Alpha-actinin

Overview
NameAlpha-actinin
Smed IDSMED30026466
Length (bp)2494
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-actinin (SMED30026466) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-actinin (SMED30026466) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-actinin (SMED30026466) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-actinin (SMED30026466) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026466

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30026466h1SMcG0003060 dd_Smed_v4_5647_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026466h1SMcG0003060 dd_Smed_v4_5647_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026466h1SMcG0003060 Contig33524uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026466h1SMcG0003060 Contig33524newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30026466h1SMcG0003060 dd_Smed_v4_10174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026466h1SMcG0003060 dd_Smed_v4_10174_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026466h1SMcG0003060 Contig6221newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026466h1SMcG0003060 Contig6221uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026466h1SMcG0003060 Contig49671uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026466h1SMcG0003060 Contig49671newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN1 (actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163])

HSP 1 Score: 888.641 bits (2295), Expect = 0.000e+0
Identity = 426/771 (55.25%), Postives = 565/771 (73.28%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L++ EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ + + ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K R AL    K  E ID L LEYAKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP+A+ E   IL + + +  +++    + +   NPY+ I+ +++  KW  +  LVP+RD AL EE  +QQ  ++LR+QF   AN  GPW++ + + +  +  +    L+ Q + L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM+EFR  FNHFDR+ +  L   +FKACL+SLG+ +  D + +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT D L +ELPP+QA+YCI RM P+ GP+S PGALDY  FS  LYGESDL
Sbjct:  123 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMA-GTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN1 (actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163])

HSP 1 Score: 887.871 bits (2293), Expect = 0.000e+0
Identity = 425/771 (55.12%), Postives = 564/771 (73.15%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L++ EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ + + ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K R AL    K  E ID L LEYAKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP+A+ E   IL + + +  +++    + +   NPY+ I+ +++  KW  +  LVP+RD AL EE  +QQ  ++LR+QF   AN  GPW++ + + +  +  +    L+ Q + L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM+EFR  FNHFDR +T  +D  DF+ACL+S+G+ +      +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT D L +ELPP+QA+YCI RM P+ GP+S PGALDY  FS  LYGESDL
Sbjct:   58 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMA-GTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNM-----GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 822          
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN1 (actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163])

HSP 1 Score: 886.715 bits (2290), Expect = 0.000e+0
Identity = 425/771 (55.12%), Postives = 564/771 (73.15%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L++ EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ + + ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K R AL    K  E ID L LEYAKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP+A+ E   IL + + +  +++    + +   NPY+ I+ +++  KW  +  LVP+RD AL EE  +QQ  ++LR+QF   AN  GPW++ + + +  +  +    L+ Q + L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM+EFR  FNHFDR +T  +D  DF+ACL+S+G+ +      +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT D L +ELPP+QA+YCI RM P+ GP+S PGALDY  FS  LYGESDL
Sbjct:  123 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMA-GTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNM-----GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL 887          
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN4 (actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166])

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 566/771 (73.41%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAF ALIHRHRPELI+Y KL +D+P+ NLN AF+VAEKYLDIPKMLDAED++NT +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE+LM  YE LASDLLEWI + +P+L +R    T+   + KLE+FR YR + KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI   W+ L++ EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ + K+++++   L ++K L++ H AFE+DL AHQ RVE+I AIA+ELN L Y     +N R Q I +QWD LG  T   R AL +  K  E ID L LEYAKR +PF NW+E A EDLQDM I+ +++EI  LIS H+ FK+TLP+A+ E + IL +      + E+N    S + NPY+ ++ + +  KW  +  LVP+RD AL EE  KQQ  + LR+QFA  AN  GPW++ + + +  +  +    L+ Q + L + E  I+ ++  +D LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM EFR  FNHFD++    L   +FKACL+SLG+ +  D + +++F RI ++VDPNH+G VTF+AFIDF+++E +D D+ +Q+  SF +LA D+ FIT + L +ELPP+QA+YCI RM P++GP++ PGALDY+ FS  LYGESDL
Sbjct:  142 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGS-NPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL 911          
BLAST of Alpha-actinin vs. Ensembl Human
Match: ACTN4 (actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166])

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 566/771 (73.41%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAF ALIHRHRPELI+Y KL +D+P+ NLN AF+VAEKYLDIPKMLDAED++NT +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE+LM  YE LASDLLEWI + +P+L +R    T+   + KLE+FR YR + KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI   W+ L++ EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ + K+++++   L ++K L++ H AFE+DL AHQ RVE+I AIA+ELN L Y     +N R Q I +QWD LG  T   R AL +  K  E ID L LEYAKR +PF NW+E A EDLQDM I+ +++EI  LIS H+ FK+TLP+A+ E + IL +      + E+N    S + NPY+ ++ + +  KW  +  LVP+RD AL EE  KQQ  + LR+QFA  AN  GPW++ + + +  +  +    L+ Q + L + E  I+ ++  +D LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM EFR  FNHFD++    L   +FKACL+SLG+ +  D + +++F RI ++VDPNH+G VTF+AFIDF+++E +D D+ +Q+  SF +LA D+ FIT + L +ELPP+QA+YCI RM P++GP++ PGALDY+ FS  LYGESDL
Sbjct:  142 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGS-NPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANVVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKSFSTALYGESDL 911          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 851.662 bits (2199), Expect = 0.000e+0
Identity = 409/768 (53.26%), Postives = 554/768 (72.14%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGE 2305
            TLG+IWTIILR+AIQDI VEE+SA++GLLLWC+RKTAPY NVNVQNFH SWKDGLAFCALIHRHRP+L+DYS+L + +PI NLN AFD+AEK+LDIPKMLDAEDM N+ +PDE++VM YVS YYH F+G +KAETAANRIC+VL+VNQ+NE +M  YE+LASDLL WIN+ +P+L NR+TD+TL   + KLE++R YR  EKPP+ E KG LET++NTLQTRLRLSNRP +LP + H+I DI  AW  L+ +EKGFE+WL++EI RLERLE+L +KF  KC  HE WAH K++  +  +++  GL ++K L K H AFE+DLGAHQ RVE+I AIA ELN L Y  I  IN R Q I +QWD LG+ +SK R  L +A +  E +D+L L++AKR +PF NWL+ A EDL D++I+  ++EI +L++ H+ FK+TL +A+ E   I Q+   +  L+ ++G       NPY+ +S  D++ KW  +   VP+RDS LQ E+ +QQ  ++LR  FA+ ANQ GPWLE+E + +  +    +  L+    +L  I+  +L ++  +DELE +H+ MQ   + +N  + Y+M+++RVGWE  LTS+ K INE +NQ+L RD+KG+SE Q++EFR  F+HFD+ R   LD    ++CL+S+G+ +    + D++  R+   VDPN  G V FEAF+DF+TKENSD D+VEQM  SF ILA+ + FIT D L +ELP +QA YC+ RM P R P + P + DY  FS  LY +
Sbjct:   58 TLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDMANS-QPDEKAVMTYVSCYYHYFSGMRKAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLGGRGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERA-GLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLYSQ 823          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 409/768 (53.26%), Postives = 554/768 (72.14%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGE 2305
            TLG+IWTIILR+AIQDI VEE+SA++GLLLWC+RKTAPY NVNVQNFH SWKDGLAFCALIHRHRP+L+DYS+L + +PI NLN AFD+AEK+LDIPKMLDAEDM N+ +PDE++VM YVS YYH F+G +KAETAANRIC+VL+VNQ+NE +M  YE+LASDLL WIN+ +P+L NR+TD+TL   + KLE++R YR  EKPP+ E KG LET++NTLQTRLRLSNRP +LP + H+I DI  AW  L+ +EKGFE+WL++EI RLERLE+L +KF  KC  HE WAH K++  +  +++  GL ++K L K H AFE+DLGAHQ RVE+I AIA ELN L Y  I  IN R Q I +QWD LG+ +SK R  L +A +  E +D+L L++AKR +PF NWL+ A EDL D++I+  ++EI +L++ H+ FK+TL +A+ E   I Q+   +  L+ ++G       NPY+ +S  D++ KW  +   VP+RDS LQ E+ +QQ  ++LR  FA+ ANQ GPWLE+E + +  +    +  L+    +L  I+  +L ++  +DELE +H+ MQ   + +N  + Y+M+++RVGWE  LTS+ K INE +NQ+L RD+KG+SE Q++EFR  F+HFD+ R   LD    ++CL+S+G+ +    + D++  R+   VDPN  G V FEAF+DF+TKENSD D+VEQM  SF ILA+ + FIT D L +ELP +QA YC+ RM P R P + P + DY  FS  LY +
Sbjct:  129 TLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDMANS-QPDEKAVMTYVSCYYHYFSGMRKAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLGGRGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERA-GLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLYSQ 894          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 405/795 (50.94%), Postives = 549/795 (69.06%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGA---------------------------QKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGE 2305
            TLG+IWTIILR+AIQDI VEE+SA++GLLLWC+RKTAPY NVNVQNFH SWKDGLAFCALIHRHRP+L+DYS+L + +PI NLN AFD+AEK+LDIPKMLDAED+  +  PDE+S M YVS +YHAF                              + AETAANRIC+VL+VNQ+NE +M  YE+LASDLL WIN+ +P+L NR+TD+TL   + KLE++R YR  EKPP+ E KG LET++NTLQTRLRLSNRP +LP + H+I DI  AW  L+ +EKGFE+WL++EI RLERLE+L +KF  KC  HE WAH K++  +  +++  GL ++K L K H AFE+DLGAHQ RVE+I AIA ELN L Y  I  IN R Q I +QWD LG+ +SK R  L +A +  E +D+L L++AKR +PF NWL+ A EDL D++I+  ++EI +L++ H+ FK+TL +A+ E   I Q+   +  L+ ++G       NPY+ +S  D++ KW  +   VP+RDS LQ E+ +QQ  ++LR  FA+ ANQ GPWLE+E + +  +    +  L+    +L  I+  +L ++  +DELE +H+ MQ   + +N  + Y+M+++RVGWE  LTS+ K INE +NQ+L RD+KG+SE Q++EFR  F+HFD+ R   LD    ++CL+S+G+ +    + D++  R+   VDPN  G V FEAF+DF+TKENSD D+VEQM  SF ILA+ + FIT D L +ELP +QA YC+ RM P R P + P + DY  FS  LY +
Sbjct:   58 TLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDV--SRHPDEKSTMTYVSCFYHAFRNMRDPPPPVIRQPPPQRVVVAPPPERDWRKDAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLGGRGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERA-GLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLYSQ 849          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: atn-1 (AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8])

HSP 1 Score: 823.928 bits (2127), Expect = 0.000e+0
Identity = 405/795 (50.94%), Postives = 549/795 (69.06%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGA---------------------------QKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGE 2305
            TLG+IWTIILR+AIQDI VEE+SA++GLLLWC+RKTAPY NVNVQNFH SWKDGLAFCALIHRHRP+L+DYS+L + +PI NLN AFD+AEK+LDIPKMLDAED+  +  PDE+S M YVS +YHAF                              + AETAANRIC+VL+VNQ+NE +M  YE+LASDLL WIN+ +P+L NR+TD+TL   + KLE++R YR  EKPP+ E KG LET++NTLQTRLRLSNRP +LP + H+I DI  AW  L+ +EKGFE+WL++EI RLERLE+L +KF  KC  HE WAH K++  +  +++  GL ++K L K H AFE+DLGAHQ RVE+I AIA ELN L Y  I  IN R Q I +QWD LG+ +SK R  L +A +  E +D+L L++AKR +PF NWL+ A EDL D++I+  ++EI +L++ H+ FK+TL +A+ E   I Q+   +  L+ ++G       NPY+ +S  D++ KW  +   VP+RDS LQ E+ +QQ  ++LR  FA+ ANQ GPWLE+E + +  +    +  L+    +L  I+  +L ++  +DELE +H+ MQ   + +N  + Y+M+++RVGWE  LTS+ K INE +NQ+L RD+KG+SE Q++EFR  F+HFD+ R   LD    ++CL+S+G+ +    + D++  R+   VDPN  G V FEAF+DF+TKENSD D+VEQM  SF ILA+ + FIT D L +ELP +QA YC+ RM P R P + P + DY  FS  LY +
Sbjct:  129 TLGLIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDV--SRHPDEKSTMTYVSCFYHAFRNMRDPPPPVIRQPPPQRVVVAPPPERDWRKDAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKANQVGPWLERELEQVLAIGLGGRGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENFVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFDKERA-GLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKENSDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYVTFSRSLYSQ 920          
BLAST of Alpha-actinin vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 320.857 bits (821), Expect = 1.102e-92
Identity = 169/370 (45.68%), Postives = 228/370 (61.62%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEM------SAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDIL 1093
            TLG+IWTIILR+ IQDIT E+       SAKE LLLWC+ KTA Y NVNV+NF  SW+DGLAF ALIH+HRP+L+DY  L + N + NL  AFD AE  L + K LDAED +N  +PDE+S++ YV +YYH F   ++      RI KV+    +N+ ++N YE L+SDLLEWIN K+  L  R  +N L G + +L EF  YR  EKPPK++ KGELE +  TLQ+ +R +N+ P++P E  +I DI  AW+ L+K E   E  L  E+ R E+LE L  +FN K +  E W      +    NF +  L  ++   K H A E D+ A++ RV+ +VA+A EL    Y     IN R +N+   W+ L
Sbjct:  201 TLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAED-VNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGN-DLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYL 568          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0333801)

HSP 1 Score: 924.465 bits (2388), Expect = 0.000e+0
Identity = 443/771 (57.46%), Postives = 577/771 (74.84%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEEM+AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRP+LIDY+KLS+DNP+ENLN AFDVAEKYLDIP+MLD +D+INT KPDER++M YVS YYHAF GAQ+AETAANRICKVL+VNQ+NE LM  YE LASDLLEWI + +P+L +R  DN+L G + KLEE+R YR   KPP+ E K +LET +NTLQT+LRLSNRP YLPTE   ++DI  +WK L+  EK FE+WL+AE  RLERLE+L +KF  K D HE W   K+E+ + Q+F+   L ELK L K H AFE+DL AHQ RVE+I AIA+ELNTL Y    ++N R Q I +QWD LG  T + R AL EA +  E+ID L LE+AKR +PF NWL+   EDL DM I+ +++EI  LI  H+ FK TL  A+ E   I+ L   + ++++ +       ENPY+ ++  D+  KW  +  LVPQRD  L  E+ KQQ  + LR+QFA+ AN  GPW+E++ D +  +    +  L+ Q  +L + E+ + A++  ++ELE +H+A+Q  +I +N YT YTM+ +RVGWEQ LTS+ + INEV+NQILTRD+KG+S+ Q++EFR  FNHFD+NRT +L   +FK+CLVSLG+ + KD + D DF+RI  +VDPN+TG+V F+AF+DF+T+E++D D+ EQ+  SF ILA D+P+I  D L +ELPP+QA+YCI+RMPP++GPN  PGALDY  FS  LYGE+DL
Sbjct:  126 TLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL-ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0070343)

HSP 1 Score: 924.465 bits (2388), Expect = 0.000e+0
Identity = 443/771 (57.46%), Postives = 577/771 (74.84%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEEM+AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRP+LIDY+KLS+DNP+ENLN AFDVAEKYLDIP+MLD +D+INT KPDER++M YVS YYHAF GAQ+AETAANRICKVL+VNQ+NE LM  YE LASDLLEWI + +P+L +R  DN+L G + KLEE+R YR   KPP+ E K +LET +NTLQT+LRLSNRP YLPTE   ++DI  +WK L+  EK FE+WL+AE  RLERLE+L +KF  K D HE W   K+E+ + Q+F+   L ELK L K H AFE+DL AHQ RVE+I AIA+ELNTL Y    ++N R Q I +QWD LG  T + R AL EA +  E+ID L LE+AKR +PF NWL+   EDL DM I+ +++EI  LI  H+ FK TL  A+ E   I+ L   + ++++ +       ENPY+ ++  D+  KW  +  LVPQRD  L  E+ KQQ  + LR+QFA+ AN  GPW+E++ D +  +    +  L+ Q  +L + E+ + A++  ++ELE +H+A+Q  +I +N YT YTM+ +RVGWEQ LTS+ + INEV+NQILTRD+KG+S+ Q++EFR  FNHFD+NRT +L   +FK+CLVSLG+ + KD + D DF+RI  +VDPN+TG+V F+AF+DF+T+E++D D+ EQ+  SF ILA D+P+I  D L +ELPP+QA+YCI+RMPP++GPN  PGALDY  FS  LYGE+DL
Sbjct:  126 TLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL-ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0303048)

HSP 1 Score: 924.465 bits (2388), Expect = 0.000e+0
Identity = 443/771 (57.46%), Postives = 577/771 (74.84%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEEM+AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRP+LIDY+KLS+DNP+ENLN AFDVAEKYLDIP+MLD +D+INT KPDER++M YVS YYHAF GAQ+AETAANRICKVL+VNQ+NE LM  YE LASDLLEWI + +P+L +R  DN+L G + KLEE+R YR   KPP+ E K +LET +NTLQT+LRLSNRP YLPTE   ++DI  +WK L+  EK FE+WL+AE  RLERLE+L +KF  K D HE W   K+E+ + Q+F+   L ELK L K H AFE+DL AHQ RVE+I AIA+ELNTL Y    ++N R Q I +QWD LG  T + R AL EA +  E+ID L LE+AKR +PF NWL+   EDL DM I+ +++EI  LI  H+ FK TL  A+ E   I+ L   + ++++ +       ENPY+ ++  D+  KW  +  LVPQRD  L  E+ KQQ  + LR+QFA+ AN  GPW+E++ D +  +    +  L+ Q  +L + E+ + A++  ++ELE +H+A+Q  +I +N YT YTM+ +RVGWEQ LTS+ + INEV+NQILTRD+KG+S+ Q++EFR  FNHFD+NRT +L   +FK+CLVSLG+ + KD + D DF+RI  +VDPN+TG+V F+AF+DF+T+E++D D+ EQ+  SF ILA D+P+I  D L +ELPP+QA+YCI+RMPP++GPN  PGALDY  FS  LYGE+DL
Sbjct:  126 TLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL-ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0070344)

HSP 1 Score: 922.924 bits (2384), Expect = 0.000e+0
Identity = 443/771 (57.46%), Postives = 576/771 (74.71%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEEM+AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRP+LIDY+KLS+DNP+ENLN AFDVAEKYLDIP+MLD +D+ NT  PDER+VM YVSSYYH F+GAQKAETAANRICKVL+VNQ+NE LM  YE LASDLLEWI + +P+L +R  DN+L G + KLEE+R YR   KPP+ E K +LET +NTLQT+LRLSNRP YLPTE   ++DI  +WK L+  EK FE+WL+AE  RLERLE+L +KF  K D HE W   K+E+ + Q+F+   L ELK L K H AFE+DL AHQ RVE+I AIA+ELNTL Y    ++N R Q I +QWD LG  T + R AL EA +  E+ID L LE+AKR +PF NWL+   EDL DM I+ +++EI  LI  H+ FK TL  A+ E   I+ L   + ++++ +       ENPY+ ++  D+  KW  +  LVPQRD  L  E+ KQQ  + LR+QFA+ AN  GPW+E++ D +  +    +  L+ Q  +L + E+ + A++  ++ELE +H+A+Q  +I +N YT YTM+ +RVGWEQ LTS+ + INEV+NQILTRD+KG+S+ Q++EFR  FNHFD+NRT +L   +FK+CLVSLG+ + KD + D DF+RI  +VDPN+TG+V F+AF+DF+T+E++D D+ EQ+  SF ILA D+P+I  D L +ELPP+QA+YCI+RMPP++GPN  PGALDY  FS  LYGE+DL
Sbjct:  126 TLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLQNTALPDERAVMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL-ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 895          
BLAST of Alpha-actinin vs. Ensembl Fly
Match: Actn (gene:FBgn0000667 transcript:FBtr0310657)

HSP 1 Score: 917.531 bits (2370), Expect = 0.000e+0
Identity = 443/773 (57.31%), Postives = 576/773 (74.51%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELN--TLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEEM+AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRP+LIDY+KLS+DNP+ENLN AFDVAEKYLDIP+MLD +D+ NT  PDER+VM YVSSYYH F+GAQKAETAANRICKVL+VNQ+NE LM  YE LASDLLEWI + +P+L +R  DN+L G + KLEE+R YR   KPP+ E K +LET +NTLQT+LRLSNRP YLPTE   ++DI  +WK L+  EK FE+WL+AE  RLERLE+L +KF  K D HE W   K+E+ + Q+F+   L ELK L K H AFE+DL AHQ RVE+I AIA+ELN  TL Y    ++N R Q I +QWD LG  T + R AL EA +  E+ID L LE+AKR +PF NWL+   EDL DM I+ +++EI  LI  H+ FK TL  A+ E   I+ L   + ++++ +       ENPY+ ++  D+  KW  +  LVPQRD  L  E+ KQQ  + LR+QFA+ AN  GPW+E++ D +  +    +  L+ Q  +L + E+ + A++  ++ELE +H+A+Q  +I +N YT YTM+ +RVGWEQ LTS+ + INEV+NQILTRD+KG+S+ Q++EFR  FNHFD+NRT +L   +FK+CLVSLG+ + KD + D DF+RI  +VDPN+TG+V F+AF+DF+T+E++D D+ EQ+  SF ILA D+P+I  D L +ELPP+QA+YCI+RMPP++GPN  PGALDY  FS  LYGE+DL
Sbjct:  126 TLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLQNTALPDERAVMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNVSTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL-ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 897          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn1 (actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-4])

HSP 1 Score: 890.952 bits (2301), Expect = 0.000e+0
Identity = 426/771 (55.25%), Postives = 566/771 (73.41%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY+KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  +W  L+  EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+E+ ++++F+   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K   AL    K  E ID L LE+AKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP A+ E + IL + + I  +++    + +  +NPY+ I+ +++  KW  +  LVPQRD AL EE  +QQ  ++LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INE++NQILTRD KG+S+ QM+EFR  FNHFDR+ +  L   +FKACL+SLGF +  D + +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF +LA D+ +I  D L +ELPP+QA+YCI RM P+ GP+S PGALDY  FS  LYGESDL
Sbjct:  133 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYNKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNSWGRLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTDGKEEMLQHKDFETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQRICDQWDSLGVLTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMA-GQNPYTTINPQEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIEMHGTLEDQLTHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQAEYCIARMTPYSGPDSVPGALDYMSFSTALYGESDL 902          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn1 (actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-4])

HSP 1 Score: 890.952 bits (2301), Expect = 0.000e+0
Identity = 426/771 (55.25%), Postives = 566/771 (73.41%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY+KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  +W  L+  EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+E+ ++++F+   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K   AL    K  E ID L LE+AKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP A+ E + IL + + I  +++    + +  +NPY+ I+ +++  KW  +  LVPQRD AL EE  +QQ  ++LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INE++NQILTRD KG+S+ QM+EFR  FNHFDR+ +  L   +FKACL+SLGF +  D + +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF +LA D+ +I  D L +ELPP+QA+YCI RM P+ GP+S PGALDY  FS  LYGESDL
Sbjct:  133 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYNKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNSWGRLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTDGKEEMLQHKDFETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQRICDQWDSLGVLTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMA-GQNPYTTINPQEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIEMHGTLEDQLTHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQAEYCIARMTPYSGPDSVPGALDYMSFSTALYGESDL 902          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn1 (actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-4])

HSP 1 Score: 890.952 bits (2301), Expect = 0.000e+0
Identity = 426/771 (55.25%), Postives = 566/771 (73.41%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY+KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  +W  L+  EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+E+ ++++F+   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K   AL    K  E ID L LE+AKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP A+ E + IL + + I  +++    + +  +NPY+ I+ +++  KW  +  LVPQRD AL EE  +QQ  ++LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INE++NQILTRD KG+S+ QM+EFR  FNHFDR+ +  L   +FKACL+SLGF +  D + +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF +LA D+ +I  D L +ELPP+QA+YCI RM P+ GP+S PGALDY  FS  LYGESDL
Sbjct:  133 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYNKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNSWGRLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTDGKEEMLQHKDFETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQRICDQWDSLGVLTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMA-GQNPYTTINPQEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIEMHGTLEDQLTHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQAEYCIARMTPYSGPDSVPGALDYMSFSTALYGESDL 902          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn4 (actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-940])

HSP 1 Score: 886.715 bits (2290), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 561/771 (72.76%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAF ALIHRHRPELIDY KL +D+P+ NLN AF+VAE+YLDIPKMLDAED++NT +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE+LM  YE LASDLLEWI + +P+L NR  + T+   + KLE+FR YR + KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI GAW +L+  EKG+E+WL+ EI+RLERL++L +KF  K   HE W   K+ +   ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I  QWD LG  T   R +L    K  E ID L LEYAKR +PF NW+E A EDLQDM I+ ++ EI  LI+ HE FK+TLP A  E + I  ++  +  +   NG   +   NPY+ I+ + +  KW  +  LVPQRD ALQEE+ +QQ  D LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L++ E+ I+ ++  +D+LE  H+ +Q  +I DN YT YTM+ +RVGWEQ LT++ + INE++NQ+LTRD KG+S+ Q+ E+R  FNHFD++ +  L   +FKACL+SLG+ +  D + D++F RI  IVDPN++G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT + L +ELPP+QA+YCI RM P+ GP++  GALDY  FS  LYGESDL
Sbjct:  132 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIDYDKLRKDDPVTNLNNAFEVAERYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRAPEKTMAEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINGAWHKLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEGWTDGKEAMLTQKDYETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICEQWDALGSLTQNRRESLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIDEIQGLITAHEQFKSTLPEANKEREAIQAIQAEVQKIANYNGIKLA-GNNPYTTITPQSIDKKWEKVQQLVPQRDQALQEELTRQQSNDHLRRQFANQANMIGPWIQNKMEEIGRISIEMNGTLEDQLTHLSQYEQSIIEYKPNIDQLEGDHQLIQEALIFDNKYTAYTMEHLRVGWEQLLTTIARTINEIENQVLTRDAKGISQEQLHEYRTSFNHFDKDHSGLLQSEEFKACLISLGYDVENDKQGDAEFARIMGIVDPNNSGAVTFQAFIDFMSRETTDTDTADQVIASFKILAGDKNYITAEELRRELPPDQAEYCIARMAPYSGPDAVAGALDYMSFSTALYGESDL 901          
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Match: actn4 (actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-940])

HSP 1 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 420/771 (54.47%), Postives = 560/771 (72.63%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAF ALIHRHRPELIDY KL +D+P+ NLN AF+VAE+YLDIPKMLDAED++ T++PDE+++M YVS +YHAF+GAQKAETAANRICKVL VNQ+NE+LM  YE LASDLLEWI + +P+L NR  + T+   + KLE+FR YR + KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI GAW +L+  EKG+E+WL+ EI+RLERL++L +KF  K   HE W   K+ +   ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I  QWD LG  T   R +L    K  E ID L LEYAKR +PF NW+E A EDLQDM I+ ++ EI  LI+ HE FK+TLP A  E + I  ++  +  +   NG   +   NPY+ I+ + +  KW  +  LVPQRD ALQEE+ +QQ  D LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L++ E+ I+ ++  +D+LE  H+ +Q  +I DN YT YTM+ +RVGWEQ LT++ + INE++NQ+LTRD KG+S+ Q+ E+R  FNHFD++ +  L   +FKACL+SLG+ +  D + D++F RI  IVDPN++G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT + L +ELPP+QA+YCI RM P+ GP++  GALDY  FS  LYGESDL
Sbjct:  132 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIDYDKLRKDDPVTNLNNAFEVAERYLDIPKMLDAEDIVGTLRPDEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRAPEKTMAEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINGAWHKLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEGWTDGKEAMLTQKDYETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICEQWDALGSLTQNRRESLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIDEIQGLITAHEQFKSTLPEANKEREAIQAIQAEVQKIANYNGIKLA-GNNPYTTITPQSIDKKWEKVQQLVPQRDQALQEELTRQQSNDHLRRQFANQANMIGPWIQNKMEEIGRISIEMNGTLEDQLTHLSQYEQSIIEYKPNIDQLEGDHQLIQEALIFDNKYTAYTMEHLRVGWEQLLTTIARTINEIENQVLTRDAKGISQEQLHEYRTSFNHFDKDHSGLLQSEEFKACLISLGYDVENDKQGDAEFARIMGIVDPNNSGAVTFQAFIDFMSRETTDTDTADQVIASFKILAGDKNYITAEELRRELPPDQAEYCIARMAPYSGPDAVAGALDYMSFSTALYGESDL 901          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:780123])

HSP 1 Score: 889.412 bits (2297), Expect = 0.000e+0
Identity = 423/771 (54.86%), Postives = 570/771 (73.93%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY KL +D+P+ NLN AFDVAE+YLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L++ EKG+E+W++ EI+RLERL++L +KF  K   HEAW   K+ + + ++++   L ++K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    T+N R Q I +QWD LG  T + R AL    K  E ID L LEYAKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP A+ E + IL +++ I  +++    + S + NPY+ I+ +++ +KW  +  LVP+RD AL EE  +QQ+ ++LR+QFA  AN  GPW++ +   +  +  +    L+ Q   L + E+ I+ ++ ++D+LE+ H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INEV+NQ+LTRD KG+S+ QM+EFR  F+HFDR+ + +L   +FKACL+SLG+ +  D + +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT D L +ELPP+QA+YCI RM P+ GP++ PGALDY  FS  LYGESDL
Sbjct:  121 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQAEKGYEEWMLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLQKKDYETASLSDIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSQTVNARCQRICDQWDNLGALTQQRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPEADKERQAILGIQNEISKIMQTYHVNMSGS-NPYTSITPQEINNKWDHVRQLVPRRDQALTEEHARQQQNERLRKQFAAQANVIGPWIQTKMQEIGRIAIEMHGTLEDQLNNLRQYEKSIVNYKPKIDQLESDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQVLTRDAKGISQEQMNEFRNSFSHFDRDHSGRLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGLVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITADELRRELPPDQAEYCIARMAPYLGPDAVPGALDYMSFSTALYGESDL 890          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:780123])

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 421/771 (54.60%), Postives = 568/771 (73.67%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY KL +D+P+ NLN AFDVAE+YLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L++ EKG+E+W++ EI+RLERL++L +KF  K   HEAW   K+ + + ++++   L ++K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    T+N R Q I +QWD LG  T + R AL    K  E ID L LEYAKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP A+ E + IL +++ I  +++    + S + NPY+ I+ +++ +KW  +  LVP+RD AL EE  +QQ+ ++LR+QFA  AN  GPW++ +   +  +  +    L+ Q   L + E+ I+ ++ ++D+LE+ H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INEV+NQ+LTRD KG+S+ QM+EFR  F+HFDR ++  L+  DF+ACL+S+G+ +      +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT D L +ELPP+QA+YCI RM P+ GP++ PGALDY  FS  LYGESDL
Sbjct:  121 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEQAEKGYEEWMLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLQKKDYETASLSDIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSQTVNARCQRICDQWDNLGALTQQRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPEADKERQAILGIQNEISKIMQTYHVNMSGS-NPYTSITPQEINNKWDHVRQLVPRRDQALTEEHARQQQNERLRKQFAAQANVIGPWIQTKMQEIGRIAIEMHGTLEDQLNNLRQYEKSIVNYKPKIDQLESDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQVLTRDAKGISQEQMNEFRNSFSHFDRKKSGFLESDDFRACLISMGYNM-----GEAEFARIMSIVDPNRLGLVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITADELRRELPPDQAEYCIARMAPYLGPDAVPGALDYMSFSTALYGESDL 885          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: gss (glutathione synthetase [Source:Xenbase;Acc:XB-GENE-976512])

HSP 1 Score: 879.782 bits (2272), Expect = 0.000e+0
Identity = 423/771 (54.86%), Postives = 563/771 (73.02%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVNVQNFH+SWKDGLA CALIHRHRP+LIDYSKL +D+PI NLN AFDVAEKYLDIPKMLDAED++NT KPDE+++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NRT +  +   + KLE+FR YR + KPP+ + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AWK L++ EKG+E+WL+ EI+RLERLE+L +KF  K   HE+W   K+E+   ++++   L E++ L++ H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N+R Q I +QWD LG  T K R AL    K  E ID L LE+AKR +PF NW++ A EDLQDM I+ S++EI  LI+ HE FK TLP A+ E   IL ++  I  + +  G   S   NPY+ ++  D+ +KW  +  LVP RD  LQEE+ +QQ  ++LR+QFA  AN  GPW++ + + +  +       L+ Q   L + E+ I++++S +D+LE  H+ +Q  +I DN +T Y+M+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM+EFR  FNHFDR R   +D  DF+ACL+S+G+ L      + +F RI  +VDPN+TG VTF+AFIDF+T+E ++ D+ EQ+  SF ILA+D+ +IT + L +ELPP QA+YCI RM  + G ++  GALDY  FS+ LYGESDL
Sbjct:  138 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRTPEKNMGAMQKKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLLEIRRLERLEHLAEKFKQKASLHESWTRGKEELLTQRDYESASLMEIRALVRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNSRCQAICDQWDNLGTLTQKRRDALERVEKLLETIDQLYLEFAKRAAPFNNWMDGAVEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADKEKMSILGIQAEIQKIAQTYGIKLSGI-NPYTNLTHLDISNKWETVKQLVPHRDQTLQEELARQQANERLRRQFAAQANVIGPWIQSKMEEIGRISVDISASLEDQMNHLKQYEQNIISYKSNIDKLEGDHQLIQESLIFDNKHTNYSMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL-----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKSYITIEELRRELPPEQAEYCITRMTKYTGADAISGALDYMSFSSALYGESDL 902          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: gss (glutathione synthetase [Source:Xenbase;Acc:XB-GENE-976512])

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 423/771 (54.86%), Postives = 563/771 (73.02%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVNVQNFH+SWKDGLA CALIHRHRP+LIDYSKL +D+PI NLN AFDVAEKYLDIPKMLDAED++NT KPDE+++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NRT +  +   + KLE+FR YR + KPP+ + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AWK L++ EKG+E+WL+ EI+RLERLE+L +KF  K   HE+W   K+E+   ++++   L E++ L++ H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N+R Q I +QWD LG  T K R AL    K  E ID L LE+AKR +PF NW++ A EDLQDM I+ S++EI  LI+ HE FK TLP A+ E   IL ++  I  + +  G   S   NPY+ ++  D+ +KW  +  LVP RD  LQEE+ +QQ  ++LR+QFA  AN  GPW++ + + +  +       L+ Q   L + E+ I++++S +D+LE  H+ +Q  +I DN +T Y+M+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM+EFR  FNHFDR R   +D  DF+ACL+S+G+ L      + +F RI  +VDPN+TG VTF+AFIDF+T+E ++ D+ EQ+  SF ILA+D+ +IT + L +ELPP QA+YCI RM  + G ++  GALDY  FS+ LYGESDL
Sbjct:  142 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRTPEKNMGAMQKKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLLEIRRLERLEHLAEKFKQKASLHESWTRGKEELLTQRDYESASLMEIRALVRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNSRCQAICDQWDNLGTLTQKRRDALERVEKLLETIDQLYLEFAKRAAPFNNWMDGAVEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADKEKMSILGIQAEIQKIAQTYGIKLSGI-NPYTNLTHLDISNKWETVKQLVPHRDQTLQEELARQQANERLRRQFAAQANVIGPWIQSKMEEIGRISVDISASLEDQMNHLKQYEQNIISYKSNIDKLEGDHQLIQESLIFDNKHTNYSMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL-----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKSYITIEELRRELPPEQAEYCITRMTKYTGADAISGALDYMSFSSALYGESDL 906          
BLAST of Alpha-actinin vs. Ensembl Xenopus
Match: gss (glutathione synthetase [Source:Xenbase;Acc:XB-GENE-976512])

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 423/771 (54.86%), Postives = 563/771 (73.02%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVNVQNFH+SWKDGLA CALIHRHRP+LIDYSKL +D+PI NLN AFDVAEKYLDIPKMLDAED++NT KPDE+++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NRT +  +   + KLE+FR YR + KPP+ + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AWK L++ EKG+E+WL+ EI+RLERLE+L +KF  K   HE+W   K+E+   ++++   L E++ L++ H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N+R Q I +QWD LG  T K R AL    K  E ID L LE+AKR +PF NW++ A EDLQDM I+ S++EI  LI+ HE FK TLP A+ E   IL ++  I  + +  G   S   NPY+ ++  D+ +KW  +  LVP RD  LQEE+ +QQ  ++LR+QFA  AN  GPW++ + + +  +       L+ Q   L + E+ I++++S +D+LE  H+ +Q  +I DN +T Y+M+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM+EFR  FNHFDR R   +D  DF+ACL+S+G+ L      + +F RI  +VDPN+TG VTF+AFIDF+T+E ++ D+ EQ+  SF ILA+D+ +IT + L +ELPP QA+YCI RM  + G ++  GALDY  FS+ LYGESDL
Sbjct:  146 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFDVAEKYLDIPKMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRTPEKNMGAMQKKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLLEIRRLERLEHLAEKFKQKASLHESWTRGKEELLTQRDYESASLMEIRALVRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNSRCQAICDQWDNLGTLTQKRRDALERVEKLLETIDQLYLEFAKRAAPFNNWMDGAVEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADKEKMSILGIQAEIQKIAQTYGIKLSGI-NPYTNLTHLDISNKWETVKQLVPHRDQTLQEELARQQANERLRRQFAAQANVIGPWIQSKMEEIGRISVDISASLEDQMNHLKQYEQNIISYKSNIDKLEGDHQLIQESLIFDNKHTNYSMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL-----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKSYITIEELRRELPPEQAEYCITRMTKYTGADAISGALDYMSFSSALYGESDL 910          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn2 (actinin alpha 2 [Source:MGI Symbol;Acc:MGI:109192])

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 571/771 (74.06%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVN+QNFH SWKDGL  CALIHRHRP+LIDYSKL++D+PI N+N A ++AEK+LDIPKMLDAED++NT KPDER++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NRT + T+   + KLE+FR YR   KPPK + K +LE  +NTLQT+LR+SNRP ++P+E  M++DI GAW+ L++ EKG+E+WL+ EI+RLERLE+L +KF  K  THE WA+ K++I   ++++   L E++ LL+ H AFE+DL AHQ RVE+I AIA+ELN L Y     +N+R Q I +QWD LG  T K R AL    K  E ID L LE+AKR +PF NW+E A EDLQDM I+ S++EI  LI+ HE FK TLP A+ E + IL +++ +  +I++     S++ NPYS +++ +L++KW  +  LVP RD +LQEE+ +Q   ++LR+QFA  AN  GPW++ + + +     Q    L+ Q  +L + E  I+ +++ +D+LE  H+ +Q  ++ DN +T YTM+ IRVGWE  LT++ + INEV+ QILTRD KG+++ QM+EFR  FNHFDR +   +D  DF+ACL+S+G+ L      +++F RI  +VDPN  G VTF++FIDF+T+E +D D+ EQ+  SF ILA+D+P+I  + L +ELPP+QAQYCI+RMPP+ GP S PGALDY  FS+ LYGESDL
Sbjct:  130 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSILAIQNEVEKVIQSYSIRISSS-NPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDL-----GEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPPYSGPGSVPGALDYTAFSSALYGESDL 894          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn2 (actinin alpha 2 [Source:MGI Symbol;Acc:MGI:109192])

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 571/771 (74.06%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVN+QNFH SWKDGL  CALIHRHRP+LIDYSKL++D+PI N+N A ++AEK+LDIPKMLDAED++NT KPDER++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NRT + T+   + KLE+FR YR   KPPK + K +LE  +NTLQT+LR+SNRP ++P+E  M++DI GAW+ L++ EKG+E+WL+ EI+RLERLE+L +KF  K  THE WA+ K++I   ++++   L E++ LL+ H AFE+DL AHQ RVE+I AIA+ELN L Y     +N+R Q I +QWD LG  T K R AL    K  E ID L LE+AKR +PF NW+E A EDLQDM I+ S++EI  LI+ HE FK TLP A+ E + IL +++ +  +I++     S++ NPYS +++ +L++KW  +  LVP RD +LQEE+ +Q   ++LR+QFA  AN  GPW++ + + +     Q    L+ Q  +L + E  I+ +++ +D+LE  H+ +Q  ++ DN +T YTM+ IRVGWE  LT++ + INEV+ QILTRD KG+++ QM+EFR  FNHFDR +   +D  DF+ACL+S+G+ L      +++F RI  +VDPN  G VTF++FIDF+T+E +D D+ EQ+  SF ILA+D+P+I  + L +ELPP+QAQYCI+RMPP+ GP S PGALDY  FS+ LYGESDL
Sbjct:  130 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSILAIQNEVEKVIQSYSIRISSS-NPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDL-----GEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPPYSGPGSVPGALDYTAFSSALYGESDL 894          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn4 (actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773])

HSP 1 Score: 887.1 bits (2291), Expect = 0.000e+0
Identity = 423/771 (54.86%), Postives = 565/771 (73.28%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAF ALIHRHRPELI+Y KL +D+P+ NLN AF+VAEKYLDIPKMLDAED++NT +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE+LM  YE LASDLLEWI + +P+L +R    T+   + KLE+FR YR + KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI   W+ L++ EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ + K ++++   L ++K L++ H AFE+DL AHQ RVE+I AIA+ELN L Y     +N R Q I +QWD LG  T   R AL +  K  E ID L LEYAKR +PF NW+E A EDLQDM I+ +++EI  LIS H+ FK+TLP+A+ E + IL +      + E+N    S + NPY+ ++ + +  KW  +  LVP+RD AL EE  KQQ  + LR+QFA  AN  GPW++ + + +  +  +    L+ Q + L + E  I+ ++  +D LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM EFR  FNHFD++    L   +FKACL+SLG+ +  D + D++F RI ++VDPNH+G VTF+AFIDF+++E +D D+ +Q+  SF +LA D+ FIT + L +ELPP+QA+YCI RM P++GP++ PGALDY+ FS  LYGESDL
Sbjct:  143 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYERLASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLKQRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSHNVNTRCQKICDQWDNLGSLTHSRREALEKTEKQLETIDQLHLEYAKRAAPFNNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAESNHIKLSGS-NPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANMVGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPSLDLLEQQHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKDHGGALGPEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETTDTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAAPGALDYKSFSTALYGESDL 912          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn1 (actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:2137706])

HSP 1 Score: 883.248 bits (2281), Expect = 0.000e+0
Identity = 423/771 (54.86%), Postives = 565/771 (73.28%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY KL +D+P+ NLN AFDVAE++LDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L++ EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ + + ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K R AL    K  E ID L LEYAKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP+A+ E   IL + + +  +++    + +   NPY+ I+ +++  KW  +  LVP+RD AL EE  +QQ  ++LR+QF   AN  GPW++ + + +  +  +    L+ Q + L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T Y M+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM+EFR  FNHFDR+ +  L   +FKACL+SLG+ +  D + +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT+D L +ELPP+QA+YCI RM P+ GP+S PGALDY  FS  LYGESDL
Sbjct:  123 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMA-GTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. Ensembl Mouse
Match: Actn1 (actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:2137706])

HSP 1 Score: 882.093 bits (2278), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 564/771 (73.15%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY KL +D+P+ NLN AFDVAE++LDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L++ EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ + + ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K R AL    K  E ID L LEYAKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP+A+ E   IL + + +  +++    + +   NPY+ I+ +++  KW  +  LVP+RD AL EE  +QQ  ++LR+QF   AN  GPW++ + + +  +  +    L+ Q + L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T Y M+ IRVGWEQ LT++ + INEV+NQILTRD KG+S+ QM+EFR  FNHFDR +T  +D  DF+ACL+S+G+ +      +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT+D L +ELPP+QA+YCI RM P+ GP+S PGALDY  FS  LYGESDL
Sbjct:  123 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERFLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMA-GTNPYTTITPQEINGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVNYKPKIDQLECDHQLIQEALIFDNKHTNYNMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRKKTGMMDTDDFRACLISMGYNM-----GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITEDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL 887          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|L7UZ85|ACTN_DERFA (Alpha-actinin OS=Dermatophagoides farinae OX=6954 PE=1 SV=1)

HSP 1 Score: 916.376 bits (2367), Expect = 0.000e+0
Identity = 441/771 (57.20%), Postives = 571/771 (74.06%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLG+IWTIILR+AIQDI+VEEM+AKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAFCALIHRHRP+LIDY KL +DNP++N N AFDVAEK+L+IP+MLDAED++ T KPDER++M YVS YYHAF GAQ+AETAANRICKVL+VNQDNE LM  YE LASDLLEWI +  P+L NRTTDNTL GT+ KLEEFR YR   KPP+ E K  LET +NTLQT+LRLS RP Y+P+E  M++DI GAWK L+  EKGFE+WL++E+ RLERL++L +KF  K D HE W   K+E+    +F+   L E+K L K H AFE+DL AHQ RVE+I AIA+ELN LGY  I +IN R Q I +QWD LG  T++ R AL EA +  E++D   LE+AKR +PF NWL++  EDL DM I+ S++EI +LI  HE+FK TL  A+ E K I+ L   +  +           ENPY+ ++ + +  KW  +  LVPQRD  LQ E+++QQ  + LR+QFA+ AN  GPW+E++ D +  +    +  L+ Q  +L + ++ ++ +R  VD+LE +H+ +Q  +I +N YT YTM+ +RVGWEQ LTS+ + INEV+NQILTRD+KG+++ Q++EFR  FNHFD+ RT +L   +FK+CLVSLG+ +  D  +  +FRRI  IVDPN TG+V F+AF+DF+T+E +D D+ EQM  SF ILA D+P+IT D L +ELPP+QA+YCI RM P+ G  + PGALDYR FS  LYGESDL
Sbjct:  118 TLGLIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSWKDGLAFCALIHRHRPDLIDYGKLRKDNPMDNFNLAFDVAEKHLNIPRMLDAEDVVYTAKPDERAIMTYVSWYYHAFHGAQQAETAANRICKVLKVNQDNERLMEEYERLASDLLEWIRRTTPWLENRTTDNTLPGTQKKLEEFRSYRRQHKPPRVEQKANLETNFNTLQTKLRLSKRPAYMPSEGKMVSDITGAWKGLESAEKGFEEWLLSEMMRLERLDHLAQKFKHKADIHEEWTQGKEEMLVSHDFRQCKLNEIKALKKKHEAFESDLAAHQDRVEQIAAIAQELNALGYHDIASINARCQRICDQWDRLGTLTTRRRQALDEAEQILEKVDLFHLEFAKRAAPFNNWLDETREDLVDMFIVHSIEEIQQLIDAHESFKNTLGEADKEYKTIVGLAQEVQPMATQYQIPGGL-ENPYTTLTPEVITTKWRDVKQLVPQRDHTLQTELIRQQCNENLRRQFAEKANVVGPWIERQMDAVTAIGMGMQGTLEDQLQRLHEYDQAVVQYRPHVDDLEKIHQEVQEAMIFENRYTQYTMETLRVGWEQLLTSIHRNINEVENQILTRDSKGITQEQLNEFRTSFNHFDKKRTGRLAPEEFKSCLVSLGYNIRND--DRPEFRRILAIVDPNKTGYVHFDAFLDFMTREYTDTDTAEQMIDSFRILAGDKPYITADELRRELPPDQAEYCIRRMTPYNGQCAVPGALDYRSFSTALYGESDL 885          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|Q7PKQ5|ACTN_ANOGA (Alpha-actinin, sarcomeric OS=Anopheles gambiae OX=7165 GN=Actn PE=3 SV=2)

HSP 1 Score: 913.294 bits (2359), Expect = 0.000e+0
Identity = 444/796 (55.78%), Postives = 577/796 (72.49%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQK-------------------------AETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEEM+AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRP+LIDYSKLS+DNP+ENLN AFDVAEKYLDIP+MLD +D+INT KPDER++M YVS YYHAF GAQ+                         AETAANRICKVL+VNQ+NE LM  YE LASDLLEWI + +P+L +R +D+TL G + KLEE+R YR   KPP+ E K +LET +NTLQT+LRLSNRP Y+PTE  M++DI  +WK L+  EK FE+WL+AE  RLERLE+L +KF  K DTHE W   K+E+ + Q+F++  L ELK L K H AFE+DL AHQ RVE+I AIA+ELNTL Y    ++N R Q I +QWD LG  T + R  L EA +  E+ID L LE+AKR +PF NWL+ A EDL DM I+ +++EI  LI  H+ FK TL  A+ E   I+ L     A+++          NPY+ +S   +  KW  +  LVPQRD  L  E+ KQQ  + LR+QFA+ AN  GPW+E++ D +  +       L+ Q  +L + E+ + A++  ++ELE +H+A+Q  +I +N YT YTM+ +RVGWEQ LTS+ + INEV+NQILTRD+KG+++ Q++EFR  FNHFD+NRT +L   +FK+CLVSLG+ + KD + D DF+RI  +VDPN +G+V F+AF+DF+T+E++D D+ EQ+  SF ILA+D+P+I  D L +ELPP+QA+YCI+RMPP++GPN+ PGALDY  FS  LYGESDL
Sbjct:  128 TLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYSKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQPGSTPFVIHLTKTGLSYRFFVRLFAAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQSDSTLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYMPTEGKMVSDITNSWKGLEHAEKAFEEWLLAETMRLERLEHLAQKFKHKADTHEDWTKGKEEMLQSQDFRNCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCASVNARCQRICDQWDRLGALTQRRRQGLDEAERILEKIDLLHLEFAKRAAPFNNWLDGAREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNVIIGLVRDAEAIVKQEQVPGGLV-NPYTTLSADLISRKWSEVRALVPQRDQTLANELRKQQNNEMLRRQFAEKANAVGPWIERQMDAVTAIGMGISGSLEEQLHRLKEYEQAVYAYKPSIEELEKIHQAVQESMIFENRYTHYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGITQEQLTEFRSSFNHFDKNRTGRLAPEEFKSCLVSLGYSIGKDKQGDMDFQRILAVVDPNASGYVQFDAFLDFMTRESTDTDTAEQVIDSFRILASDRPYILPDELRRELPPDQAEYCIQRMPPYKGPNAIPGALDYMSFSTALYGESDL 922          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|P18091|ACTN_DROME (Alpha-actinin, sarcomeric OS=Drosophila melanogaster OX=7227 GN=Actn PE=1 SV=2)

HSP 1 Score: 912.524 bits (2357), Expect = 0.000e+0
Identity = 445/800 (55.62%), Postives = 578/800 (72.25%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIK-----------------------------PDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEEM+AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRP+LIDY+KLS+DNP+ENLN AFDVAEKYLDIP+MLD +D+INT K                             PDER+VM YVSSYYH F+GAQKAETAANRICKVL+VNQ+NE LM  YE LASDLLEWI + +P+L +R  DN+L G + KLEE+R YR   KPP+ E K +LET +NTLQT+LRLSNRP YLPTE   ++DI  +WK L+  EK FE+WL+AE  RLERLE+L +KF  K D HE W   K+E+ + Q+F+   L ELK L K H AFE+DL AHQ RVE+I AIA+ELNTL Y    ++N R Q I +QWD LG  T + R AL EA +  E+ID L LE+AKR +PF NWL+   EDL DM I+ +++EI  LI  H+ FK TL  A+ E   I+ L   + ++++ +       ENPY+ ++  D+  KW  +  LVPQRD  L  E+ KQQ  + LR+QFA+ AN  GPW+E++ D +  +    +  L+ Q  +L + E+ + A++  ++ELE +H+A+Q  +I +N YT YTM+ +RVGWEQ LTS+ + INEV+NQILTRD+KG+S+ Q++EFR  FNHFD+NRT +L   +FK+CLVSLG+ + KD + D DF+RI  +VDPN+TG+V F+AF+DF+T+E++D D+ EQ+  SF ILA D+P+I  D L +ELPP+QA+YCI+RMPP++GPN  PGALDY  FS  LYGE+DL
Sbjct:  126 TLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPDLIDYAKLSKDNPLENLNTAFDVAEKYLDIPRMLDPDDLINTPKPDERAIMTYVSCYYHAFQGAQQVGNNTALPDERAVMTYVSSYYHCFSGAQKAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRRTMPWLNSRQADNSLAGVQKKLEEYRTYRRKHKPPRVEQKAKLETNFNTLQTKLRLSNRPAYLPTEGKTVSDISNSWKGLELAEKAFEEWLLAETMRLERLEHLAQKFKHKADAHEDWTRGKEEMLQSQDFRQCKLNELKALKKKHEAFESDLAAHQDRVEQIAAIAQELNTLEYHDCVSVNARCQRICDQWDRLGALTQRRRTALDEAERILEKIDILHLEFAKRAAPFNNWLDGTREDLVDMFIVHTMEEIQGLIQAHDQFKATLGEADKEFNLIVNLVREVESIVKQHQIPGGL-ENPYTTLTANDMTRKWSDVRQLVPQRDQTLANELRKQQNNEMLRRQFAEKANIVGPWIERQMDAVTAIGMGLQGSLEDQLHRLKEYEQAVYAYKPNIEELEKIHQAVQESMIFENRYTNYTMETLRVGWEQLLTSINRNINEVENQILTRDSKGISQEQLNEFRSSFNHFDKNRTGRLSPEEFKSCLVSLGYSIGKDRQGDLDFQRILAVVDPNNTGYVHFDAFLDFMTRESTDTDTAEQVIDSFRILAADKPYILPDELRRELPPDQAEYCIQRMPPYKGPNGVPGALDYMSFSTALYGETDL 924          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|P20111|ACTN2_CHICK (Alpha-actinin-2 OS=Gallus gallus OX=9031 GN=ACTN2 PE=2 SV=1)

HSP 1 Score: 890.567 bits (2300), Expect = 0.000e+0
Identity = 420/771 (54.47%), Postives = 572/771 (74.19%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVN+QNFH+SWKDGL  CALIHRHRP+LIDYSKL++D+PI N+N A ++AEK+LDIPKMLDAED++NT KPDER++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NRT + T+   + KLE+FR YR   KPPK + K +LE  +NTLQT+LR+SNRP ++P+E  M++DI GAW+ L++ EKG+E+WL+ EI+RLERLE+L +KF  K  THE WA+ K++I   ++++   L E++ +L+ H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N+R Q I +QWD LG  T K R AL    K  E ID L LE+AKR +PF NW+E A EDLQDM I+ S++EI  LIS H+ FK TLP A+ E + IL +++ +  +I++     S A NPYS +++++++ KW  +  LVPQRD +LQEE+ +Q   ++LR+QFA  AN  GPW++ + + +     +    L+ Q  +L + E+ I+ ++  +D+LE  H+ +Q  ++ DN +T YTM+ IRVGWE  LT++ + INEV+ QILTRD KG+++ QM++FR  FNHFDR +   +D  DF+ACL+S+G+ L      +++F RI ++VDPN  G VTF++FIDF+T+E +D D+ EQ+  SF ILA+D+P+I  D L +ELPP QAQYCI+RMP + GP S PGALDY  FS+ LYGESDL
Sbjct:  133 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHLSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHEQWAYGKEQILLQKDYESASLTEVRAMLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNDRCQKICDQWDSLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLISAHDQFKATLPEADGERQAILSIQNEVEKVIQSYSMRIS-ASNPYSTVTVEEIRTKWEKVKQLVPQRDQSLQEELARQHANERLRRQFAAQANVIGPWIQTKMEEIARSSIEMTGPLEDQMNQLKQYEQNIINYKHNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNDFRASFNHFDRRKNGLMDHDDFRACLISMGYDL-----GEAEFARIMSLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILADELRRELPPEQAQYCIKRMPQYTGPGSVPGALDYTSFSSALYGESDL 897          
BLAST of Alpha-actinin vs. UniProt/SwissProt
Match: sp|Q9JI91|ACTN2_MOUSE (Alpha-actinin-2 OS=Mus musculus OX=10090 GN=Actn2 PE=1 SV=2)

HSP 1 Score: 889.797 bits (2298), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 571/771 (74.06%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVN+QNFH SWKDGL  CALIHRHRP+LIDYSKL++D+PI N+N A ++AEK+LDIPKMLDAED++NT KPDER++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NRT + T+   + KLE+FR YR   KPPK + K +LE  +NTLQT+LR+SNRP ++P+E  M++DI GAW+ L++ EKG+E+WL+ EI+RLERLE+L +KF  K  THE WA+ K++I   ++++   L E++ LL+ H AFE+DL AHQ RVE+I AIA+ELN L Y     +N+R Q I +QWD LG  T K R AL    K  E ID L LE+AKR +PF NW+E A EDLQDM I+ S++EI  LI+ HE FK TLP A+ E + IL +++ +  +I++     S++ NPYS +++ +L++KW  +  LVP RD +LQEE+ +Q   ++LR+QFA  AN  GPW++ + + +     Q    L+ Q  +L + E  I+ +++ +D+LE  H+ +Q  ++ DN +T YTM+ IRVGWE  LT++ + INEV+ QILTRD KG+++ QM+EFR  FNHFDR +   +D  DF+ACL+S+G+ L      +++F RI  +VDPN  G VTF++FIDF+T+E +D D+ EQ+  SF ILA+D+P+I  + L +ELPP+QAQYCI+RMPP+ GP S PGALDY  FS+ LYGESDL
Sbjct:  130 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHETWAYGKEQILLQKDYESASLTEVRALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSILAIQNEVEKVIQSYSIRISSS-NPYSTVTMDELRNKWDKVKQLVPVRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDL-----GEAEFARIMTLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPPYSGPGSVPGALDYTAFSSALYGESDL 894          
BLAST of Alpha-actinin vs. TrEMBL
Match: K1RH58 (Alpha-actinin, sarcomeric OS=Crassostrea gigas OX=29159 GN=CGI_10003110 PE=4 SV=1)

HSP 1 Score: 964.911 bits (2493), Expect = 0.000e+0
Identity = 464/771 (60.18%), Postives = 593/771 (76.91%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDITVEE++AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRPELIDY KLS+DNP+ENLN AFDVAEK+LDIP+MLD EDM+N++KPDERSVMAYVSSYYHAF+GAQ+AETAANRICKVL+VNQ+NE LM  YE LASDLLEWI K  P+L NRTTDNTL GT+ KLEEFR YR   KPPK E K  LE  +NTLQTRLRLSNRP YLPTE  M++DI  AWK L+  EKGFE+WL++E+QRLERL++L +KF  +C  HE WA  K+E+ + Q++   GL +LK + K H AFE+DL AHQ RVE+I AIA+ELN L Y  + T+N R Q I +QWD LG  T++ R  L EA K  E+IDTL L++AKR +PF NWL+ A+EDL D+ I+ S++EI +L+  HETFK TLP A+ E   I+ L   +  L    G   +  +NPY+ +  +D+ +KW  + +LVP+RD  LQ E+MKQQ   +LR+QFA  AN  GPW+E + D + ++  Q+K  L+ Q  KL + E+    ++  +DELE  ++ +Q  +I +N YT YTM+ +RVGWEQ LT++ + INEV+NQILTRD+KG+SE QM+EFR  FNHFD+NR+R+L+  +FKACLVSLG+ +  D + D+DF+RI +IVDPN++G+VTFEAF+DF+T+E +D D+ EQ+ +SF ILA D+P+IT  IL QELPP+QA+YCI+RM P+ G ++ PGALDY  FS  LYGESDL
Sbjct:  112 TLGMIWTIILRFAIQDITVEELTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPELIDYHKLSKDNPLENLNTAFDVAEKHLDIPRMLDPEDMVNSVKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKVNQENERLMEEYERLASDLLEWIRKTTPWLENRTTDNTLPGTQRKLEEFRDYRRKHKPPKLEDKARLENSFNTLQTRLRLSNRPAYLPTEGKMVSDIANAWKGLEFAEKGFEEWLLSELQRLERLDHLAQKFRHRCQIHEEWAEGKEEMLQSQDYLRCGLNQLKAMKKKHEAFESDLAAHQDRVEQIAAIAQELNLLEYHDVLTVNTRCQKICDQWDRLGTLTAQRRQGLDEAEKILEKIDTLHLDFAKRAAPFNNWLDGAKEDLLDIFIVHSVEEIQQLLEAHETFKQTLPEADKEFNAIMALASEVQRLANQVGLQLT--DNPYTTVDPQDIANKWADVKHLVPKRDGTLQNEMMKQQNNMRLRKQFAAKANVVGPWIENQLDAVASMGIQTKSSLEEQLKKLRQYEQATTQYKPNIDELERYNQEIQEAMIFENHYTQYTMETLRVGWEQLLTAIARNINEVENQILTRDSKGISEDQMNEFRVSFNHFDKNRSRRLEPKEFKACLVSLGYNIRDDRQGDADFQRIMSIVDPNNSGYVTFEAFLDFMTRETADTDTAEQVMQSFKILAGDKPYITAQILRQELPPDQAEYCIQRMAPYSGRDAVPGALDYMSFSTALYGESDL 880          
BLAST of Alpha-actinin vs. TrEMBL
Match: A0A1S3HKE4 (alpha-actinin isoform X3 OS=Lingula unguis OX=7574 GN=LOC106156043 PE=4 SV=1)

HSP 1 Score: 963.755 bits (2490), Expect = 0.000e+0
Identity = 466/771 (60.44%), Postives = 585/771 (75.88%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE++AKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAFCALIHRHRPEL+DY KLSRDNP++NLN AFDVAEK+LDIPKMLDAEDM+N+ KPDERSVMAYVSSYYHAF+GAQ+AETAANRICKVL+VNQ+NE LM  YE +ASDLLEWI +  P+L NR TDNTL GT+ KLEEFR YR   KPPK E K  LET +NTLQTRLRLSNRP YLPTE  M++DI  AWK L+  EKGFE+WL++E+QRLERL++L +KF  KCD HE WA  K+++ + Q+FK   L ELK + K H AFE+DL AHQ RVE+I AIA ELNTL Y    ++N R Q I +QWD LG  T + R+AL EA +  E IDTL LE+AKR +PF NW++ A+EDL DM I+ + +EI  LI  HE FK TL  A+ E   I+ L   +  + +   +     ENPY+ +S KD+  KW  +  LVPQRD  L +E+++Q+  D+LR QFA  AN  GPW+EK  D + +V   +K  L+ Q  +L   EE +LAFR  +DELE  ++ +Q  +I DN +T YTM+ +RVGWEQ +TS+ + INEV+NQI+TRD+KG+S+ QM EFRK FNHFD+NRTR L+  +FKACL+SLG+ +  D + ++DF+RI +IVDPN TG VTF+AF+DF+T+E +D D+ EQ+ +SF ILA D+P+IT +IL  ELPP+QA+YCI+RM P+ G +S  GALDY  FS  LYGESDL
Sbjct:  124 TLGMIWTIILRFAIQDISVEELTAKEGLLLWCQRKTAPYKNVNVQNFHLSWKDGLAFCALIHRHRPELLDYYKLSRDNPLDNLNLAFDVAEKHLDIPKMLDAEDMVNSAKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKVNQENERLMEEYERMASDLLEWIRRTTPWLENRHTDNTLPGTQKKLEEFRDYRRKYKPPKLEEKARLETTFNTLQTRLRLSNRPAYLPTEGKMVSDIANAWKGLEGAEKGFEEWLLSELQRLERLDHLAQKFKHKCDIHEEWAFGKEDMLQSQDFKKCRLNELKAMKKKHEAFESDLAAHQDRVEQIAAIASELNTLDYHDSPSVNARCQRICDQWDALGTLTQRRRSALEEAERILERIDTLHLEFAKRAAPFNNWMDGAKEDLVDMFIVHTTEEIQGLIDAHEQFKQTLGEADKEFNSIIGLVTEVTRMCQQ--YDLVLPENPYTTLSAKDIASKWEEVKLLVPQRDQTLHQEMLRQRNNDRLRNQFANKANVVGPWIEKHLDAVASVGMNTKESLEQQMQRLKSYEENVLAFRPNMDELERYNQEVQEAMIFDNRFTQYTMETLRVGWEQLVTSIARNINEVENQIMTRDSKGISQEQMEEFRKSFNHFDKNRTRSLEGKEFKACLISLGYNIRDDRQGEADFQRIMSIVDPNGTGRVTFDAFLDFMTRETTDTDTAEQVMQSFKILAGDKPYITAEILRTELPPDQAEYCIQRMAPYSGVDSTKGALDYTSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. TrEMBL
Match: R7VCM4 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_101963 PE=4 SV=1)

HSP 1 Score: 963.755 bits (2490), Expect = 0.000e+0
Identity = 460/771 (59.66%), Postives = 596/771 (77.30%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEEM+AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRPELIDY+KLS+DNP+ENLN AFDVAEKYLDIP+MLDAEDM+N++KPDERSVMAYVSSYYHAF+GAQ+AETAANRICKVL++NQ+NE LM  YE +ASDLLEWI +  P+L NRTTDNTL GT+ KLEEFR+YR   KPPK E K +LET +NTLQTRLRLSNRP Y+PTE  M++DI  AWK L++ EKGFEDWL++E+QRLERL++L +KF  KCD HE W+  KDE+ + Q+FK   L +LK + + H AFE+DL AHQ RVE+I AIA+ELNTLGY  + ++N+R Q I +QWD+LG  T   + AL EA    E ID L LE+AKR +PF NW++ A+EDL DM I+ + +EI  LI  HE FK TL  A+ E   I+ L   +  + +  G      ENPY  I+ +D+ +KW  +  LVPQRD  LQ E+++QQ  ++LR+QFAQ AN  G W+E+  D++ +V  Q K  L+   AKL  +E ++ A+R  + +LE +++ +Q  +I +NS+TPYTM+ +RVGWEQ LTSV + INEV+NQILTRD+KG++  QM EFRK F HFD++++R+L+  +FK+CL+SLG+ +  D + ++DF+RI +IVDPN+ G V+F+AF+DF+T+E +DND+ EQ+ +SF ILA D PFIT DIL +ELPP+QA+YCI+RM PF G  + PGALDY  FS  LYGES++
Sbjct:  119 TLGMIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPELIDYNKLSKDNPLENLNLAFDVAEKYLDIPRMLDAEDMVNSVKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKINQENERLMEEYERMASDLLEWIRRTTPWLENRTTDNTLPGTQRKLEEFREYRRAHKPPKLEEKAKLETTFNTLQTRLRLSNRPAYIPTEGKMVSDIANAWKGLERAEKGFEDWLLSELQRLERLDHLAQKFKHKCDIHEEWSTGKDEMLQAQDFKKCHLNDLKAMKRKHEAFESDLAAHQDRVEQIAAIAQELNTLGYHDVVSVNSRCQRICDQWDLLGNLTQGRKNALEEAEHILERIDQLHLEFAKRAAPFNNWMDGAKEDLVDMFIVHTTEEIQGLIDAHEQFKQTLGEADKEYNSIISLVQEVQRISQQYGIMGGN-ENPYISITAQDIANKWAEVRQLVPQRDQTLQAEMIRQQNNERLRRQFAQKANVVGQWIERHLDMVASVGVQ-KGSLEDHLAKLHGVEGDVNAYRPNIADLERINEEVQEAMIFENSHTPYTMETLRVGWEQLLTSVARNINEVENQILTRDSKGITNEQMEEFRKSFFHFDKSKSRRLEAKEFKSCLISLGYNIRDDRQGEADFQRIMSIVDPNNMGHVSFDAFLDFMTREATDNDTAEQVMQSFRILAADAPFITADILRRELPPDQAEYCIKRMAPFHGQGAPPGALDYTSFSTALYGESNV 887          
BLAST of Alpha-actinin vs. TrEMBL
Match: A0A0B7B7H5 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF162867 PE=4 SV=1)

HSP 1 Score: 959.903 bits (2480), Expect = 0.000e+0
Identity = 458/771 (59.40%), Postives = 590/771 (76.52%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDITVEE++AKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAFCALIHRHRPEL+DY KLSRDNPIENLN AFD+AEKYLDIP+MLD EDM+N+ KPDERSVMAYVSSYYHAF+GAQ+AETAANRICKVL+VNQ+NE LM  YE LASDLLEWI +  P+L NRTTDNTL GT+ +LEEFR YR  +KPPK E K +LE  +NTLQTRLRLSNRP YLPTE  M++DI  AWK L+  EKGFE+WL++E+QRLERL++L +KF  KC+ HE WA  K+E+ K  +FK   L ELK + K H AFE+DL AHQ RVE+I AIA+ELN+L Y  + T+N R Q I +QWD+LG+ T K R  L EA +  E ID L LE+AKR +PF NW++ A+EDL+DM I+ + +E+  LI  HE FK TL  A+ E   I+ L   I  L     F  +  +NPYS +  +D+ +KW  +  L+P RD+ LQ+E+M+QQ  ++LR+QFA  AN  G W+E + D + ++    +  L+ Q  KL + ++ ++A++  ++ELE  ++ +Q  +I +N YT YTM+ +RVGWEQ LT++ + INEV+NQILTRD+KG+SEAQM+EFR  FNHFD+N T++L+  +FKACL+SLG+++  D + ++DF+RI +IVDPN T  VTF+AF+DF+T+E +D D+ EQ+ +SF ILA D+PFIT  IL QELPP+QA+YCI+RM P+ G ++ PGALDY  FS  LYGESDL
Sbjct:  121 TLGMIWTIILRFAIQDITVEELTAKEGLLLWCQRKTAPYKNVNVQNFHLSWKDGLAFCALIHRHRPELLDYYKLSRDNPIENLNTAFDIAEKYLDIPRMLDPEDMVNSAKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKVNQENEKLMEEYERLASDLLEWIRRTRPWLENRTTDNTLPGTQRRLEEFRDYRRKQKPPKLEDKAKLENSFNTLQTRLRLSNRPAYLPTEGKMVSDIANAWKGLETAEKGFEEWLLSELQRLERLDHLAQKFRHKCEIHEEWAAGKEEMLKSGDFKRCRLNELKAMKKKHEAFESDLAAHQDRVEQIAAIAQELNSLDYHDVGTVNGRCQRICDQWDVLGQLTIKRREGLEEAERILERIDQLHLEFAKRAAPFNNWMDGAKEDLRDMFIVHTTEEVEGLIDAHEQFKATLGEADKEYGNIVGLVQEIQRL--GQQFGITPPDNPYSTLHAQDITNKWSEVKQLIPHRDAILQQEMMRQQNNERLRRQFAAKANVVGQWIENQLDAVASIGVTGRSSLEEQLKKLQQFDKAVVAYKPNMEELERYNQEVQEAMIFENRYTQYTMETLRVGWEQLLTAIARNINEVENQILTRDSKGISEAQMNEFRMSFNHFDKNHTKRLEPKEFKACLISLGYKIRDDKQGEADFQRIMSIVDPNRTNHVTFDAFLDFMTRETADTDTAEQVMQSFKILAGDKPFITAQILRQELPPDQAEYCIQRMAPYSGRDAVPGALDYMSFSTALYGESDL 889          
BLAST of Alpha-actinin vs. TrEMBL
Match: A0A1S3HNG4 (alpha-actinin, sarcomeric isoform X4 OS=Lingula unguis OX=7574 GN=LOC106156043 PE=4 SV=1)

HSP 1 Score: 957.592 bits (2474), Expect = 0.000e+0
Identity = 463/771 (60.05%), Postives = 584/771 (75.75%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE++AKEGLLLWC+RKTAPYKNVNVQNFH+S+KDGLAFCALIHRHRPEL+DY  LS+DNP++NLN AFDVAEK+LDIPKMLDAEDM+N+ KPDERSVMAYVSSYYHAF+GAQ+AETAANRICKVL+VNQ+NE LM  YE +ASDLLEWI +  P+L NR TDNTL GT+ KLEEFR YR   KPPK E K  LET +NTLQTRLRLSNRP YLPTE  M++DI  AWK L+  EKGFE+WL++E+QRLERL++L +KF  KCD HE WA  K+++ + Q+FK   L ELK + K H AFE+DL AHQ RVE+I AIA ELNTL Y    ++N R Q I +QWD LG  T + R+AL EA +  E IDTL LE+AKR +PF NW++ A+EDL DM I+ + +EI  LI  HE FK TL  A+ E   I+ L   +  + +   +     ENPY+ +S KD+  KW  +  LVPQRD  L +E+++Q+  D+LR QFA  AN  GPW+EK  D + +V   +K  L+ Q  +L   EE +LAFR  +DELE  ++ +Q  +I DN +T YTM+ +RVGWEQ +TS+ + INEV+NQI+TRD+KG+S+ QM EFRK FNHFD+NRTR L+  +FKACL+SLG+ +  D + ++DF+RI +IVDPN TG VTF+AF+DF+T+E +D D+ EQ+ +SF ILA D+P+IT +IL  ELPP+QA+YCI+RM P+ G +S  GALDY  FS  LYGESDL
Sbjct:  124 TLGMIWTIILRFAIQDISVEELTAKEGLLLWCQRKTAPYKNVNVQNFHLSFKDGLAFCALIHRHRPELLDYDTLSKDNPLDNLNLAFDVAEKHLDIPKMLDAEDMVNSAKPDERSVMAYVSSYYHAFSGAQQAETAANRICKVLKVNQENERLMEEYERMASDLLEWIRRTTPWLENRHTDNTLPGTQKKLEEFRDYRRKYKPPKLEEKARLETTFNTLQTRLRLSNRPAYLPTEGKMVSDIANAWKGLEGAEKGFEEWLLSELQRLERLDHLAQKFKHKCDIHEEWAFGKEDMLQSQDFKKCRLNELKAMKKKHEAFESDLAAHQDRVEQIAAIASELNTLDYHDSPSVNARCQRICDQWDALGTLTQRRRSALEEAERILERIDTLHLEFAKRAAPFNNWMDGAKEDLVDMFIVHTTEEIQGLIDAHEQFKQTLGEADKEFNSIIGLVTEVTRMCQQ--YDLVLPENPYTTLSAKDIASKWEEVKLLVPQRDQTLHQEMLRQRNNDRLRNQFANKANVVGPWIEKHLDAVASVGMNTKESLEQQMQRLKSYEENVLAFRPNMDELERYNQEVQEAMIFDNRFTQYTMETLRVGWEQLVTSIARNINEVENQIMTRDSKGISQEQMEEFRKSFNHFDKNRTRSLEGKEFKACLISLGYNIRDDRQGEADFQRIMSIVDPNGTGRVTFDAFLDFMTRETTDTDTAEQVMQSFKILAGDKPYITAEILRTELPPDQAEYCIQRMAPYSGVDSTKGALDYTSFSTALYGESDL 892          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:103031817])

HSP 1 Score: 881.322 bits (2276), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 560/771 (72.63%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY+KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  ++T+   + KLE+FR YR   KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L+  EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ +   ++++ + L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K   AL    K  E ID L LE+AKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP A+ E + IL + + I  +++    + +   NPY+ I+  ++  KW  +  LVPQRD AL EE  +QQ  ++LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INE++NQILTRD KG+S+ Q+SEFR  FNHFDR+ +  L   +FKACL+SLGF +  D + +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF +LA D+ +I  D L +ELPP+QA YCI RM P+ GP++ PGALDY  FS  LYGESDL
Sbjct:  132 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPESTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNAWGALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEAMLTQKDYETVTLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQKICDQWDALGALTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMA-GTNPYTTINPTEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIELHGTLEDQLTNLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLSEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQADYCISRMAPYTGPDAVPGALDYMSFSTALYGESDL 901          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn3a (actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-9])

HSP 1 Score: 877.856 bits (2267), Expect = 0.000e+0
Identity = 423/771 (54.86%), Postives = 563/771 (73.02%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVNVQNFH+SWKDGLA CALIHRHRP+LIDYSKL +D+PI NLN AF+VAEK+LDIPKMLDA+D++NT KPDE+++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NR  + T+   + KLE+FR YR + KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AWK L++ EKG+E+WL+ EI+RLERLE+L +KF  KC  HE+W   K+++   ++++   L E++ L++ H AFE+DL AHQ RVE+I AIA+ELN L Y    TIN R Q I ++WD LG  T K R +L    K  E ID L LE+AKR +PF NW++ A EDLQDM I+ S++EI  LI+ H+ FK TLP A+ E    + +++ I  + +  G    T ENPY+ IS +D+ +KW A+  LVP RD  LQEEV +QQ  ++LR+QFA  AN  GPW++ + + ++ V       L+ Q   L + E+ I+ ++S +D+LE  H+  Q  +I DN +T YTM+ +RVGWEQ LT++ + INEV+NQILTRD KG+S+ Q++EFR  FNHFDR R   +D  DF+ACL+S+G+ L      + +F RI  +VD N+TG VTF+AFIDF+T+E ++ D+ EQ+  SF ILA+D+ +IT + L +ELPP QA+YCI RM  F G N+   ALDY  FS+ LYGESDL
Sbjct:  133 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPKMLDADDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRVAEQTMPAMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLEHLAEKFKQKCTLHESWTAGKEQLLSLKDYESASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAATINARCQGICDEWDNLGTLTQKRRDSLERVEKLWETIDQLFLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATMGIQNEILKIAQTYGIKL-TGENPYTVISPQDISNKWEAVKQLVPMRDQMLQEEVARQQSNERLRRQFAAQANIIGPWIQTKMEEISHVSIDIAGSLEEQMGNLKQYEQNIINYKSNIDKLEGDHQLSQEGLIFDNKHTNYTMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL-----GEVEFARIMTLVDANNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKTYITVEELRRELPPEQAEYCISRMTRFVGVNAPADALDYISFSSALYGESDL 897          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn3a (actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-9])

HSP 1 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 423/771 (54.86%), Postives = 563/771 (73.02%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVNVQNFH+SWKDGLA CALIHRHRP+LIDYSKL +D+PI NLN AF+VAEK+LDIPKMLDA+D++NT KPDE+++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NR  + T+   + KLE+FR YR + KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AWK L++ EKG+E+WL+ EI+RLERLE+L +KF  KC  HE+W   K+++   ++++   L E++ L++ H AFE+DL AHQ RVE+I AIA+ELN L Y    TIN R Q I ++WD LG  T K R +L    K  E ID L LE+AKR +PF NW++ A EDLQDM I+ S++EI  LI+ H+ FK TLP A+ E    + +++ I  + +  G    T ENPY+ IS +D+ +KW A+  LVP RD  LQEEV +QQ  ++LR+QFA  AN  GPW++ + + ++ V       L+ Q   L + E+ I+ ++S +D+LE  H+  Q  +I DN +T YTM+ +RVGWEQ LT++ + INEV+NQILTRD KG+S+ Q++EFR  FNHFDR R   +D  DF+ACL+S+G+ L      + +F RI  +VD N+TG VTF+AFIDF+T+E ++ D+ EQ+  SF ILA+D+ +IT + L +ELPP QA+YCI RM  F G N+   ALDY  FS+ LYGESDL
Sbjct:   89 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPKMLDADDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRVAEQTMPAMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLEHLAEKFKQKCTLHESWTAGKEQLLSLKDYESASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAATINARCQGICDEWDNLGTLTQKRRDSLERVEKLWETIDQLFLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATMGIQNEILKIAQTYGIKL-TGENPYTVISPQDISNKWEAVKQLVPMRDQMLQEEVARQQSNERLRRQFAAQANIIGPWIQTKMEEISHVSIDIAGSLEEQMGNLKQYEQNIINYKSNIDKLEGDHQLSQEGLIFDNKHTNYTMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL-----GEVEFARIMTLVDANNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKTYITVEELRRELPPEQAEYCISRMTRFVGVNAPADALDYISFSSALYGESDL 853          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:103031817])

HSP 1 Score: 875.544 bits (2261), Expect = 0.000e+0
Identity = 420/771 (54.47%), Postives = 558/771 (72.37%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY+KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  ++T+   + KLE+FR YR   KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L+  EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ +   ++++ + L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K   AL    K  E ID L LE+AKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP A+ E + IL + + I  +++    + +   NPY+ I+  ++  KW  +  LVPQRD AL EE  +QQ  ++LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L + E+ I+ ++ ++D+LE  H+ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INE++NQILTRD KG+S+ Q+SEFR  FNHFDR RT  +D  DF+ CL+S+G+ +      +++F RI +IVDPN  G VTF+AFIDF+++E +D D+ +Q+  SF +LA D+ +I  D L +ELPP+QA YCI RM P+ GP++ PGALDY  FS  LYGESDL
Sbjct:  132 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRVPESTMQAMQQKLEDFRDYRRQHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDISNAWGALEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEAMLTQKDYETVTLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELEYYDSPSVNARCQKICDQWDALGALTQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMA-GTNPYTTINPTEINAKWDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIELHGTLEDQLTNLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLSEFRASFNHFDRKRTGLMDGEDFRTCLISMGYNM-----GEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKVLAGDKNYILADELRRELPPDQADYCISRMAPYTGPDAVPGALDYMSFSTALYGESDL 896          
BLAST of Alpha-actinin vs. Ensembl Cavefish
Match: actn4 (actinin alpha 4 [Source:NCBI gene;Acc:103022122])

HSP 1 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 420/772 (54.40%), Postives = 555/772 (71.89%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPD-ERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAF ALIHRHRPELIDY KL +D+P+ NLN AF+VAEKYLDIPKMLDAED     K   E+++M YVS +YHAF+GAQKAETAANRICKVL VNQ+NE+LM  YE LASDLLEWI + +P+L NR  + T+   + KLE+FR YR + KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI GAW +L+  EKG+E+WL+ EI+RLERL++L +KF  K   HE+W   K+ +   ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I  QWD+LG  T   R +L    K  E ID L LEYAKR +PF NW+E A EDLQDM I+ +++EI  LI+ HE FK TLP A  E + I  ++  +  + + NG   +   NPY+ I+   +  KW  +  LVPQRD ALQEE+ +QQ  D LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L + E+ I+ ++  +D+LE  H+ +Q  +I DN YT YTM+ +RVGWEQ LT++ + INE++NQILTRD KG+S+ Q+ E+R  FNHFD++    L   +FKACL+SLG+ +  + + D++F RI  IVDPN++G VTF+AFIDF+++E +D D+ +Q+  SF ILA D+ +IT + L +ELPP+QA+YCI RM P+ GP++ PGALDY  FS  LYGESDL
Sbjct:  129 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIDYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDTWYAAKERYEKAIMTYVSCFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEKLASDLLEWIRRTIPWLENRAPEKTMAEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINGAWHKLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKATIHESWTDGKEAMLTQKDYETASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICEQWDVLGSLTQSRRESLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIEEIQGLITAHEQFKATLPEANKEREAIQAIQAEVQKIAQYNGIKLA-GTNPYTTITPSSIDSKWDKVQKLVPQRDQALQEELARQQSNDHLRRQFANQANIVGPWIQNKMEEIGRISIEMNGTLEDQLTHLRQYEQSIIDYKPNIDQLEGNHQLIQEALIFDNKYTAYTMEHLRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLHEYRTSFNHFDKDHGGALQAEEFKACLISLGYDVENNKQGDAEFARIMGIVDPNNSGAVTFQAFIDFMSRETTDTDTADQVIASFKILAGDKNYITAEELRRELPPDQAEYCIGRMAPYAGPDAVPGALDYMSFSTALYGESDL 899          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 875.544 bits (2261), Expect = 0.000e+0
Identity = 419/771 (54.35%), Postives = 559/771 (72.50%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAF ALIHRHRP+LIDY KL +D+PI NLN AF+VAEKYLDIPKMLDAED++ T +PDE+++M YVS YYHAF+GAQKAETAANRICKVL VNQ+NE LM  YEH+ASDLL+WI ++ P+L NR  +NT+   + KLE FR YR + KPPK + K +LE  +NTLQT+LRL NRP ++P+E  M++DI   W  L++ EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+ + + +++  + L ELK LL+ H AFE+DL AHQ RVE+I AIA+ELN L Y  + ++N R Q+I  +WD LG+ T + +  L    K  E ID L LE+AKR +PF  W++ A EDLQDM I+ ++ EI  LIS HE FK TLP AE E   IL + + I  + +      +   NPYS I+  D+  KW  M   VP RD +L++ + +QQ  + LR+QFA  AN  GPW++ + + +  +  +    L+ Q  +L + E+ I+ ++  +D+LE+ ++ +Q  +I DN +T YTM+ IRVGWEQ LT++ + INEV+ QILTRD KG+S+ QM EFR  FNHFD++ + KL   +FKACL+SLG+ +  D + +++F RI  +VDPN+TG VTF++FIDF+T+E +D D+ +Q+  SF ILA D+ FIT D L +ELPP+QA+YCI RM P+RGP++ PGALDY  FS  LYGESDL
Sbjct:   88 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYEKLRKDDPITNLNNAFEVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNQENEKLMEDYEHMASDLLDWI-RRTPWLENRVPENTMQAMQGKLEGFRDYRRVHKPPKAQEKCQLEISFNTLQTKLRLMNRPAFMPSEGKMVSDIANGWSMLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHEAWTAGKEAMLEKRDYDSVSLTELKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDVASVNARCQDICAEWDKLGDLTQRRKDTLERTEKVLETIDQLYLEFAKRAAPFNTWMDGAVEDLQDMFIVHTIDEIQGLISAHEQFKDTLPEAEKEKSAILGVHNEIQKVAQTYNVKLA-GPNPYSAITPHDISSKWERMTQQVPLRDDSLRDLLARQQANETLRRQFAASANIVGPWIQTKMEEIGHISIEMHGTLEDQLNQLRRYEQNIINYKPNIDKLESEYQLVQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVETQILTRDAKGISQEQMHEFRASFNHFDKDHSGKLGAEEFKACLISLGYDVGNDQQGEAEFARIMTVVDPNNTGLVTFQSFIDFMTRETTDTDTADQVIASFKILAGDKNFITADELRRELPPDQAEYCIARMAPYRGPDAVPGALDYMSFSTALYGESDL 856          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000684.1 (pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 gene:ENSPMAG00000000623.1 transcript:ENSPMAT00000000684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 508.449 bits (1308), Expect = 3.865e-173
Identity = 242/419 (57.76%), Postives = 314/419 (74.94%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSL 1258
            TLGMIWTIILR+AIQDI++E  SAKEGLLLWC+RKTAPYKNVNVQNFH SWKDGLAF ALIHRHRP+LIDY KL +D+PI NLN AF+VAEKYLDIPKMLDAED++NT +PDE+++M YVS YYHAF+GAQKAETAANRICKVL VN +  +L  +       LLEWIN+ +P L +R T N +   + KLE+FR YR + KPPK   K +LE  +NTLQT+LRL NRP ++P+E  +++DI  AW  L++ EKG+E+WL+ EI+RLERL++L +KF  K   H++W   K ++ + ++++ + L ELK LLK H AFE+DL AHQ RVE+I AIA+ELN L Y  + ++N + + I ++WD LGE T   + +L    K  E ID L LE+AKR +PF  W++ A EDLQDM I+ ++
Sbjct:   92 TLGMIWTIILRFAIQDISIENTSAKEGLLLWCQRKTAPYKNVNVQNFHTSWKDGLAFNALIHRHRPDLIDYDKLRKDDPIGNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNHERVDLSCACVRARLQLLEWINRTIPVLEDRNTQNNMPAMQGKLEDFRDYRRVHKPPKAGDKCQLEINFNTLQTKLRLMNRPAFMPSEGKLVSDIGNAWSHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHKSWTEGKQQMLQQKDYESVSLAELKALLKKHEAFESDLAAHQDRVEQIAAIAQELNDLNYHDVASVNTKCKEICDEWDDLGEWTQTRKDSLSRTEKVLETIDHLYLEFAKRAAPFNTWMDGAAEDLQDMFIVHTI 510          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001834.1 (pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1 gene:ENSPMAG00000001663.1 transcript:ENSPMAT00000001834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 300.056 bits (767), Expect = 1.913e-87
Identity = 152/377 (40.32%), Postives = 223/377 (59.15%), Query Frame = 2
Query:    5 LGMIWTIILRYAIQDITV------EEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNR 1117
            LG+IWTIILR+ IQDI+V      E  SAK+ LLLWC+ KTA Y NVNV NF  SW+DGLAF A+IH+HRP+L+D+ KL + N   NL +AF+ AE++L + K+LD E  ++  +PDE+S++ YV S+YH F+  +       RI KVL    + + ++  YE LAS+LLEWI + +  L +R   N+L+G + +L  F  YR +EKPPK+  KG LE +  T+Q+++R +N+  Y P E  ++ +I  AW+ L+K E G E  L  E+ R E+LE L ++F+ K    E W      +    NF    L  ++   K H A E D+ A++GRV  +  +A EL    Y ++  +  R   +   W  L E  +  R
Sbjct:   47 LGLIWTIILRFQIQDISVQTEDSKETRSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAVIHKHRPDLVDFEKLKKSNAQHNLQHAFNAAEQHLGVTKLLDPEADVSVDQPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLDSAIEADRMVERYESLASELLEWIGRTITALNSRDFPNSLVGVQQQLHAFSSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVAEINRAWERLEKAEHGRELALRDELIRQEKLEQLARRFDRKAAMRETWLAENQRLVMQDNF-GADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARR 422          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004049.1 (pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1 gene:ENSPMAG00000003699.1 transcript:ENSPMAT00000004049.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.204 bits (757), Expect = 3.538e-87
Identity = 157/378 (41.53%), Postives = 224/378 (59.26%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEE------MSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNR 1117
            TLG+IWTIILR+ IQDI+VE        SAK+ LLLWC+ KTA Y NV V NF  SW+DGLAF ALIH+HRP+LID+  L   +P  N+  AF+VAE+ L + ++LDAED I    PDE+SV+ YV +YYH F+  +       RI KVL+   + + ++  Y+ LASDLL+WI + +  L NRT  N+L G + +L+ F  YR +EKP K+  KG LE +  T+Q+R+R +N+  +LP E  +I++I  AW+ L+K E   E  L  E+ R E+LE L ++F+ K    E+W      +    NF    L  ++   K H A E D+ A++ RV  ++ +A+EL    Y  +  +  R  N+   W  L E     R
Sbjct:   98 TLGLIWTIILRFQIQDISVETEDSREVKSAKDALLLWCQMKTAGYPNVRVHNFTTSWRDGLAFNALIHKHRPDLIDFDALDPADPYGNMQTAFNVAEQKLGLTQLLDAED-IAVEHPDEKSVITYVVTYYHYFSKMKALAVEGKRIGKVLESAMETDQMIEKYDSLASDLLDWIEQTIAILNNRTFANSLTGVQQQLQAFSSYRTVEKPAKFTEKGNLEVLLFTIQSRMRANNQKVFLPGEGKLISEINKAWERLEKAEHERELALREELIRQEKLEQLARRFDRKAAMRESWLTENQCLVLQDNFGS-DLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRR 473          
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 299.286 bits (765), Expect = 5.148e-86
Identity = 154/377 (40.85%), Postives = 231/377 (61.27%), Query Frame = 2
Query:    5 LGMIWTIILRYAIQDITVE------EMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNR 1117
            LG+IWTIILR+ IQDI+VE        SAK+ LLLWC+ KTA Y+NVN+ NF  SW+DGLAF A++H+HRP+LI++ KL + N   NL  AF++AE+ L + K+LD ED I+  +PDE+S++ YV +YYH F+  +       RI KVL+   + + +++ YE LAS+LLEWI + +  L NR   N+L G + +L+ F  YR +EKP K+  KG LE +  T+Q+++R +N+  Y P E  ++N+I  AW+ L+K E   E  L  E+ R E+LE L ++F+ K    E W      +    NF  + L  ++   K H A EAD+ A++ RV+ +V +A EL    Y ++  + +R  N+   W+ L E  +  R
Sbjct:  150 LGLIWTIILRFQIQDISVETEDNKERRSAKDALLLWCQMKTAGYQNVNIHNFTTSWRDGLAFNAIVHKHRPDLIEFDKLKKSNAHHNLQNAFNIAEQKLGLTKLLDPED-ISVDQPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLESAIETDQMIDKYETLASELLEWIEQTIIILNNRKFANSLTGVQQQLQAFSTYRTVEKPNKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVNEINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAALRETWLSENQRLVTQDNF-GVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARR 524          

HSP 2 Score: 49.6766 bits (117), Expect = 3.030e-6
Identity = 87/362 (24.03%), Postives = 150/362 (41.44%), Query Frame = 2
Query:  263 DVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSY-EHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEF----RKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPP---YLPTEDHMINDIQGAWKEL-DKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIG--LCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPN 1315
            DV E+      +LDA        PDE +V A V     A     +     +R+ K  Q  QD   L   Y E  A +L  WI++K  +L         +    KLE+      ++ G E  P+   +     + N L  +L  +  P        +DH+ N +   ++EL D+ ++     L             ++ F+L+C+  +AW   K ++   ++ +++G  L  +  L +     E DL A Q ++  +   AE L ++  ++ D I  R   I   WD L ET  +NR   L           LQ ++ + +  F  WL +A+  +    + ++L E  KL++ HE  K  + N
Sbjct:  791 DVTEEISSYRPVLDALHEQAQGLPDEVTVSAGVPDRLEALEQRYRELVELSRVRK--QRLQDALALYKMYSEAEACEL--WIDEKSQWL-------NAMDVPEKLEDLEVIQHRFEGFE--PEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHL-NSVWSDFRELVDQKKEALSSALS------------IQNFHLECNETKAWIREKTKVI--ESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETL-QNREESLGEASK------LQ-QFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDN 1116          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 843.573 bits (2178), Expect = 0.000e+0
Identity = 414/786 (52.67%), Postives = 560/786 (71.25%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPY-------SPIS--------IKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI +E+  AK+GLLLWC+RKTAPYKNV+V+NF  S+KDGLAFCALIHRHRP+LIDY  L +++P+ NLN AFDVAE+YLDIP+MLD EDM+ T +PDER+VM YVSSYYHAF  +Q+A+TAA RI KVL +N+DNE +M  YE LASDLL+WINK +P+L +R TD TL   + KL+E R YR  EKPPK E KG+LET +NTLQT+LRLSNRP YLP+E  MINDI  AW  L+  EK FEDWL+ E++R+ERL++L +KF  KC+ HE+W + KD +    ++ D  L ++  L+K H AFE+DL AHQ RV++IVAIA+ELN L Y KID +N R QNI + W  LGE T      L +A +  + +D L+LE+AK+ +PF NWLE A EDL DM  + +++EI +L+  HE FK  +P A+ E   I+ +  +I +L        S  ENPY       SPI+        + D+ + W  +  LVP+RD  L++E  KQ R ++LR +FA  AN  GPW++++ + L T+    +  L+     L  +E  I +++  ++ELE +++ +Q  +I +N +T YTM+A+RVGWEQ LT++ + INEV+NQILTRD+KG++E QM EFR  FN FD+++T KL+ ++FK CLVSLG+ + +  K D +F R+  IVDPN TG VTF+AF+DF+T+E +D+D+ EQ+ +SF ILA D+PFIT + L +ELPP+QA+YCI RM P+ G ++ PGALDY  FS  LYGESDL
Sbjct:  119 TLGMIWTIILRFAIQDIAIEDSFAKDGLLLWCQRKTAPYKNVSVKNFTTSFKDGLAFCALIHRHRPDLIDYDSLRKEDPLYNLNKAFDVAEQYLDIPRMLDPEDMVETERPDERAVMTYVSSYYHAFTSSQQADTAAKRIGKVLNINRDNERMMEDYERLASDLLDWINKTMPWLTSRDTDGTLKDMQRKLDELRNYRKGEKPPKVEEKGQLETNFNTLQTKLRLSNRPAYLPSEGKMINDINDAWGGLEMAEKDFEDWLLMEMRRMERLDHLAEKFRHKCNIHESWTNGKDAVLSKDDYSDATLADINALMKKHEAFESDLAAHQDRVDQIVAIAQELNALEYSKIDEVNARCQNICDDWKDLGELTMHRLQKLEDAQQRLQSLDQLRLEFAKKAAPFNNWLESAREDLMDMFSVHTVEEIQELLDAHEAFKENMPAAQAEYNSIMDIAVQIESL--------SGQENPYTSLSKEASPITDMLFTFVFVCDINEGWNQVVDLVPKRDILLRDERSKQDRNERLRVEFANKANVVGPWIQQQGEKLRTIGFHMEGSLEKNLQVLQDLETFITSYKPNIEELEVINQEVQQALIFENPHTKYTMEAMRVGWEQLLTAIARNINEVENQILTRDSKGITEEQMKEFRASFNFFDKDQTGKLEPNEFKQCLVSLGYNIKEGDKGDREFERLLGIVDPNGTGKVTFQAFVDFMTRETADSDTAEQVMESFRILAGDKPFITAEELRRELPPDQAEYCIARMAPYEGKDAVPGALDYMSFSTALYGESDL 896          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 299.671 bits (766), Expect = 7.734e-86
Identity = 163/369 (44.17%), Postives = 229/369 (62.06%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVE-----EMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDIL 1093
            TLG+IWTIILR+ IQDIT+E     + SAK+ LLLWC+ KT  Y +V + NF  SW+DGLAF A+IHRHRP+LI++ KL++ +  +NL  AF+VAE  L I  +LDAED +N   PDE+S++ YV++YYH FA  +  E + +RI KV++  ++NE L+  YE LASDLLEWI  K+  L  R   NTLLG + ++ EF +YR  EKPP++  KG LE     L +++R +++ PY+P E   + DI  AW+ L+K+E   E  L  E+ R ERLE L  KF+ K    E W +    +    NF +  L  ++   K H A E D+ A++ RV  IVA+AEEL+   Y   + I      I   W++L
Sbjct:  116 TLGLIWTIILRFQIQDITIEGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAED-VNVDFPDEKSILTYVAAYYHYFAKMKTVEVSGSRIGKVIERIKENEELIIDYEKLASDLLEWIEIKIIQLGEREFANTLLGVQQQMLEFNQYRTQEKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPEGRGMIDINRAWERLEKSEHERELALREELMRQERLEMLAAKFDRKYAMRETWLNENQRLVAVDNFGN-DLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELL 482          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 256.144 bits (653), Expect = 1.533e-73
Identity = 144/371 (38.81%), Postives = 212/371 (57.14%), Query Frame = 2
Query:    5 LGMIWTIILRYAIQDITV------EEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIG--LCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDIL 1093
            LG+IW IILR+ I DI+       E  SAKE LLLWC+R T  Y  V++QNF  SW++GLAF AL+H+HRP+LIDY+ L       NLN AF VA + L I ++LDAED ++  +PD+RSVM YV++YY  FA  +  ET   RI K++ V  + E +  SYE + SDLL WI+ K+  L  R  +  +   + +L  F+ +R +EKPPKY  +  +E     LQT+ + +N+ P+ P E  ++ DI  AW+ ++  E      L  E+ R + LE + +KF  K D  E+W    D++ +  + + +G     ++  LK H A   D+ A + R + +  +A+EL    Y K D I  R   I  +WD L
Sbjct:  115 LGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAED-VDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITEL-ARPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAWQVMESAEHERAQALRNELIRQQMLEKMAEKFQRKADLRESWL---DDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKL 480          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 221.476 bits (563), Expect = 5.249e-65
Identity = 112/252 (44.44%), Postives = 159/252 (63.10%), Query Frame = 2
Query:    5 LGMIWTIILRYAIQDITV------EEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWK 742
            LG+IW IILR+ I DI+       E  SAKE LLLWC+R T  Y +V++QNF  SW++GLAF AL+H+HRP+LIDY+ L       NLN AF VAE+ L I ++LDAED ++  +PD+RSVM YV++YY  FA  +  ET   RI K++ V  + E +  SYE + SDLL WI+ K+  L  R  +  +   + +L  F+ +R +EKPPKY  +  +E     LQT+ + +N+ P+ P E  ++ DI  AW+
Sbjct:  117 LGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAED-VDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITEL-ARPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAWQ 366          
BLAST of Alpha-actinin vs. Ensembl Nematostella
Match: EDO28528 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T681])

HSP 1 Score: 195.282 bits (495), Expect = 3.204e-58
Identity = 90/159 (56.60%), Postives = 122/159 (76.73%), Query Frame = 2
Query: 1841 ILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFK-NDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            +LTRD+KG++E QM EFR  FN FD+++T KL+ ++FK CLVSLG+ + +  K  D +F R+  IVDPN TG VTF+AF+DF+T+E +D+D+ EQ+ +SF ILA D+PFIT + L +ELPP+QA+YCI RM P+ G ++ PGALDY  FS  LYGESDL
Sbjct:    1 MLTRDSKGITEEQMKEFRASFNFFDKDQTGKLEPNEFKQCLVSLGYNIKEGDKVGDREFERLLGIVDPNGTGKVTFQAFVDFMTRETADSDTAEQVMESFRILAGDKPFITAEELRRELPPDQAEYCIARMAPYEGKDAVPGALDYMSFSTALYGESDL 159          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: actn3b (actinin alpha 3 [Source:NCBI gene;Acc:101158802])

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 565/771 (73.28%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVNVQNFH+SWKDGLA CALIHRHRP+LIDYSKL +D+PI NLN AF+VAEK+LDIP+MLDAED++NT KPDE+++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NR  + T+   + KLE+FR YR + KPP+ + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AWK L++ EKG+E+WL+ EI+RLERL++L +KF  KC  HEAW   K+++   ++++   L E++ L++ H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K R AL    K  E ID L LE+AKR +PF NW++ A EDLQDM I+ S++EI  LI+ H+ FK TLP A+ E    L + + I  + +  G   S   NPY+ +S +D+ +KW  + +LVP RD  LQEEV +QQ  ++LR+QFA  AN  GPW++ + + ++ V       L+ Q   L + E+ I+ ++S +D+LE  H+  Q  +I DN +T Y+M+ +RVGWEQ LT++ + INEV+NQILTRD KG+S+ Q++EFR  FNHFDR R   +D  DF+ACL+S+G+ L      + +F RI  +VDPN+TG VTF+AFIDF+T+E ++ D+ EQ+  SF ILA+D+ +IT D L +ELPP QA+YCI RM  + GP++ PGALDY  FS+ LYGESDL
Sbjct:  134 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPRMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRVAEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFKQKCAMHEAWTSGKEDLLSQKDYESASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNARCQGICDQWDNLGTLTQKRRDALERVEKLWETIDQLYLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATLGIHNEILKIAQTYGIKLSGI-NPYTNLSPQDISNKWDTVKHLVPLRDQMLQEEVARQQANERLRRQFAAQANIIGPWIQTKMEEISHVSVDIAGSLEEQMNSLKQYEQNIINYKSNIDKLEGDHQLSQESLIFDNKHTNYSMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL-----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKNYITVDELRRELPPEQAEYCISRMTRYVGPDAPPGALDYISFSSALYGESDL 898          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: actn3b (actinin alpha 3 [Source:NCBI gene;Acc:101158802])

HSP 1 Score: 880.167 bits (2273), Expect = 0.000e+0
Identity = 422/771 (54.73%), Postives = 565/771 (73.28%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPY+NVNVQNFH+SWKDGLA CALIHRHRP+LIDYSKL +D+PI NLN AF+VAEK+LDIP+MLDAED++NT KPDE+++M YVS +YHAFAGA++AETAANRICKVL VNQ+NE LM  YE LAS+LLEWI + +P+L NR  + T+   + KLE+FR YR + KPP+ + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AWK L++ EKG+E+WL+ EI+RLERL++L +KF  KC  HEAW   K+++   ++++   L E++ L++ H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  T K R AL    K  E ID L LE+AKR +PF NW++ A EDLQDM I+ S++EI  LI+ H+ FK TLP A+ E    L + + I  + +  G   S   NPY+ +S +D+ +KW  + +LVP RD  LQEEV +QQ  ++LR+QFA  AN  GPW++ + + ++ V       L+ Q   L + E+ I+ ++S +D+LE  H+  Q  +I DN +T Y+M+ +RVGWEQ LT++ + INEV+NQILTRD KG+S+ Q++EFR  FNHFDR R   +D  DF+ACL+S+G+ L      + +F RI  +VDPN+TG VTF+AFIDF+T+E ++ D+ EQ+  SF ILA+D+ +IT D L +ELPP QA+YCI RM  + GP++ PGALDY  FS+ LYGESDL
Sbjct:  134 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFHISWKDGLALCALIHRHRPDLIDYSKLRKDDPIGNLNTAFEVAEKFLDIPRMLDAEDIVNTPKPDEKAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWIRRTIPWLENRVAEQTMRAMQQKLEDFRDYRRVHKPPRVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDIANAWKGLEQVEKGYEEWLLTEIRRLERLDHLAEKFKQKCAMHEAWTSGKEDLLSQKDYESASLMEIRALMRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAASVNARCQGICDQWDNLGTLTQKRRDALERVEKLWETIDQLYLEFAKRAAPFNNWMDGAMEDLQDMFIVHSIEEIQSLITAHDQFKATLPEADKERMATLGIHNEILKIAQTYGIKLSGI-NPYTNLSPQDISNKWDTVKHLVPLRDQMLQEEVARQQANERLRRQFAAQANIIGPWIQTKMEEISHVSVDIAGSLEEQMNSLKQYEQNIINYKSNIDKLEGDHQLSQESLIFDNKHTNYSMEHVRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLNEFRASFNHFDRKRNGMMDPDDFRACLISMGYDL-----GEVEFARIMTLVDPNNTGVVTFQAFIDFMTRETAETDTAEQVMASFKILASDKNYITVDELRRELPPEQAEYCISRMTRYVGPDAPPGALDYISFSSALYGESDL 898          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:101169077])

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 420/771 (54.47%), Postives = 563/771 (73.02%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY+KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L+  EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+E+ + ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  + K   AL    K  E ID L LE+AKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP A+ E + IL + + I  +++    + + + NPY+ I+ +++  KW  +  LVP RD +L EE  +QQ  ++LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L + E+ I+ ++ ++D+LE  H+ +Q+ +I DN +T YTM+ IRVGWEQ LT++ + INE++NQILTRD KG+S+ Q++EFR  FNHFDR+ +  L   +FKACL+SLGF +  D + +++F RI ++VDPN  G VTF+ FIDF+++E +D D+ +Q+  SF ILA D+ +I  D L +ELPP+QA+YCI RM P+ GP+  PGALDY  FS  LYGESDL
Sbjct:  121 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRMPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEEMLQRRDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRICDQWDALGALSQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDSFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGS-NPYTTINPQEVNAKWDKVRQLVPLRDQSLIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIEMHGTLEDQLTHLRQYEKSIINYKPKIDQLEGDHQLIQAALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQGENEFSRIMSVVDPNRMGVVTFQGFIDFMSRETADTDTADQVMASFKILAGDKNYILADELRRELPPDQAEYCIARMAPYSGPDGVPGALDYMSFSTALYGESDL 890          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: actn1 (actinin alpha 1 [Source:NCBI gene;Acc:101169077])

HSP 1 Score: 868.611 bits (2243), Expect = 0.000e+0
Identity = 422/793 (53.22%), Postives = 565/793 (71.25%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRL------------MKDFK----------NDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVN+QNFH+SWKDGL FCALIHRHRPELIDY+KL +D+P+ NLN AFDVAEKYLDIPKMLDAED++ T +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE LM  YE LASDLLEWI + +P+L NR  +NT+   + KLE+FR YR L KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L+  EKG+E+WL+ EI+RLERL++L +KF  K   HEAW   K+E+ + ++++   L E+K LLK H AFE+DL AHQ RVE+I AIA+ELN L Y    ++N R Q I +QWD LG  + K   AL    K  E ID L LE+AKR +PF NW+E A EDLQD  I+ +++EI  L + HE FK TLP A+ E + IL + + I  +++    + + + NPY+ I+ +++  KW  +  LVP RD +L EE  +QQ  ++LR+QFA  AN  GPW++ + + +  +  +    L+ Q   L + E+ I+ ++ ++D+LE  H+ +Q+ +I DN +T YTM+ IRVGWEQ LT++ + INE++NQILTRD KG+S+ Q++EFR  FNHFDR+ +  L   +FKACL+SLGF +             +DFK           +++F RI ++VDPN  G VTF+ FIDF+++E +D D+ +Q+  SF ILA D+ +I  D L +ELPP+QA+YCI RM P+ GP+  PGALDY  FS  LYGESDL
Sbjct:  121 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYAKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRMPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSDINNAWGGLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEEMLQRRDYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRICDQWDALGALSQKRSEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDSFIVHTIEEIQGLSTAHEQFKATLPEADKERQAILGIHNEIAKIVQTYHVNMAGS-NPYTTINPQEVNAKWDKVRQLVPLRDQSLIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIEMHGTLEDQLTHLRQYEKSIINYKPKIDQLEGDHQLIQAALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEIENQILTRDAKGISQEQLNEFRASFNHFDRDHSGTLGAEEFKACLISLGFDIGNDAQKRTGIMDAEDFKTCLISMGYNLGENEFSRIMSVVDPNRMGVVTFQGFIDFMSRETADTDTADQVMASFKILAGDKNYILADELRRELPPDQAEYCIARMAPYSGPDGVPGALDYMSFSTALYGESDL 912          
BLAST of Alpha-actinin vs. Ensembl Medaka
Match: ENSORLT00000001151.2 (alpha-actinin-4 [Source:NCBI gene;Acc:101155449])

HSP 1 Score: 863.218 bits (2229), Expect = 0.000e+0
Identity = 418/782 (53.45%), Postives = 559/782 (71.48%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDR-----------NRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI+VEE SAKEGLLLWC+RKTAPYKNVNVQNFH+SWKDGLAF ALIHRHRP+LIDY  L +D+P+ NLN AF+VAEK+LDIPKMLDAED++NT +PDE+++M YVSS+YHAF+GAQKAETAANRICKVL VNQ+NE +M  YE LAS+LLEWI + +P+L +RT   T+   +AK E+FR YR + KPPK + K +LE  +NTLQT+LRLSNRP ++P+E  M++DI  AW  L+  EKG+E+W+++EI+RLERLE+L +KF+ K   HE+W + K+ +   ++++   L E+K LL+ H AFE+DL AHQ RVE+I AIA+ELN L Y    ++NNR Q I +QWD LG  T   + +L    K  E ID L LEYAKR +PF NW+E A EDLQDM I+ +++EI  LI+ HE FK+TLP A  E + I  ++  +  + ++NG   S A NPY+ I+ + + DKW     +VPQRD ALQ E+ KQ   D LR  FA+ AN  G +++ + + +  +  +    L+ Q   L + ++ IL F   ++ LE  H+ +Q  +I DN YT YTM+ +RVGWEQ LT++ + INEV+NQILTRD KG+S+ Q+ E+R  FNHFD+           + T  L   +FKACL+SLG+ +  + + D++F RI +IVDPN++G VTF+AFIDF++ E +D DS +Q+  SF ILA D+ +I  D L +ELPP+QA+YCI RM P+ GP+  PGALDY  FS  LYGESDL
Sbjct:  129 TLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYESLRKDDPVTNLNNAFEVAEKHLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEQMMEDYEKLASNLLEWIRRTIPWLEDRTQQKTVNDMQAKQEDFRDYRTVHKPPKVQEKCQLEISFNTLQTKLRLSNRPAFMPSEGRMVSDINSAWHTLEGAEKGYEEWILSEIRRLERLEHLAEKFHQKAAIHESWTNGKEAMLTQKDYETSTLSEVKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSASVNNRCQKICDQWDTLGTLTHSRKDSLERTEKQLESIDELYLEYAKRAAPFNNWMEGAMEDLQDMFIVHNIEEIQGLIAAHEQFKSTLPEANKEREAIQAIQAEVQKIAQSNGIKLSGA-NPYTTITPRSIDDKWEQAMAMVPQRDKALQGELNKQNSNDTLRATFAKQANVVGGYIQAKMEEIGRISIEMNGTLEDQLTHLREYQQTILFFMPEINTLEGYHQHIQEALIFDNQYTSYTMEHLRVGWEQLLTTIARTINEVENQILTRDAKGISQEQLYEYRASFNHFDKSTSGAEKGGRCDHTGSLIAEEFKACLISLGYDVENEKQGDAEFTRIMSIVDPNNSGAVTFQAFIDFMSSETTDKDSADQVIASFKILAGDKNYIMADELRRELPPDQAEYCIARMAPYTGPDGVPGALDYMSFSTALYGESDL 909          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000040562.1 (SMESG000040562.1)

HSP 1 Score: 1568.13 bits (4059), Expect = 0.000e+0
Identity = 769/771 (99.74%), Postives = 770/771 (99.87%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTK+KLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRAALLEAIKAKEEIDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMD IRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL
Sbjct:  133 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKSKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRAALLEAIKAKEEIDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDTIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 903          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 836.254 bits (2159), Expect = 0.000e+0
Identity = 405/775 (52.26%), Postives = 563/775 (72.65%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWL----EKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI +E++SAKEGLLLWC+RKTAPYKNV V NFH S+KDGLAFCALIHRHRP+LIDY+ L +DN  ENLN AFDVAEK+LDIP+MLDAEDMI   KPDE SVMAYVSSYYHAF+GAQKAETA+NRICKVL VNQ+NE LMN YE L+++LL+WI K +P  ++R+   ++     KL+ FRKYR  EKPPK+E KG+LET YNTLQTRLRLSNRP ++P E   I DI   WK+L+ +EK FE+WL++E+QRLE+L+YLV++F+L+C+THE+W++ K E+ + +++ +  L EL+ L K   AFE+D   H+ RV RI  IAEEL  L Y  + +I+ R  +I   WD +G+  ++    +   ++  E ID+L L++AK++   YNW+EQA+EDLQD  ++  + E+  L+  H  FK +L +A  E  E++ +  +I +L E +    +  ENPY+ ++ ++L+D+W  +N LVP+R   L+EE+ +Q++ + LR ++A  AN+ GPWL    EK N + N V+  S   L+ Q+++L K+E+E++ FR + +EL+   + +   +I +N +T Y+M+ +RV WEQ L+S+RK  NE+DNQILTRD+KG+S  QM EFR+CFNHFD++ T+ L+ ++FKACLVSLG+ L +D K ++DF RI   VDPN+ G+VTF+AFIDF+T E +D DS +QM +SF +LA D+ +IT++ L +ELP  QA+YCI  M P+ GP       DY+ FSN LYG SDL
Sbjct:  121 TLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNLGKAV-ENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQAS---LEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKED-KGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 890          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 405/780 (51.92%), Postives = 562/780 (72.05%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWL----EKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDF-----KNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI +E++SAKEGLLLWC+RKTAPYKNV V NFH S+KDGLAFCALIHRHRP+LIDY+ L +DN  ENLN AFDVAEK+LDIP+MLDAEDMI   KPDE SVMAYVSSYYHAF+GAQKAETA+NRICKVL VNQ+NE LMN YE L+++LL+WI K +P  ++R+   ++     KL+ FRKYR  EKPPK+E KG+LET YNTLQTRLRLSNRP ++P E   I DI   WK+L+ +EK FE+WL++E+QRLE+L+YLV++F+L+C+THE+W++ K E+ + +++ +  L EL+ L K   AFE+D   H+ RV RI  IAEEL  L Y  + +I+ R  +I   WD +G+  ++    +   ++  E ID+L L++AK++   YNW+EQA+EDLQD  ++  + E+  L+  H  FK +L +A  E  E++ +  +I +L E +       ENPY+ ++ ++L+D+W  +N LVP+R   L+EE+ +Q++ + LR ++A  AN+ GPWL    EK N + N V+  S   L+ Q+++L K+E+E++ FR + +EL+   + +   +I +N +T Y+M+ +RV WEQ L+S+RK  NE+DNQILTRD+KG+S  QM EFR+CFNHFD++ T+ L+ ++FKACLVSLG+ L +D      K ++DF RI   VDPN+ G+VTF+AFIDF+T E +D DS +QM +SF +LA D+ +IT++ L +ELP  QA+YCI  M P+ GP       DY+ FSN LYG SDL
Sbjct:  121 TLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNL-GKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQAS---LEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 896          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 405/784 (51.66%), Postives = 562/784 (71.68%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWL----EKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKN---------DSDFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI +E++SAKEGLLLWC+RKTAPYKNV V NFH S+KDGLAFCALIHRHRP+LIDY+ L +DN  ENLN AFDVAEK+LDIP+MLDAEDMI   KPDE SVMAYVSSYYHAF+GAQKAETA+NRICKVL VNQ+NE LMN YE L+++LL+WI K +P  ++R+   ++     KL+ FRKYR  EKPPK+E KG+LET YNTLQTRLRLSNRP ++P E   I DI   WK+L+ +EK FE+WL++E+QRLE+L+YLV++F+L+C+THE+W++ K E+ + +++ +  L EL+ L K   AFE+D   H+ RV RI  IAEEL  L Y  + +I+ R  +I   WD +G+  ++    +   ++  E ID+L L++AK++   YNW+EQA+EDLQD  ++  + E+  L+  H  FK +L +A  E  E++ +  +I +L E +       ENPY+ ++ ++L+D+W  +N LVP+R   L+EE+ +Q++ + LR ++A  AN+ GPWL    EK N + N V+  S   L+ Q+++L K+E+E++ FR + +EL+   + +   +I +N +T Y+M+ +RV WEQ L+S+RK  NE+DNQILTRD+KG+S  QM EFR+CFNHFD++ T+ L+ ++FKACLVSLG+ L +D  N         ++DF RI   VDPN+ G+VTF+AFIDF+T E +D DS +QM +SF +LA D+ +IT++ L +ELP  QA+YCI  M P+ GP       DY+ FSN LYG SDL
Sbjct:  121 TLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNL-GKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQAS---LEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 900          
BLAST of Alpha-actinin vs. Planmine SMEST
Match: SMESG000026000.1 (SMESG000026000.1)

HSP 1 Score: 827.78 bits (2137), Expect = 0.000e+0
Identity = 405/790 (51.27%), Postives = 561/790 (71.01%), Query Frame = 2
Query:    2 TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMSWKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKMLDAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDNENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGLEKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELDKNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNFKDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTINNRTQNIANQWDILGETTSKNRXXXXXXXXXXXXXDTLQLEYAKRISPFYNWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLRDRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEEVMKQQRIDQLRQQFAQYANQAGPWL----EKENDILNTVLAQSKLHLDAQRAKLTKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNLTSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDFKACLVSLGFRLMKDFKNDS---------------DFRRIANIVDPNHTGFVTFEAFIDFVTKENSDNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPNSQPGALDYRLFSNRLYGESDL 2314
            TLGMIWTIILR+AIQDI +E++SAKEGLLLWC+RKTAPYKNV V NFH S+KDGLAFCALIHRHRP+LIDY+ L +DN  ENLN AFDVAEK+LDIP+MLDAEDMI   KPDE SVMAYVSSYYHAF+GAQKAETA+NRICKVL VNQ+NE LMN YE L+++LL+WI K +P  ++R+   ++     KL+ FRKYR  EKPPK+E KG+LET YNTLQTRLRLSNRP ++P E   I DI   WK+L+ +EK FE+WL++E+QRLE+L+YLV++F+L+C+THE+W++ K E+ + +++ +  L EL+ L K   AFE+D   H+ RV RI  IAEEL  L Y  + +I+ R  +I   WD +G+  ++    +   ++  E ID+L L++AK++   YNW+EQA+EDLQD  ++  + E+  L+  H  FK +L +A  E  E++ +  +I +L E +       ENPY+ ++ ++L+D+W  +N LVP+R   L+EE+ +Q++ + LR ++A  AN+ GPWL    EK N + N V+  S   L+ Q+++L K+E+E++ FR + +EL+   + +   +I +N +T Y+M+ +RV WEQ L+S+RK  NE+DNQILTRD+KG+S  QM EFR+CFNHFD++ T+ L+ ++FKACLVSLG+ L +D  + S               DF RI   VDPN+ G+VTF+AFIDF+T E +D DS +QM +SF +LA D+ +IT++ L +ELP  QA+YCI  M P+ GP       DY+ FSN LYG SDL
Sbjct:  121 TLGMIWTIILRFAIQDIKMEDLSAKEGLLLWCQRKTAPYKNVKVSNFHTSFKDGLAFCALIHRHRPDLIDYNNLHKDNARENLNLAFDVAEKHLDIPRMLDAEDMIKFAKPDELSVMAYVSSYYHAFSGAQKAETASNRICKVLGVNQENEKLMNEYETLSTNLLKWIEKMIPIFQDRSESTSVENMHNKLDNFRKYRITEKPPKHEEKGQLETAYNTLQTRLRLSNRPNFIPPESKTIGDINHRWKDLENSEKDFEEWLMSELQRLEQLDYLVRRFHLRCNTHESWSNGKIEMLQSEDYLNANLPELRALYKRLQAFESDFSGHEPRVVRINVIAEELRKLEYHDMKSIDARLNSIVETWDYMGKLDAERNENIKNILQLLENIDSLHLDFAKKVPNIYNWIEQAKEDLQDSFMVHYIDEVKALLDQHYQFKESLKDATSEYDELIAISKKIKSLAEEHNL-GKAVENPYTMVTSQNLRDEWEELNSLVPKRGKELKEELTRQEQHENLRLKYANLANKVGPWLDARQEKLNSLSNNVIQAS---LEEQKSELYKLEQEVMDFRPKAEELDQCSQELHKYLIFENRHTQYSMEIVRVSWEQLLSSIRKTRNEIDNQILTRDSKGLSSEQMEEFRRCFNHFDKDHTKMLEPNEFKACLVSLGYNLKEDKDSHSDKDNQHGRRASVGEADFSRIMLQVDPNNDGYVTFDAFIDFMTHETADEDSSDQMLRSFKVLAGDKDYITEEELRRELPKEQAEYCIANMLPYTGPGGDVCGYDYQSFSNSLYGLSDL 906          
The following BLAST results are available for this feature:
BLAST of Alpha-actinin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTN10.000e+055.25actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163][more]
ACTN10.000e+055.12actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163][more]
ACTN10.000e+055.12actinin alpha 1 [Source:HGNC Symbol;Acc:HGNC:163][more]
ACTN40.000e+054.73actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166][more]
ACTN40.000e+054.73actinin alpha 4 [Source:HGNC Symbol;Acc:HGNC:166][more]
back to top
BLAST of Alpha-actinin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atn-10.000e+053.26AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-10.000e+053.26AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-10.000e+050.94AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
atn-10.000e+050.94AcTiniN [Source:UniProtKB/TrEMBL;Acc:Q9XVU8][more]
unc-701.102e-9245.68Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actn0.000e+057.46gene:FBgn0000667 transcript:FBtr0333801[more]
Actn0.000e+057.46gene:FBgn0000667 transcript:FBtr0070343[more]
Actn0.000e+057.46gene:FBgn0000667 transcript:FBtr0303048[more]
Actn0.000e+057.46gene:FBgn0000667 transcript:FBtr0070344[more]
Actn0.000e+057.31gene:FBgn0000667 transcript:FBtr0310657[more]
back to top
BLAST of Alpha-actinin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn10.000e+055.25actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-... [more]
actn10.000e+055.25actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-... [more]
actn10.000e+055.25actinin, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-081113-... [more]
actn40.000e+054.73actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
actn40.000e+054.47actinin, alpha 4 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn10.000e+054.86actinin alpha 1 [Source:NCBI gene;Acc:780123][more]
actn10.000e+054.60actinin alpha 1 [Source:NCBI gene;Acc:780123][more]
gss0.000e+054.86glutathione synthetase [Source:Xenbase;Acc:XB-GENE... [more]
gss0.000e+054.86glutathione synthetase [Source:Xenbase;Acc:XB-GENE... [more]
gss0.000e+054.86glutathione synthetase [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actn20.000e+054.73actinin alpha 2 [Source:MGI Symbol;Acc:MGI:109192][more]
Actn20.000e+054.73actinin alpha 2 [Source:MGI Symbol;Acc:MGI:109192][more]
Actn40.000e+054.86actinin alpha 4 [Source:MGI Symbol;Acc:MGI:1890773... [more]
Actn10.000e+054.86actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:213770... [more]
Actn10.000e+054.73actinin, alpha 1 [Source:MGI Symbol;Acc:MGI:213770... [more]
back to top
BLAST of Alpha-actinin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|L7UZ85|ACTN_DERFA0.000e+057.20Alpha-actinin OS=Dermatophagoides farinae OX=6954 ... [more]
sp|Q7PKQ5|ACTN_ANOGA0.000e+055.78Alpha-actinin, sarcomeric OS=Anopheles gambiae OX=... [more]
sp|P18091|ACTN_DROME0.000e+055.63Alpha-actinin, sarcomeric OS=Drosophila melanogast... [more]
sp|P20111|ACTN2_CHICK0.000e+054.47Alpha-actinin-2 OS=Gallus gallus OX=9031 GN=ACTN2 ... [more]
sp|Q9JI91|ACTN2_MOUSE0.000e+054.73Alpha-actinin-2 OS=Mus musculus OX=10090 GN=Actn2 ... [more]
back to top
BLAST of Alpha-actinin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1RH580.000e+060.18Alpha-actinin, sarcomeric OS=Crassostrea gigas OX=... [more]
A0A1S3HKE40.000e+060.44alpha-actinin isoform X3 OS=Lingula unguis OX=7574... [more]
R7VCM40.000e+059.66Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A0B7B7H50.000e+059.40Uncharacterized protein OS=Arion vulgaris OX=10286... [more]
A0A1S3HNG40.000e+060.05alpha-actinin, sarcomeric isoform X4 OS=Lingula un... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn10.000e+054.73actinin alpha 1 [Source:NCBI gene;Acc:103031817][more]
actn3a0.000e+054.86actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
actn3a0.000e+054.86actinin alpha 3a [Source:ZFIN;Acc:ZDB-GENE-000329-... [more]
actn10.000e+054.47actinin alpha 1 [Source:NCBI gene;Acc:103031817][more]
actn40.000e+054.40actinin alpha 4 [Source:NCBI gene;Acc:103022122][more]
back to top
BLAST of Alpha-actinin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009295.10.000e+054.35pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 ge... [more]
ENSPMAT00000000684.13.865e-17357.76pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 ... [more]
ENSPMAT00000001834.11.913e-8740.32pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1... [more]
ENSPMAT00000004049.13.538e-8741.53pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1... [more]
ENSPMAT00000008111.15.148e-8640.85pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 ge... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Alpha-actinin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
ALPHA-ACTININ0.000e+052.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424317.734e-8644.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495761.533e-7338.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291015.249e-6544.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO285283.204e-5856.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-actinin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actn3b0.000e+054.73actinin alpha 3 [Source:NCBI gene;Acc:101158802][more]
actn3b0.000e+054.73actinin alpha 3 [Source:NCBI gene;Acc:101158802][more]
actn10.000e+054.47actinin alpha 1 [Source:NCBI gene;Acc:101169077][more]
actn10.000e+053.22actinin alpha 1 [Source:NCBI gene;Acc:101169077][more]
ENSORLT00000001151.20.000e+053.45alpha-actinin-4 [Source:NCBI gene;Acc:101155449][more]
back to top
BLAST of Alpha-actinin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040562.10.000e+099.74SMESG000040562.1[more]
SMESG000026000.10.000e+052.26SMESG000026000.1[more]
SMESG000026000.10.000e+051.92SMESG000026000.1[more]
SMESG000026000.10.000e+051.66SMESG000026000.1[more]
SMESG000026000.10.000e+051.27SMESG000026000.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026466 ID=SMED30026466|Name=Alpha-actinin|organism=Schmidtea mediterranea sexual|type=transcript|length=2494bp
GACTCTTGGAATGATTTGGACAATAATTTTACGATATGCTATTCAAGACA
TTACAGTTGAAGAAATGTCAGCAAAAGAAGGACTCTTGTTGTGGTGCAAA
AGAAAAACGGCACCCTATAAAAATGTCAATGTTCAAAATTTTCATATGAG
CTGGAAAGATGGCCTGGCATTTTGTGCATTAATCCATCGGCACAGACCTG
AACTGATAGACTATTCGAAACTGTCTCGGGATAATCCCATTGAAAATCTG
AATTACGCATTTGACGTGGCAGAAAAATATCTTGATATTCCAAAAATGCT
TGATGCTGAAGATATGATAAACACTATAAAACCAGACGAAAGATCTGTTA
TGGCCTACGTATCTTCTTATTACCACGCTTTCGCCGGAGCACAGAAGGCC
GAGACAGCGGCTAATCGCATTTGCAAGGTTCTTCAAGTAAATCAAGATAA
CGAAAATTTAATGAATTCCTACGAGCATTTGGCATCTGATTTGTTAGAGT
GGATAAATAAAAAACTACCATTCTTACGAAATAGAACAACTGATAACACT
TTACTCGGGACAAAGGCAAAATTAGAAGAATTTCGTAAATATAGAGGATT
AGAAAAGCCTCCTAAATATGAAATGAAAGGTGAATTAGAAACAATTTATA
ATACTCTTCAAACACGACTCCGGTTGAGCAATAGGCCACCTTATTTGCCA
ACAGAAGATCATATGATTAACGATATCCAAGGAGCATGGAAAGAATTAGA
TAAAAATGAAAAAGGATTTGAGGATTGGTTGGTGGCAGAAATTCAAAGAT
TGGAAAGATTAGAATATCTTGTCAAAAAATTCAATTTAAAATGTGACACT
CATGAAGCATGGGCTCACAATAAAGATGAAATATGCAAATATCAAAATTT
CAAAGATATTGGATTATGTGAATTGAAAAATCTTTTAAAATTACATGTTG
CTTTTGAAGCTGACTTAGGCGCCCATCAGGGAAGAGTTGAAAGAATCGTG
GCTATTGCTGAAGAACTGAACACACTTGGGTACGATAAAATAGATACGAT
TAATAATCGCACTCAAAACATAGCAAACCAATGGGATATCTTGGGAGAAA
CTACTTCCAAAAATCGTGCAGCCCTATTGGAGGCAATAAAGGCCAAGGAG
GAAATAGATACGTTACAGTTAGAATATGCTAAAAGAATTTCTCCATTTTA
CAATTGGTTAGAACAAGCAGAAGAAGATCTACAAGACATGCTTATTATTA
GCAGTCTGCAGGAAATTAATAAATTAATTTCTGGCCATGAAACTTTCAAA
ACGACATTGCCAAATGCTGAGATTGAGCTTAAAGAGATATTGCAATTAAG
AGATCGTATACATGCGCTTATTGAGAATAATGGCTTTTCGGCGTCTACTG
CTGAGAATCCTTATTCGCCTATTTCTATAAAGGATCTAAAAGATAAATGG
CTCGCAATGAATTATTTAGTGCCACAAAGAGATTCAGCACTGCAAGAGGA
GGTGATGAAGCAGCAAAGGATTGATCAGTTGAGGCAACAATTTGCTCAAT
ATGCTAACCAGGCTGGTCCTTGGCTTGAAAAGGAAAATGATATACTTAAC
ACAGTCTTGGCGCAGTCTAAATTGCATTTAGATGCCCAAAGAGCAAAACT
GACTAAAATTGAAGAAGAAATTTTGGCTTTTAGATCACGGGTCGATGAAC
TTGAAAACCTTCACAAAGCAATGCAAAGTATGGTGATTCTGGACAATAGT
TATACACCATATACAATGGATGCGATTAGAGTTGGGTGGGAACAAAACTT
GACCTCTGTTAGGAAAGCTATTAACGAAGTTGATAATCAAATTCTCACTC
GTGATACAAAAGGTGTCAGTGAAGCTCAGATGTCCGAATTCAGAAAGTGT
TTCAATCATTTCGATCGTAATCGCACTAGGAAATTAGATTTATCCGACTT
TAAAGCTTGTTTGGTTTCTCTTGGTTTTCGATTAATGAAAGATTTCAAAA
ACGATTCCGACTTTCGTAGAATTGCAAATATCGTCGATCCTAATCATACG
GGCTTCGTGACTTTTGAAGCATTTATCGATTTCGTAACAAAGGAAAATTC
GGACAATGATTCGGTTGAACAAATGACAAAGTCTTTCAGTATTTTAGCTA
ATGACCAACCTTTTATAACGAAAGATATATTACTACAAGAGTTGCCTCCG
AATCAAGCCCAATATTGCATTGAAAGAATGCCCCCTTTTCGGGGCCCTAA
TTCGCAGCCAGGCGCATTAGATTATCGTCTTTTTTCTAATAGACTTTATG
GTGAATCGGATTTGTGAATCTCTGAACATCTAGTAATATTTATGAAATTT
TTAATCTAGAAATAATTATTTTCCTGGTAACGTCAAAGTTTTACCATTAA
CCCCATACAATTAGTTTTGTAGTGGACGCTGTATTAGTGTCACCCGACAT
GGATATGAAATTGCAAATAAATTATACTTTTTCGTTCAAAAACA
back to top

protein sequence of SMED30026466-orf-1

>SMED30026466-orf-1 ID=SMED30026466-orf-1|Name=SMED30026466-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=772bp
TLGMIWTIILRYAIQDITVEEMSAKEGLLLWCKRKTAPYKNVNVQNFHMS
WKDGLAFCALIHRHRPELIDYSKLSRDNPIENLNYAFDVAEKYLDIPKML
DAEDMINTIKPDERSVMAYVSSYYHAFAGAQKAETAANRICKVLQVNQDN
ENLMNSYEHLASDLLEWINKKLPFLRNRTTDNTLLGTKAKLEEFRKYRGL
EKPPKYEMKGELETIYNTLQTRLRLSNRPPYLPTEDHMINDIQGAWKELD
KNEKGFEDWLVAEIQRLERLEYLVKKFNLKCDTHEAWAHNKDEICKYQNF
KDIGLCELKNLLKLHVAFEADLGAHQGRVERIVAIAEELNTLGYDKIDTI
NNRTQNIANQWDILGETTSKNRAALLEAIKAKEEIDTLQLEYAKRISPFY
NWLEQAEEDLQDMLIISSLQEINKLISGHETFKTTLPNAEIELKEILQLR
DRIHALIENNGFSASTAENPYSPISIKDLKDKWLAMNYLVPQRDSALQEE
VMKQQRIDQLRQQFAQYANQAGPWLEKENDILNTVLAQSKLHLDAQRAKL
TKIEEEILAFRSRVDELENLHKAMQSMVILDNSYTPYTMDAIRVGWEQNL
TSVRKAINEVDNQILTRDTKGVSEAQMSEFRKCFNHFDRNRTRKLDLSDF
KACLVSLGFRLMKDFKNDSDFRRIANIVDPNHTGFVTFEAFIDFVTKENS
DNDSVEQMTKSFSILANDQPFITKDILLQELPPNQAQYCIERMPPFRGPN
SQPGALDYRLFSNRLYGESDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0019863IgE binding
GO:0005515protein binding
GO:0005509calcium ion binding
GO:0003779actin binding
GO:0005546phosphatidylinositol-4,5-bisphosphate binding
GO:0008092cytoskeletal protein binding
GO:0019904protein domain specific binding
GO:0030274LIM domain binding
GO:0030374ligand-dependent nuclear receptor transcription coactivator activity
GO:0030375thyroid hormone receptor coactivator activity
GO:0030674protein binding, bridging
GO:0031432titin binding
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
GO:0044325ion channel binding
GO:0046872metal ion binding
GO:0046983protein dimerization activity
GO:0051015actin filament binding
GO:0051373FATZ binding
GO:0070080titin Z domain binding
Vocabulary: biological process
TermDefinition
GO:0051017actin filament bundle assembly
GO:0006936muscle contraction
GO:0030035microspike assembly
GO:0042391regulation of membrane potential
GO:0043267negative regulation of potassium ion transport
GO:0043268positive regulation of potassium ion transport
GO:0045214sarcomere organization
GO:0048041focal adhesion assembly
GO:0051289protein homotetramerization
GO:0051695actin filament uncapping
GO:0055013cardiac muscle cell development
GO:0086097phospholipase C-activating angiotensin-activated signaling pathway
GO:0090002establishment of protein localization to plasma membrane
GO:1901017negative regulation of potassium ion transmembrane transporter activity
GO:1901018positive regulation of potassium ion transmembrane transporter activity
GO:1903506regulation of nucleic acid-templated transcription
GO:2000009negative regulation of protein localization to cell surface
GO:2000273positive regulation of signaling receptor activity
GO:2001137positive regulation of endocytic recycling
GO:2001259positive regulation of cation channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR001715CH-domain
IPR002048EF_hand_dom
IPR018159Spectrin/alpha-actinin
IPR011992EF-hand-dom_pair
IPR002017Spectrin_repeat
IPR014837EF-hand_Ca_insen
IPR018247EF_Hand_1_Ca_BS
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005865striated muscle thin filament
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0030017sarcomere
GO:0030018Z disc
GO:0030175filopodium
GO:0030864cortical actin cytoskeleton
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 371..391
NoneNo IPR availableCOILSCoilCoilcoord: 536..570
NoneNo IPR availableCOILSCoilCoilcoord: 493..513
NoneNo IPR availableSMARTSM01184efhand_Ca_insen_2coord: 701..767
e-value: 5.6E-24
score: 95.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 506..618
e-value: 1.3E-33
score: 117.6
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 269..379
e-value: 3.0E-22
score: 80.9
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 380..505
e-value: 1.1E-36
score: 127.7
NoneNo IPR availableGENE3DG3DSA:1.20.58.60coord: 143..268
e-value: 2.2E-45
score: 155.5
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 703..771
e-value: 3.1E-23
score: 83.7
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 619..702
e-value: 4.2E-14
score: 54.4
NoneNo IPR availablePANTHERPTHR11915:SF425ALPHA-ACTININ-4coord: 1..770
NoneNo IPR availablePANTHERPTHR11915SPECTRIN/FILAMIN RELATED CYTOSKELETAL PROTEINcoord: 1..770
NoneNo IPR availableCDDcd00176SPECcoord: 157..379
e-value: 7.28383E-11
score: 60.5372
NoneNo IPR availableCDDcd00176SPECcoord: 276..501
e-value: 7.27021E-21
score: 89.8123
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 145..267
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 215..375
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 382..502
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 506..618
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 24..123
e-value: 1.6E-26
score: 104.1
IPR001715Calponin homology domainPFAMPF00307CHcoord: 23..128
e-value: 2.1E-28
score: 98.7
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 22..128
score: 26.837
IPR001715Calponin homology domainCDDcd00014CHcoord: 23..128
e-value: 7.95792E-27
score: 103.159
IPR002048EF-hand domainSMARTSM00054efh_1coord: 670..698
e-value: 0.36
score: 19.9
coord: 629..657
e-value: 0.0032
score: 26.7
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 625..660
score: 12.226
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 666..701
score: 9.911
IPR002048EF-hand domainCDDcd00051EFhcoord: 629..696
e-value: 1.2556E-8
score: 49.8537
IPR018159Spectrin/alpha-actininSMARTSM00150SPEC_4coord: 275..376
e-value: 1.1E-12
score: 58.1
coord: 390..498
e-value: 0.54
score: 13.3
coord: 512..615
e-value: 2.1
score: 6.7
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 18..137
e-value: 1.6E-51
score: 175.0
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 1..127
IPR014837EF-hand, Ca insensitivePFAMPF08726EFhand_Ca_insencoord: 701..767
e-value: 6.3E-19
score: 67.8
IPR002017Spectrin repeatPFAMPF00435Spectrincoord: 510..598
e-value: 7.4E-7
score: 29.6
coord: 273..377
e-value: 8.6E-14
score: 51.9
coord: 153..260
e-value: 2.1E-8
score: 34.6
coord: 389..499
e-value: 4.3E-10
score: 40.0
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 638..650
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 618..765