKIWMHENVKLEMQFVYNEPTTPVLPDETGITIHLYDGIEYDILCSFKDEWPSFMCESHLTSITLLPCASSNKISTPSFSSSESDNGKLQRFLFAGNNIVYLQKNSIPLTRMRGFIMFLLPGSYCVSCQLVISDSVDCHKVFTNIFVLFESEKHQINVI
Sbjct:    1 MSYTVYYKQSVFDHASLTIAVSLNGDENQKLNFDLLNQIRSNFDFINNRNSDIMKKIFFNYKQDFSSKEKEWENFQAHHRPFGLLFISEFKSGTDFKKILDLYISEKERLDASIYESRLIFIYNENTKSFGNFIKRTLNTNGDISSSVDSETGEMVLGDVLCTDFSEELKYIQDCFIQNELIWQCRSTIRVSRMNSTISLNGSSCSSVSNNWKINSLSSENPTQLLPPCDNSLKSFETTSFEEKSFDSEIRNFLKSIFEKVLYSLNSREAFLNNKLEQTRNKQSNIEAVSDSGSVVSLDDGEFNLSDPLDLDLKKLQEESRFNKNNKSRLYLGRLNKQTADYSLLCGNYLDSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELVVFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKNPPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQHRFLDAANFLKMVKSDLLKIQNDKEQYHNTLAQLYSQMGFFRKSSLHKYKKSLLMHHKLCVAKGPDRKLIYEQRFSVLIDILNDLNVKFTDLFNEKVSGNWLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSILDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASVMNLPKLKQTIFRKLPDYLIPKQPSKPCKEKSVFIFTPIKINSNFNRGQSAEPVIWICGEECEIVLIFDNLIYLPIHLSNVAFQLTSTETGSQVWLPSEGSSIHYLPAHDKNINCHFVIVPNPQRISLGNYNITNISYSITSIANILFQPHKLVTDVVLQSTSVPEIKLYPMMPQLRIMSSISETMNNSNFNLCKYPLNTIFCSNIDLYLNEILEFSLFLSNESKELDIDQIVCIIDELELNISSKTLISRFADQEFSNRKSSIHRLLSFPVNSLEKFLPIKSINSLKDYVNLNSDNLSLPTDAIVKFRIDTTNEEFNHELLERFSMSDPENLEVLWSGQLKLTVQYWSNHITNYDSNDNISVNSDVDDVVVVQKENLPLSNTYRESVCLFNCQIMTGLSLINFYLDDQLNLVLSLMNFTRNKMNVEIFWRDVKIQKSYIVTPSNDYRADFCDSKQMHRNSSTELFSHISNLVIPFEVLSLKSTMDEGFIKSEEDLTRYIQKYLKISWIMKDKTLDKVRQGFVNLTWCNCYISQSAFKNVSGSELGHRVLFSTNDLIKIWMHENVKLEMQFVYNEPTTPVLPDETGITIHLYDGIEYDILCSFKDEWPSFMCESHLTSITLLPCASSNKISTPSFSSSESDNGKLQRFLFAGNNIVYLQKNSIPLTRMRGFIMFLLPGSYCVSCQLVISDSVDCHKVFTNIFVLFESEKHQINVI 1404          
The following BLAST results are available for this feature:
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
TRAPPC93.503e-1322.93trafficking protein particle complex 9 [Source:HGN... [more]
TRAPPC94.116e-1323.76trafficking protein particle complex 9 [Source:HGN... [more]
TRAPPC96.361e-1323.94trafficking protein particle complex 9 [Source:HGN... [more]
TRAPPC96.361e-1323.94trafficking protein particle complex 9 [Source:HGN... [more]
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRAPPC96.437e-1327.19si:dkey-218f9.10 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
TRAPPC97.826e-1327.19si:dkey-218f9.10 [Source:ZFIN;Acc:ZDB-GENE-070705-... [more]
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
emc16.982e-1322.89ER membrane protein complex subunit 1 [Source:Xenb... [more]
emc17.101e-1322.52ER membrane protein complex subunit 1 [Source:Xenb... [more]
emc17.440e-1322.65ER membrane protein complex subunit 1 [Source:Xenb... [more]
emc17.549e-1322.52ER membrane protein complex subunit 1 [Source:Xenb... [more]
emc11.060e-1222.65ER membrane protein complex subunit 1 [Source:Xenb... [more]
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Trappc95.030e-1422.93trafficking protein particle complex 9 [Source:MGI... [more]
Trappc99.307e-1423.29trafficking protein particle complex 9 [Source:MGI... [more]
Trappc91.326e-1323.29trafficking protein particle complex 9 [Source:MGI... [more]
Trappc96.673e-1326.85trafficking protein particle complex 9 [Source:MGI... [more]
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q3U0M1|TPPC9_MOUSE7.690e-1323.29Trafficking protein particle complex subunit 9 OS=... [more]
sp|Q32PH0|TPPC9_BOVIN2.011e-1229.22Trafficking protein particle complex subunit 9 OS=... [more]
sp|Q96Q05|TPPC9_HUMAN2.410e-1223.76Trafficking protein particle complex subunit 9 OS=... [more]
sp|Q6PA97|TPPC9_XENLA2.538e-1222.65Trafficking protein particle complex subunit 9 OS=... [more]
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZRV91.509e-2526.14Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A026WDD91.337e-2025.77Protein brunelleschi OS=Ooceraea biroi OX=2015173 ... [more]
A0A2J7Q9722.898e-2025.18Uncharacterized protein OS=Cryptotermes secundus O... [more]
A0A2J7Q9823.196e-2025.18Protein brunelleschi OS=Cryptotermes secundus OX=1... [more]
A0A0J7KQ703.271e-2023.97Protein brunelleschi-like protein OS=Lasius niger ... [more]
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-218f9.102.083e-1623.64trafficking protein particle complex 9 [Source:HGN... [more]
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:dkey-218f9.101.314e-1228.11trafficking protein particle complex 9 [Source:NCB... [more]
si:dkey-218f9.101.393e-1228.11trafficking protein particle complex 9 [Source:NCB... [more]
si:dkey-218f9.101.790e-1227.91trafficking protein particle complex 9 [Source:NCB... [more]
si:dkey-218f9.102.297e-1227.91trafficking protein particle complex 9 [Source:NCB... [more]
back to top
BLAST of ATP-dependent DNA helicase PIF1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000079839.10.000e+099.79SMESG000079839.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026473 ID=SMED30026473|Name=ATP-dependent DNA helicase PIF1|organism=Schmidtea mediterranea sexual|type=transcript|length=4681bp
CACGCAATTTTTAAATTTAAAAAATAATTTTTTTTTATGAAAGTTTTCCA
TTCATAAAACATTATTTAATTTTTGGCAAAATATGTCATACACAGTTTAT
TATAAACAGTCAGTTTTCGATCATGCTTCATTAACAATAGCAGTTTCGTT
AAATGGGGATGAAAATCAAAAATTGAATTTTGACTTATTAAATCAAATCC
GTTCAAATTTCGATTTTATTAACAATAGAAATTCAGACATAATGAAAAAA
ATATTTTTCAATTATAAACAAGATTTCTCATCAAAGGAAAAAGAATGGGA
AAATTTTCAAGCACATCATAGGCCATTCGGTCTTTTATTTATATCTGAAT
TTAAAAGCGGTACTGATTTTAAAAAGATTCTAGATCTATACATTTCCGAA
AAGGAAAGGTTGGATGCTAGCATTTATGAGAGTCGTTTAATATTTATTTA
TAATGAAAATACAAAATCTTTTGGTAATTTTATTAAACGAACTTTAAACA
CGAATGGAGATATTTCGTCGTCAGTTGATTCAGAAACCGGAGAAATGGTC
CTTGGTGATGTTTTATGCACTGATTTCAGTGAGGAATTAAAATATATTCA
GGACTGCTTTATTCAAAATGAATTAATTTGGCAGTGCCGGTCTACAATTA
GAGTTTCTAGAATGAATTCGACAATTTCATTAAATGGTTCTTCTTGCTCA
TCTGTTTCAAATAATTGGAAAATAAATTCACTTTCTTCTGAAAATCCGAC
CCAGCTCTCGCCACCATGTGATAATTCATTGAAATCATTTGAAACTACCT
CGTTTGAGGAGAAATCTTTTGATTCTGAAATCCGAAATTTTTTGAAATCA
ATCTTTGAAAAAGTTCTTTATTCATTAAATAGTCGAGAAGCATTTCTCAA
CAATAAATTAGAACAAACTCGAAATAAACAATCGAATATTGAAGCCGTTT
CTGACTCGGGATCTGTAGTATCTCTTGATGATGGAGAGTTCAATTTGTCA
GATCCACTTGATTTGGATTTGAAGAAATTACAAGAGGAAAGTCGATTTAA
TAAAAATAATAAATCGAGATTATATTTGGGTAGACTCAATAAACAAACTG
CTGACTATTCGTTGTTATGTGGAAATTATTTAGATTCTTATTACTATTAT
CAAGTGGCAATATGCTATCTAAGAAAAGTCAATGATCAATTGTGGTTGGC
AGGAGCAGAAGAAGGGTTATGCTGTTCTTGGATTTTGTATTGTTTTCCAA
ACCATACCCAAGCATTAGATTCAGAACTGGTAGTTTTTCTGAATGATAAA
AGTCGTCAGTTAATTTCCGGTCAATTGAAAACCGACCAATCGGTTTTATC
TATTAACAATAATATGAATTCTCCAGACCAATCAGATTTTTCTTTCTTGA
AAAAATTCTCATCGAATGATTTGTTTAAAAATCCTCCCGAAATTCAAAAT
CTGAGTGAACTGAGCGAGAAATACCATTCCTGCATATCTCGATACAAGAA
AATCCTAATCAATAAAATTCAAAATCTTTATCCGATCAATTTTGATTCCA
TTATCAAAGCCAGTCGATTTTTTGTTGGTCAACATCGATTCTTAGATGCA
GCTAATTTTCTGAAAATGGTCAAAAGTGACTTATTGAAAATCCAAAACGA
CAAAGAGCAATATCATAATACTCTAGCACAACTCTATTCTCAGATGGGAT
TTTTTCGGAAATCCTCACTACATAAATACAAGAAATCGTTATTGATGCAC
CATAAACTGTGTGTGGCAAAAGGTCCCGACAGGAAATTGATTTACGAGCA
AAGATTCTCTGTATTGATAGACATTCTCAATGATTTAAATGTGAAATGTA
CTGATTTATTCAACGAGAAAGTTAGCGGTAATTGGTTGAGTTTGATCAAT
GATAGTTTAAATGGTGAAGGATTTGATCAAGGCTTCCATTCACTGAAAAT
GCACATCGTCGTTGAACTCTATTCAGTGTGTAAAGTTTTGAATTATTCGA
CAAATGTTTTGTTGGCTCTCGGATTATCGATTCTCGATAATTGGTTTCAT
TTGATTCCTAGAGATGAATATGAAAAAATGATCAGAGAGCTTAATAACTT
GTCCAAGTCGATGTTGATTAGAGACAACCAAATGGTTTTAAATGCCTCGG
TTATGAATCTACCAAAATTGAAGCAGACCATTTTTAGAAAATTGCCAGAT
TATTTGATTCCAAAACAACCGTCGAAACCATGTAAAGAAAAATCTGTTTT
CATATTTACGCCAATCAAGATTAATTCAAACTTCAATCGAGGTCAATCTG
CTGAACCTGTAATATGGATATGTGGTGAAGAATGTGAAATTGTACTTATA
TTTGATAATCTAATCTATCTTCCTATTCATTTATCCAATGTAGCCTTTCA
ATTAACAAACACAGAAACTGGATCTCAAGTCTGGCTACCATCCGAAGGCT
CCTCTATTCATTATTTACCAGCTCACGATAAAAATATTAACTGTCACTTT
GTTATTGTTCCAAATCCTCAACGTATTTCTTTAGGCAACTATAATATCAC
AAATATTTCGTATTCTATCACATCTATTGCCAACATACTATTCCAGCCTC
ATAAACTTGTTACTGATGTTGTTCTTCAGTCAACATCGGTTCCAGAAATC
AAACTTTACCCCATGATGCCGCAATTGCGAATTATGTCCTCCATAAGCGA
AACGATGAATAATTCCAATTTCAATCTTTGCAAATATCCGTTAAATACAA
TATTCTGCTCCAATATTGATCTTTATCTGAATGAAATTTTGGAATTTTCT
TTATTTTTATCCAATGAAAGTAAAGAGCTCGATATCGATCAAATTGTTTG
CATTATTGATGAATTAGAGCTGAATATTTCATCGAAAACTCTCATTTCCC
GATTTGCAGATCAAGAATTTAGCAACCGAAAAAGTTCAATTCACAGACTG
TTATCGTTTCCTGTTAATAGTTTGGAGAAGTTTCTTCCTATCAAATCGAT
AAACAGTTTAAAGGATTATGTCAATCTAAATTCAGATAATTTGAGTTTAC
CGACTGATGCTATTGTTAAATTTCGAATTGATACGACTAATGAGGAATTC
AATCACGAGTTGCTGGAAAGATTTTCAATGTCTGATCCGGAAAATCTCGA
AGTATTATGGAGTGGACAGTTAAAACTTACTGTTCAATATTGGTCGAATC
ATATTACAAATTATGATTCCAATGATAATATTTCGGTAAATAGTGATGTG
GATGATGTTGTCGTTGTGCAGAAGGAGAATCTGCCTTTATCTAATACATA
TCGAGAGTCGGTATGCTTATTCAACTGTCAAATAATGACCGGACTGAGTT
TGATCAATTTTTACTTGGATGATCAATTAAATCTCGTTCTATCGTTAATG
AATTTTACTCGGAACAAAATGAACGTTGAAATATTTTGGAGAGATGTGAA
AATTCAAAAAAGTTATATTGTCACACCGTCAAATGATTACAGAGCCGATT
TTTGCGATTCCAAACAGATGCACCGAAACTCTTCAACTGAATTATTTTCT
CATATTTCTAATTTAGTTATTCCTTTTGAGGTTTTATCATTAAAGTCAAC
GATGGACGAAGGATTTATTAAATCCGAAGAAGACTTGACTCGATATATTC
AAAAGTATTTGAAAATCTCTTGGATTATGAAAGACAAAACATTAGACAAA
GTTCGTCAGGGTTTTGTTAATTTGACTTGGTGCAATTGTTATATTTCACA
GTCTGCTTTCAAAAATGTTTCAGGCAGTGAACTAGGTCACCGTGTATTAT
TTTCAACAAACGACCTAATCAAGATATGGATGCATGAAAATGTAAAATTG
GAAATGCAATTTGTCTACAACGAACCAACTACACCAGTTCTTCCTGACGA
AACTGGAATTACTATACATTTATACGACGGCATAGAATATGATATTCTCT
GCTCTTTTAAAGATGAATGGCCATCATTTATGTGTGAAAGTCATTTAACA
TCGATTACTTTATTACCCTGTGCAAGCTCGAATAAAATATCCACTCCTTC
ATTTAGTTCTTCCGAATCAGACAATGGAAAACTTCAGCGTTTTCTATTTG
CAGGAAATAATATCGTCTATTTACAAAAAAATTCCATTCCATTAACACGC
ATGAGAGGTTTTATTATGTTTCTGTTACCTGGCAGTTACTGCGTCAGTTG
CCAACTTGTAATATCCGACAGTGTTGACTGTCACAAAGTCTTTACAAATA
TATTTGTTCTCTTTGAGAGTGAGAAGCATCAAATTAATGTTATCTAGGAT
TGATAATGGTGCTCTATCAGAGATTTATATCAGATTCTATTCGCTCATTA
TTACAATGATGATGGTTATAGCGATAATGCCATTCCAATTTTTATTTTTA
TTTTCTCTCCTATTATTGGCGGCCATTAATATACCTAGCATTCACTGTGA
TTTATTATTGGAAATCACAAAAGAGGCTGTGTGAATTTTGAGTAACTTCC
TTGTGTTATTATGAACGTTTTTTCGCTCTCTCTAGAGATTTCCTATTACA
ATTAGATATGTAAATATAATTGATTTTTAATCACTTTTTTTTTCGTTAGA
TATTCGGTAATATAGAAATTGGGTAATTTACGCAACCTGGCTCATAATGA
TCTATACAGGTTGGTATTGATTTGTTAATCG
back to top

protein sequence of SMED30026473-orf-1

>SMED30026473-orf-1 ID=SMED30026473-orf-1|Name=SMED30026473-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1405bp
MSYTVYYKQSVFDHASLTIAVSLNGDENQKLNFDLLNQIRSNFDFINNRN
SDIMKKIFFNYKQDFSSKEKEWENFQAHHRPFGLLFISEFKSGTDFKKIL
DLYISEKERLDASIYESRLIFIYNENTKSFGNFIKRTLNTNGDISSSVDS
ETGEMVLGDVLCTDFSEELKYIQDCFIQNELIWQCRSTIRVSRMNSTISL
NGSSCSSVSNNWKINSLSSENPTQLSPPCDNSLKSFETTSFEEKSFDSEI
RNFLKSIFEKVLYSLNSREAFLNNKLEQTRNKQSNIEAVSDSGSVVSLDD
GEFNLSDPLDLDLKKLQEESRFNKNNKSRLYLGRLNKQTADYSLLCGNYL
DSYYYYQVAICYLRKVNDQLWLAGAEEGLCCSWILYCFPNHTQALDSELV
VFLNDKSRQLISGQLKTDQSVLSINNNMNSPDQSDFSFLKKFSSNDLFKN
PPEIQNLSELSEKYHSCISRYKKILINKIQNLYPINFDSIIKASRFFVGQ
HRFLDAANFLKMVKSDLLKIQNDKEQYHNTLAQLYSQMGFFRKSSLHKYK
KSLLMHHKLCVAKGPDRKLIYEQRFSVLIDILNDLNVKCTDLFNEKVSGN
WLSLINDSLNGEGFDQGFHSLKMHIVVELYSVCKVLNYSTNVLLALGLSI
LDNWFHLIPRDEYEKMIRELNNLSKSMLIRDNQMVLNASVMNLPKLKQTI
FRKLPDYLIPKQPSKPCKEKSVFIFTPIKINSNFNRGQSAEPVIWICGEE
CEIVLIFDNLIYLPIHLSNVAFQLTNTETGSQVWLPSEGSSIHYLPAHDK
NINCHFVIVPNPQRISLGNYNITNISYSITSIANILFQPHKLVTDVVLQS
TSVPEIKLYPMMPQLRIMSSISETMNNSNFNLCKYPLNTIFCSNIDLYLN
EILEFSLFLSNESKELDIDQIVCIIDELELNISSKTLISRFADQEFSNRK
SSIHRLLSFPVNSLEKFLPIKSINSLKDYVNLNSDNLSLPTDAIVKFRID
TTNEEFNHELLERFSMSDPENLEVLWSGQLKLTVQYWSNHITNYDSNDNI
SVNSDVDDVVVVQKENLPLSNTYRESVCLFNCQIMTGLSLINFYLDDQLN
LVLSLMNFTRNKMNVEIFWRDVKIQKSYIVTPSNDYRADFCDSKQMHRNS
STELFSHISNLVIPFEVLSLKSTMDEGFIKSEEDLTRYIQKYLKISWIMK
DKTLDKVRQGFVNLTWCNCYISQSAFKNVSGSELGHRVLFSTNDLIKIWM
HENVKLEMQFVYNEPTTPVLPDETGITIHLYDGIEYDILCSFKDEWPSFM
CESHLTSITLLPCASSNKISTPSFSSSESDNGKLQRFLFAGNNIVYLQKN
SIPLTRMRGFIMFLLPGSYCVSCQLVISDSVDCHKVFTNIFVLFESEKHQ
INVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000002mitochondrial genome maintenance
GO:0000723telomere maintenance
GO:0006281DNA repair
GO:0006310DNA recombination
GO:0006974cellular response to DNA damage stimulus
GO:0032508DNA duplex unwinding
GO:0030154cell differentiation
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0003678DNA helicase activity
GO:0004386helicase activity
GO:0005524ATP binding
GO:0016787hydrolase activity
GO:00431395'-3' DNA helicase activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005739mitochondrion
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005794Golgi apparatus
GO:0005802trans-Golgi network
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013935TRAPP_II_complex_Trs120
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013935TRAPP II complex, Trs120PFAMPF08626TRAPPC9-Trs120coord: 56..521
e-value: 6.9E-11
score: 40.3
IPR013935TRAPP II complex, Trs120PANTHERPTHR21512TRAFFICKING PROTEIN PARTICLE COMPLEX SUBUNIT 9coord: 7..1116