Regulator of G-protein signaling

Overview
NameRegulator of G-protein signaling
Smed IDSMED30026464
Length (bp)1354
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Regulator of G-protein signaling (SMED30026464) t-SNE clustered cells

Violin plots show distribution of expression levels for Regulator of G-protein signaling (SMED30026464) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Regulator of G-protein signaling (SMED30026464) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Regulator of G-protein signaling (SMED30026464) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026464

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30026464SMESG000027589.1 SmedASXL_012810SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30026464SMESG000027589.1 SmedASXL_012811SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30026464SMESG000027589.1 dd_Smed_v4_8787_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30026464SMESG000027589.1 dd_Smed_v6_8787_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026464SMESG000027589.1 dd_Smed_v4_8787_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 151.754 bits (382), Expect = 1.955e-43
Identity = 68/124 (54.84%), Postives = 96/124 (77.42%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P +++  +W  SLE LL  +YGLA+F AFL+TE+S+ENLEFW+ACE +K +  Q K+  +A+KI+++++++QA +EVNLDS TR  T  +L + ++  FD AQKRIF LMEKDSYPRFLRSD+Y
Sbjct:   32 PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLY 155          
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 152.14 bits (383), Expect = 3.261e-43
Identity = 68/124 (54.84%), Postives = 96/124 (77.42%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P +++  +W  SLE LL  +YGLA+F AFL+TE+S+ENLEFW+ACE +K +  Q K+  +A+KI+++++++QA +EVNLDS TR  T  +L + ++  FD AQKRIF LMEKDSYPRFLRSD+Y
Sbjct:   56 PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLY 179          
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 150.984 bits (380), Expect = 1.891e-41
Identity = 68/124 (54.84%), Postives = 96/124 (77.42%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P +++  +W  SLE LL  +YGLA+F AFL+TE+S+ENLEFW+ACE +K +  Q K+  +A+KI+++++++QA +EVNLDS TR  T  +L + ++  FD AQKRIF LMEKDSYPRFLRSD+Y
Sbjct:  175 PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLY 298          
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 150.984 bits (380), Expect = 1.891e-41
Identity = 68/124 (54.84%), Postives = 96/124 (77.42%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P +++  +W  SLE LL  +YGLA+F AFL+TE+S+ENLEFW+ACE +K +  Q K+  +A+KI+++++++QA +EVNLDS TR  T  +L + ++  FD AQKRIF LMEKDSYPRFLRSD+Y
Sbjct:  175 PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLY 298          
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Match: RGS3 (regulator of G protein signaling 3 [Source:HGNC Symbol;Acc:HGNC:9999])

HSP 1 Score: 153.295 bits (386), Expect = 1.721e-40
Identity = 68/124 (54.84%), Postives = 96/124 (77.42%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P +++  +W  SLE LL  +YGLA+F AFL+TE+S+ENLEFW+ACE +K +  Q K+  +A+KI+++++++QA +EVNLDS TR  T  +L + ++  FD AQKRIF LMEKDSYPRFLRSD+Y
Sbjct:  383 PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLY 506          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 120.553 bits (301), Expect = 3.348e-32
Identity = 57/127 (44.88%), Postives = 82/127 (64.57%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIV 1214
            P  + +  W  S E+L+  R G   F  FLK EYSDEN+ FW ACE  K     +K+ ++A+ IY   +S+ +P+EV+LDS+ R    +++G PS  TFD AQ +I+ LM++DSYPRFL S+IY+ V
Sbjct:   25 PTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTV 151          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 120.553 bits (301), Expect = 4.502e-32
Identity = 57/127 (44.88%), Postives = 82/127 (64.57%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIV 1214
            P  + +  W  S E+L+  R G   F  FLK EYSDEN+ FW ACE  K     +K+ ++A+ IY   +S+ +P+EV+LDS+ R    +++G PS  TFD AQ +I+ LM++DSYPRFL S+IY+ V
Sbjct:   30 PTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTV 156          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 120.553 bits (301), Expect = 5.427e-32
Identity = 57/127 (44.88%), Postives = 82/127 (64.57%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIV 1214
            P  + +  W  S E+L+  R G   F  FLK EYSDEN+ FW ACE  K     +K+ ++A+ IY   +S+ +P+EV+LDS+ R    +++G PS  TFD AQ +I+ LM++DSYPRFL S+IY+ V
Sbjct:   44 PTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTV 170          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-2 (Regulator of G-protein signaling rgs-2 [Source:UniProtKB/Swiss-Prot;Acc:P49808])

HSP 1 Score: 120.168 bits (300), Expect = 6.549e-32
Identity = 57/127 (44.88%), Postives = 82/127 (64.57%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIV 1214
            P  + +  W  S E+L+  R G   F  FLK EYSDEN+ FW ACE  K     +K+ ++A+ IY   +S+ +P+EV+LDS+ R    +++G PS  TFD AQ +I+ LM++DSYPRFL S+IY+ V
Sbjct:   32 PTYEIVFGWSQSFENLMKHRAGQKYFAEFLKGEYSDENILFWQACEELKREKNAEKIEEKARIIYEDFISILSPKEVSLDSRVREIVNTNMGRPSASTFDEAQNQIYTLMQRDSYPRFLASNIYKTV 158          
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Match: rgs-1 (Regulator of G-protein signaling rgs-1 [Source:UniProtKB/Swiss-Prot;Acc:P34295])

HSP 1 Score: 108.227 bits (269), Expect = 3.117e-27
Identity = 53/130 (40.77%), Postives = 83/130 (63.85%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMG 1232
            + +  W+ S + L++ + G   F  FLK+EYSDEN+ FW ACE  K     +K+ ++A+ IY   +S+ +P+EV+LDSK R    +++  P++ TF+ AQ +I+ LM +DSYPRFL S    I YRE++ 
Sbjct:   33 EMVYSWQQSFDTLMSFKSGQKCFAEFLKSEYSDENILFWQACEELKREKNSEKMEEKARIIYEDFISILSPKEVSLDSKVREIVNTNMSRPTQNTFEDAQHQIYQLMARDSYPRFLTS----IFYRETLA 158          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0340279)

HSP 1 Score: 106.686 bits (265), Expect = 7.953e-26
Identity = 48/127 (37.80%), Postives = 81/127 (63.78%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIV 1214
            P  ++I+ W  S + L+    G  +F  FL++E+S+EN+ FW+ACE  K  +  + + ++A+ IY  ++S+ +PREV+LDS+ R     ++  P+  TFD AQ +I+ LM +DSYPRFL S  ++ +
Sbjct:  128 PTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 254          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: Dhit (gene:FBgn0028743 transcript:FBtr0301142)

HSP 1 Score: 106.686 bits (265), Expect = 8.707e-26
Identity = 48/127 (37.80%), Postives = 81/127 (63.78%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIV 1214
            P  ++I+ W  S + L+    G  +F  FL++E+S+EN+ FW+ACE  K  +  + + ++A+ IY  ++S+ +PREV+LDS+ R     ++  P+  TFD AQ +I+ LM +DSYPRFL S  ++ +
Sbjct:  131 PTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTL 257          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: CG42450 (gene:FBgn0259927 transcript:FBtr0300218)

HSP 1 Score: 106.686 bits (265), Expect = 3.748e-24
Identity = 51/126 (40.48%), Postives = 77/126 (61.11%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFA-LMEKDSYPRFLRSDIYQ 1208
            P   ++KRW  S+E L++D  GL  F  FL+ EYS EN+ FW+A    +  S   ++ ++  +IY + L   AP E+N+D KT    +  L  PS+ TFDSA + I+  L++KD YPRF+RS+ Y+
Sbjct:  490 PTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRR-SAHSQVARKVNEIYEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYK 614          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: CG42450 (gene:FBgn0259927 transcript:FBtr0310343)

HSP 1 Score: 106.686 bits (265), Expect = 4.108e-24
Identity = 51/126 (40.48%), Postives = 77/126 (61.11%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFA-LMEKDSYPRFLRSDIYQ 1208
            P   ++KRW  S+E L++D  GL  F  FL+ EYS EN+ FW+A    +  S   ++ ++  +IY + L   AP E+N+D KT    +  L  PS+ TFDSA + I+  L++KD YPRF+RS+ Y+
Sbjct:  490 PTEKRVKRWAISIEELVSDPTGLQEFTGFLEKEYSHENIRFWIAVNRLRR-SAHSQVARKVNEIYEEFLKPGAPCEINIDGKTMESVLKGLKNPSRFTFDSASEHIYMLLLKKDCYPRFIRSEHYK 614          
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Match: loco (gene:FBgn0020278 transcript:FBtr0084275)

HSP 1 Score: 102.449 bits (254), Expect = 9.887e-23
Identity = 49/117 (41.88%), Postives = 73/117 (62.39%), Query Frame = 3
Query:  858 WEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            W  S E +L D  G+  F+ FLK E+S EN+ FW ACE Y+ L  +     +A++I+++HL+  +   VN+DS+ R  T   L   +   F  AQK+IF+LM+ DSY RF+RSD+Y+
Sbjct:  458 WAGSFERMLQDAAGMQTFSEFLKKEFSAENIYFWTACERYRLLESEADRVAQAREIFAKHLANNSSDPVNVDSQARSLTEEKLADAAPDIFAPAQKQIFSLMKFDSYQRFIRSDLYK 574          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: rgs8 (regulator of G protein signaling 8 [Source:NCBI gene;Acc:436804])

HSP 1 Score: 145.976 bits (367), Expect = 2.507e-41
Identity = 65/138 (47.10%), Postives = 94/138 (68.12%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            + D++ RW  S + LL+++YGLA F  FLKTE+SDEN+EFW+ACE YK +    K+  +A KIY + + V APREVN+D +TR +T + L  P+  + +  Q ++++LMEKDSYPRF+RS IYQ +   +  Y  R S
Sbjct:   36 SNDEVTRWADSFDILLSNKYGLAAFRTFLKTEFSDENIEFWLACEDYKKIKSPAKMMSKANKIYKEFIDVHAPREVNIDHRTREETKNRLLEPTPHSLNEVQAKVYSLMEKDSYPRFIRSKIYQDLLNRTQIYCQRKS 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: rgs8 (regulator of G protein signaling 8 [Source:NCBI gene;Acc:436804])

HSP 1 Score: 145.976 bits (367), Expect = 2.507e-41
Identity = 65/138 (47.10%), Postives = 94/138 (68.12%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            + D++ RW  S + LL+++YGLA F  FLKTE+SDEN+EFW+ACE YK +    K+  +A KIY + + V APREVN+D +TR +T + L  P+  + +  Q ++++LMEKDSYPRF+RS IYQ +   +  Y  R S
Sbjct:   36 SNDEVTRWADSFDILLSNKYGLAAFRTFLKTEFSDENIEFWLACEDYKKIKSPAKMMSKANKIYKEFIDVHAPREVNIDHRTREETKNRLLEPTPHSLNEVQAKVYSLMEKDSYPRFIRSKIYQDLLNRTQIYCQRKS 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: rgs8 (regulator of G protein signaling 8 [Source:NCBI gene;Acc:436804])

HSP 1 Score: 145.976 bits (367), Expect = 2.507e-41
Identity = 65/138 (47.10%), Postives = 94/138 (68.12%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            + D++ RW  S + LL+++YGLA F  FLKTE+SDEN+EFW+ACE YK +    K+  +A KIY + + V APREVN+D +TR +T + L  P+  + +  Q ++++LMEKDSYPRF+RS IYQ +   +  Y  R S
Sbjct:   36 SNDEVTRWADSFDILLSNKYGLAAFRTFLKTEFSDENIEFWLACEDYKKIKSPAKMMSKANKIYKEFIDVHAPREVNIDHRTREETKNRLLEPTPHSLNEVQAKVYSLMEKDSYPRFIRSKIYQDLLNRTQIYCQRKS 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: rgs8 (regulator of G protein signaling 8 [Source:NCBI gene;Acc:436804])

HSP 1 Score: 145.976 bits (367), Expect = 2.507e-41
Identity = 65/138 (47.10%), Postives = 94/138 (68.12%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            + D++ RW  S + LL+++YGLA F  FLKTE+SDEN+EFW+ACE YK +    K+  +A KIY + + V APREVN+D +TR +T + L  P+  + +  Q ++++LMEKDSYPRF+RS IYQ +   +  Y  R S
Sbjct:   36 SNDEVTRWADSFDILLSNKYGLAAFRTFLKTEFSDENIEFWLACEDYKKIKSPAKMMSKANKIYKEFIDVHAPREVNIDHRTREETKNRLLEPTPHSLNEVQAKVYSLMEKDSYPRFIRSKIYQDLLNRTQIYCQRKS 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 139.813 bits (351), Expect = 4.453e-39
Identity = 62/124 (50.00%), Postives = 92/124 (74.19%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P  ++  +W  SL+ LL  +YGLA F AFL+TE+S+ENL+FW+ACE YK +  Q K+  +A+KI+++ +++Q+ +EVNLDS TR  T  +L   ++  F+ AQ+RI+ LMEKDSYPRFLRS++Y
Sbjct:   32 PTPEEAMKWGESLDKLLVHKYGLAAFRAFLRTEFSEENLDFWLACEDYKKIKSQSKMTSKAKKIFAEFIAIQSCKEVNLDSYTREHTKENLQNINRSCFELAQRRIYGLMEKDSYPRFLRSELY 155          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: sppl2b (signal peptide peptidase like 2B [Source:Xenbase;Acc:XB-GENE-958186])

HSP 1 Score: 149.058 bits (375), Expect = 1.381e-40
Identity = 67/125 (53.60%), Postives = 92/125 (73.60%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            P+ D +  W  SLE+LL+  YG ALF  FL++E+SDENL+FW+ACE YK       L+  A+KIY  ++++Q+P+EVNLD+ TR  T  +L  P++ TFD AQ+RI+ LME+DSYPRFLRSD+YQ
Sbjct:  196 PSIDDVTSWGKSLENLLSHTYGRALFRVFLQSEFSDENLDFWLACEEYKDTHPNFILHSRARKIYQLYIALQSPKEVNLDASTREMTEHNLLIPTRTTFDEAQRRIYGLMERDSYPRFLRSDLYQ 320          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: nhlrc3 (NHL repeat containing 3 [Source:Xenbase;Acc:XB-GENE-988782])

HSP 1 Score: 144.821 bits (364), Expect = 6.845e-40
Identity = 69/130 (53.08%), Postives = 95/130 (73.08%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMG 1232
            D++K+W  SLE+L+ +  GLA F AFL++EYS+EN++FW+ACE+YK +   +KL ++AQKIY   +SV+A REVNLDS TR +T +++  P+  TFD AQ RIF LMEKDSY RFL+S  Y  +   S G
Sbjct:   93 DEVKKWAESLENLINNECGLAAFRAFLQSEYSEENIDFWLACENYKKVKTPEKLLEKAQKIYEDFISVEATREVNLDSATREETSNNIIQPTHSTFDEAQHRIFILMEKDSYRRFLKSKFYLDLVLSSSG 222          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: cipc (CLOCK-interacting pacemaker [Source:Xenbase;Acc:XB-GENE-5806252])

HSP 1 Score: 131.339 bits (329), Expect = 1.073e-35
Identity = 63/121 (52.07%), Postives = 83/121 (68.60%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            D+ +RW  S + LL+ +YG  +F AFL+TE+S+ENLEFW+ACE Y+      KL  +A  I+ + + VQAPREVNLD  TR  T  +L  P+   FD AQ RI +LME+DSYPRFLRS +Y
Sbjct:   44 DEARRWARSFDLLLSHKYGRTMFRAFLQTEFSEENLEFWVACEEYRKTRSLNKLPAKAHHIFQEFIDVQAPREVNLDYPTRELTKRNLLHPTLSCFDLAQLRIHSLMERDSYPRFLRSKMY 164          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: cipc (CLOCK-interacting pacemaker [Source:Xenbase;Acc:XB-GENE-5806252])

HSP 1 Score: 132.109 bits (331), Expect = 1.881e-35
Identity = 63/121 (52.07%), Postives = 83/121 (68.60%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            D+ +RW  S + LL+ +YG  +F AFL+TE+S+ENLEFW+ACE Y+      KL  +A  I+ + + VQAPREVNLD  TR  T  +L  P+   FD AQ RI +LME+DSYPRFLRS +Y
Sbjct:   84 DEARRWARSFDLLLSHKYGRTMFRAFLQTEFSEENLEFWVACEEYRKTRSLNKLPAKAHHIFQEFIDVQAPREVNLDYPTRELTKRNLLHPTLSCFDLAQLRIHSLMERDSYPRFLRSKMY 204          
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Match: fancd2os (FANCD2 opposite strand [Source:Xenbase;Acc:XB-GENE-965507])

HSP 1 Score: 129.413 bits (324), Expect = 1.833e-34
Identity = 54/125 (43.20%), Postives = 87/125 (69.60%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            P  ++ K W  + + LLA +YG+A F AFLK+E+S+EN+EFW+ACE +K      KL  +A+KIY + +  +AP+E+N+D +TR   + ++  PS   F +AQ+R+++LM  +SYPRF++S+ YQ
Sbjct:   77 PTPEEAKSWSETFDDLLASKYGVAAFRAFLKSEFSEENIEFWLACEDFKKTKSPHKLTAKAKKIYDEFIEKEAPKEINIDFQTRENIMQTMQEPSHSCFSAAQRRVYSLMVNNSYPRFIQSEFYQ 201          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs3 (regulator of G-protein signaling 3 [Source:MGI Symbol;Acc:MGI:1354734])

HSP 1 Score: 148.673 bits (374), Expect = 3.540e-42
Identity = 67/124 (54.03%), Postives = 94/124 (75.81%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P +++  +W  SLE LL  +YGL +F AFL+TE+S+ENLEFW+ACE +K +  Q K+  +A+KI+++ +++QA +EVNLDS TR  T  +L + ++  FD AQKRIF LMEKDSYPRFLRSD+Y
Sbjct:   56 PTSEEALKWSESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLY 179          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs3 (regulator of G-protein signaling 3 [Source:MGI Symbol;Acc:MGI:1354734])

HSP 1 Score: 149.828 bits (377), Expect = 3.883e-39
Identity = 67/124 (54.03%), Postives = 94/124 (75.81%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P +++  +W  SLE LL  +YGL +F AFL+TE+S+ENLEFW+ACE +K +  Q K+  +A+KI+++ +++QA +EVNLDS TR  T  +L + ++  FD AQKRIF LMEKDSYPRFLRSD+Y
Sbjct:  432 PTSEEALKWSESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLY 555          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs8 (regulator of G-protein signaling 8 [Source:MGI Symbol;Acc:MGI:108408])

HSP 1 Score: 138.272 bits (347), Expect = 2.634e-38
Identity = 63/123 (51.22%), Postives = 87/123 (70.73%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            +T++  RW  S + LL+ +YG+A F AFLKTE+S+ENLEFW+ACE +K      KL  +A +I+ + + VQAPREVN+D +TR  T  ++  PS   FD AQ ++ +LMEKDSYPRFLRS +Y
Sbjct:   44 STEEATRWAESFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVTKAHRIFEEFVDVQAPREVNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMY 166          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs8 (regulator of G-protein signaling 8 [Source:MGI Symbol;Acc:MGI:108408])

HSP 1 Score: 138.272 bits (347), Expect = 2.634e-38
Identity = 63/123 (51.22%), Postives = 87/123 (70.73%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            +T++  RW  S + LL+ +YG+A F AFLKTE+S+ENLEFW+ACE +K      KL  +A +I+ + + VQAPREVN+D +TR  T  ++  PS   FD AQ ++ +LMEKDSYPRFLRS +Y
Sbjct:   44 STEEATRWAESFDVLLSHKYGVAAFRAFLKTEFSEENLEFWLACEEFKKTRSTAKLVTKAHRIFEEFVDVQAPREVNIDFQTREATRKNMQEPSLTCFDQAQGKVHSLMEKDSYPRFLRSKMY 166          
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Match: Rgs3 (regulator of G-protein signaling 3 [Source:MGI Symbol;Acc:MGI:1354734])

HSP 1 Score: 149.443 bits (376), Expect = 2.833e-38
Identity = 67/124 (54.03%), Postives = 94/124 (75.81%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P +++  +W  SLE LL  +YGL +F AFL+TE+S+ENLEFW+ACE +K +  Q K+  +A+KI+++ +++QA +EVNLDS TR  T  +L + ++  FD AQKRIF LMEKDSYPRFLRSD+Y
Sbjct:  830 PTSEEALKWSESLEKLLLHKYGLEVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEFIAIQACKEVNLDSYTREHTKENLQSITRGCFDLAQKRIFGLMEKDSYPRFLRSDLY 953          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|Q6DGI0|RGS8_DANRE (Regulator of G-protein signaling 8 OS=Danio rerio OX=7955 GN=rgs8 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.583e-40
Identity = 65/138 (47.10%), Postives = 94/138 (68.12%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            + D++ RW  S + LL+++YGLA F  FLKTE+SDEN+EFW+ACE YK +    K+  +A KIY + + V APREVN+D +TR +T + L  P+  + +  Q ++++LMEKDSYPRF+RS IYQ +   +  Y  R S
Sbjct:   36 SNDEVTRWADSFDILLSNKYGLAAFRTFLKTEFSDENIEFWLACEDYKKIKSPAKMMSKANKIYKEFIDVHAPREVNIDHRTREETKNRLLEPTPHSLNEVQAKVYSLMEKDSYPRFIRSKIYQDLLNRTQIYCQRKS 173          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|Q3T0T8|RGS5_BOVIN (Regulator of G-protein signaling 5 OS=Bos taurus OX=9913 GN=RGS5 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.260e-39
Identity = 67/125 (53.60%), Postives = 91/125 (72.80%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            P+ D+  +W  SL+ LL + YGLA F +FLK+E+S+ENLEFWMACE YK +    K+ + A+KIY + + V+AP+EVN+D  T+  T+ +L  PS  +FD AQKRI ALMEKDS PRF+RS+ YQ
Sbjct:   53 PSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWMACEDYKKIKSPVKMAETAKKIYEEFIQVEAPKEVNIDHFTKEITVKNLVEPSPSSFDVAQKRIHALMEKDSLPRFVRSEFYQ 177          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|Q864Z2|RGS5_PIG (Regulator of G-protein signaling 5 OS=Sus scrofa OX=9823 GN=RGS5 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.912e-39
Identity = 66/125 (52.80%), Postives = 92/125 (73.60%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            P+ D+  +W  SL+ LL + YGLA F +FLK+E+S+ENLEFWMACE YK +    K+ ++A+KIY + +  +AP+EVN+D  T+  T+ +L  PS  +FD AQKRI+ALMEKDS PRF+RS+ YQ
Sbjct:   53 PSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWMACEDYKKIKSPVKMAEKAKKIYEEFIQSEAPKEVNIDHFTKEITMKNLVEPSPSSFDVAQKRIYALMEKDSLPRFVRSEFYQ 177          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|P49796|RGS3_HUMAN (Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2)

HSP 1 Score: 152.525 bits (384), Expect = 1.878e-38
Identity = 68/124 (54.84%), Postives = 96/124 (77.42%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P +++  +W  SLE LL  +YGLA+F AFL+TE+S+ENLEFW+ACE +K +  Q K+  +A+KI+++++++QA +EVNLDS TR  T  +L + ++  FD AQKRIF LMEKDSYPRFLRSD+Y
Sbjct: 1062 PTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLY 1185          
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Match: sp|Q4R525|RGS4_MACFA (Regulator of G-protein signaling 4 OS=Macaca fascicularis OX=9541 GN=RGS4 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 1.816e-37
Identity = 64/121 (52.89%), Postives = 90/121 (74.38%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            +++K+W  SLE+L++   GLA F AFLK+EYS+EN++FW++CE YK +    KL  +A+KIY++ +SVQA +EVNLDS TR +T  ++  P+   FD AQK+IF LMEKDSY RFL+S  Y
Sbjct:   54 EEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFY 174          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: A0A1I8HX40 (RGS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.553e-49
Identity = 81/125 (64.80%), Postives = 102/125 (81.60%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            P+ DQ++RW  S + LL D+YGLALF AFLKTEYSDEN+EFW+ACE Y++LSG KK   +AQKIY++ ++ QAPREVNLDS TRL TI+++G+P    F+ AQKRI ALMEKDSY RFLRS++YQ
Sbjct:   98 PSCDQVQRWGASFDSLLNDKYGLALFRAFLKTEYSDENIEFWIACEEYRALSGPKKQTMKAQKIYNEFVAFQAPREVNLDSTTRLATINAMGSPDGHLFEQAQKRIQALMEKDSYQRFLRSEVYQ 222          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: A0A1I8H9V0 (RGS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.296e-48
Identity = 80/132 (60.61%), Postives = 105/132 (79.55%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESM 1229
            P  +Q++RW  S + LL D+YGLALF AFLKTEYSDEN+EFW+ACE Y+ L+G KK   +AQKIY++ ++ QAPREVNLDS TRL TI+++G+P +  F+ AQKRI ALMEKDSY RFLRS++YQ   R+++
Sbjct:   42 PNYEQVQRWGNSFDSLLNDKYGLALFRAFLKTEYSDENIEFWVACEEYRGLTGPKKQALKAQKIYNEFVAFQAPREVNLDSTTRLATINAMGSPDRHLFEQAQKRIQALMEKDSYQRFLRSEVYQAHLRDTV 173          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: A0A1I8JB86 (RGS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 5.147e-48
Identity = 79/132 (59.85%), Postives = 105/132 (79.55%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESM 1229
            P  +Q++RW  S + LL D+YGLALF AFLKTEYSDEN+EFW+ACE Y+ L+G K+   +AQKIY++ ++ QAPREVNLDS TRL TI+++G+P +  F+ AQKRI ALMEKDSY RFLRS++YQ   R+++
Sbjct:   43 PNYEQVQRWGNSFDSLLNDKYGLALFRAFLKTEYSDENIEFWVACEEYRGLTGPKRQALKAQKIYNEFVAFQAPREVNLDSTTRLATINAMGSPDRHLFEQAQKRIQALMEKDSYQRFLRSEVYQAHLRDTV 174          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: A0A267G568 (RGS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029753g1 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.539e-47
Identity = 82/131 (62.60%), Postives = 105/131 (80.15%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRES 1226
            P+ DQ++RW  S + LL D+YGLALF AFLKTEYSDEN+EFW+ACE Y++LSG KK   +AQKIY++ ++ QAPREVNLDS TRL TI+++G+P    F+ AQKRI ALMEKDSY RFLRS++YQ   R++
Sbjct:  381 PSCDQVQRWGASFDSLLNDKYGLALFRAFLKTEYSDENIEFWIACEEYRALSGPKKQTMKAQKIYNEFVAFQAPREVNLDSTTRLATINAMGSPDGHLFEQAQKRIQALMEKDSYQRFLRSEVYQNHLRDA 511          
BLAST of Regulator of G-protein signaling vs. TrEMBL
Match: A0A1I8I973 (RGS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.050e-47
Identity = 81/125 (64.80%), Postives = 102/125 (81.60%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            P+ DQ++RW  S + LL D+YGLALF AFLKTEYSDEN+EFW+ACE Y++LSG KK   +AQKIY++ ++ QAPREVNLDS TRL TI+++G+P    F+ AQKRI ALMEKDSY RFLRS++YQ
Sbjct:  318 PSCDQVQRWGASFDSLLNDKYGLALFRAFLKTEYSDENIEFWIACEEYRALSGPKKQTMKAQKIYNEFVAFQAPREVNLDSTTRLATINAMGSPDGHLFEQAQKRIQALMEKDSYQRFLRSEVYQ 442          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: rgs8 (regulator of G-protein signaling 8 [Source:NCBI gene;Acc:103027818])

HSP 1 Score: 147.132 bits (370), Expect = 7.214e-42
Identity = 66/136 (48.53%), Postives = 94/136 (69.12%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            D++ +W  S + LL+++YGLA+F AFLKTE+SDEN+EFW+ACE YK +    KL  +A KIY++ + V+APREVN+D +TR  T   L  P+  + +  Q ++++LMEKDSYPRFLRS  YQ +   +  Y  R S
Sbjct:   38 DEVTKWADSFDVLLSNKYGLAVFRAFLKTEFSDENIEFWLACEDYKKIKSPAKLVSKANKIYNEFIDVKAPREVNIDFRTRQDTKQKLLEPTSSSLNEIQAKVYSLMEKDSYPRFLRSKCYQDLLNRTQMYCQRKS 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: rgs8 (regulator of G-protein signaling 8 [Source:NCBI gene;Acc:103027818])

HSP 1 Score: 147.132 bits (370), Expect = 7.214e-42
Identity = 66/136 (48.53%), Postives = 94/136 (69.12%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            D++ +W  S + LL+++YGLA+F AFLKTE+SDEN+EFW+ACE YK +    KL  +A KIY++ + V+APREVN+D +TR  T   L  P+  + +  Q ++++LMEKDSYPRFLRS  YQ +   +  Y  R S
Sbjct:   38 DEVTKWADSFDVLLSNKYGLAVFRAFLKTEFSDENIEFWLACEDYKKIKSPAKLVSKANKIYNEFIDVKAPREVNIDFRTRQDTKQKLLEPTSSSLNEIQAKVYSLMEKDSYPRFLRSKCYQDLLNRTQMYCQRKS 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: rgs8 (regulator of G-protein signaling 8 [Source:NCBI gene;Acc:103027818])

HSP 1 Score: 147.132 bits (370), Expect = 7.214e-42
Identity = 66/136 (48.53%), Postives = 94/136 (69.12%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            D++ +W  S + LL+++YGLA+F AFLKTE+SDEN+EFW+ACE YK +    KL  +A KIY++ + V+APREVN+D +TR  T   L  P+  + +  Q ++++LMEKDSYPRFLRS  YQ +   +  Y  R S
Sbjct:   38 DEVTKWADSFDVLLSNKYGLAVFRAFLKTEFSDENIEFWLACEDYKKIKSPAKLVSKANKIYNEFIDVKAPREVNIDFRTRQDTKQKLLEPTSSSLNEIQAKVYSLMEKDSYPRFLRSKCYQDLLNRTQMYCQRKS 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 144.05 bits (362), Expect = 1.037e-40
Identity = 64/124 (51.61%), Postives = 93/124 (75.00%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P  ++  +W  SL+ LL  +YGLA F AFL+TE+S+ENLEFW+ACE YK +  Q K+  +A+KI+++++++Q+ +EVNLDS TR  T  +L   ++  FD AQ+RI+ LMEKDSYPRFLRS++Y
Sbjct:   37 PTPEEALKWGESLDKLLVHKYGLAAFRAFLRTEFSEENLEFWLACEDYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTREHTKENLQNITRSCFDLAQRRIYGLMEKDSYPRFLRSELY 160          
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 144.05 bits (362), Expect = 1.721e-40
Identity = 64/124 (51.61%), Postives = 93/124 (75.00%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P  ++  +W  SL+ LL  +YGLA F AFL+TE+S+ENLEFW+ACE YK +  Q K+  +A+KI+++++++Q+ +EVNLDS TR  T  +L   ++  FD AQ+RI+ LMEKDSYPRFLRS++Y
Sbjct:   51 PTPEEALKWGESLDKLLVHKYGLAAFRAFLRTEFSEENLEFWLACEDYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTREHTKENLQNITRSCFDLAQRRIYGLMEKDSYPRFLRSELY 174          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006812.1 (pep scaffold:Pmarinus_7.0:GL476397:246833:248901:1 gene:ENSPMAG00000006145.1 transcript:ENSPMAT00000006812.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.673 bits (374), Expect = 1.972e-43
Identity = 68/124 (54.84%), Postives = 90/124 (72.58%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P+ D+   W  SL+ LL  +YGLA F AFL+TE+S+EN+ FW+ACE YK      KL  +A+KI+S+++++Q+P EVNLDS TR  T ++L  P+   FD AQKRIF LMEKDSYPRFLRS +Y
Sbjct:   27 PSQDEAHAWAESLDKLLVHKYGLAAFQAFLRTEFSEENINFWLACEDYKKTKSAAKLTSKARKIFSEYIAIQSPNEVNLDSCTRELTAANLAKPTADAFDVAQKRIFGLMEKDSYPRFLRSQLY 150          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008960.1 (pep scaffold:Pmarinus_7.0:GL487232:48:5367:1 gene:ENSPMAG00000008102.1 transcript:ENSPMAT00000008960.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.124 bits (357), Expect = 2.037e-40
Identity = 65/125 (52.00%), Postives = 92/125 (73.60%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYK-SLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P+ +   +W  S E LLA +YGLA F AFLKTE+S+EN++FW+ACE +K S     KL  +++KI  + +++Q+P+EVNLDS TR  T+++L  P+  + D AQKRI+ LME+DSYPRFLRSD+Y
Sbjct:   49 PSCEDAMKWSESFEKLLAHKYGLAAFRAFLKTEFSEENIDFWLACEDFKRSARSTSKLVSKSKKISEEFIAIQSPKEVNLDSSTREVTMANLQKPTVTSLDLAQKRIYGLMERDSYPRFLRSDLY 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005413.1 (pep scaffold:Pmarinus_7.0:GL501287:7893:12072:-1 gene:ENSPMAG00000004924.1 transcript:ENSPMAT00000005413.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 9.793e-36
Identity = 60/123 (48.78%), Postives = 84/123 (68.29%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            +  + + W  SL+ LL+ +YG   F AFL+TE+S+ENLEFW+ACE +K +  + K   +A+KIYSQ ++  AP+EVNLD  TR  T + L   +   F+ AQKRI+ LME+DSYPRFL S +Y
Sbjct:    6 SVKEARAWSESLDRLLSHKYGRVAFLAFLRTEFSEENLEFWLACEEFKRMKAESKRLAQARKIYSQFIANHAPKEVNLDCLTRDATEAGLPGAAPGAFEPAQKRIYGLMERDSYPRFLLSPLY 128          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003940.1 (pep scaffold:Pmarinus_7.0:GL476449:561747:569035:-1 gene:ENSPMAG00000003600.1 transcript:ENSPMAT00000003940.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 7.863e-29
Identity = 50/121 (41.32%), Postives = 78/121 (64.46%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            +++  W +  E L+    G A+F  FL+TE+S+ENL FW+ACE  K    +  + ++A+ IY  ++S+ +P+EV+LDS+ R     ++  PS  TFD AQ +I+ LM +DSYPRFL S +Y
Sbjct:   82 EEVTSWSHCFERLMHSAAGRAVFREFLRTEFSEENLLFWLACEDLKKEENKNIVEEKARTIYEDYISILSPKEVSLDSRVREVINRNMVEPSAHTFDDAQLQIYTLMHRDSYPRFLGSSVY 202          
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008468.1 (pep scaffold:Pmarinus_7.0:GL476656:335513:340095:-1 gene:ENSPMAG00000007670.1 transcript:ENSPMAT00000008468.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 1.615e-28
Identity = 49/125 (39.20%), Postives = 82/125 (65.60%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            P+ ++++ W  S + L+    G   F  FL+TE+S+EN+ FW+ACE  K  + ++ + ++A+ IY  ++S+ +P+EV+LDS+ R     ++  P+  TFD AQ +I+ LM +DSYPRFL S IY+
Sbjct:   69 PSMEEVQVWGQSFDKLIRSTGGRNTFREFLRTEFSEENMLFWLACEDLKREANKRAVEEKARVIYEDYISILSPKEVSLDSRVREVINRNMLEPTSHTFDDAQLQIYTLMHRDSYPRFLNSQIYK 193          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO37370 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFZ6])

HSP 1 Score: 107.842 bits (268), Expect = 6.708e-28
Identity = 50/133 (37.59%), Postives = 84/133 (63.16%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMG 1232
            P++++I  W  S E LL+ + G+ +F+ FLK+EYS+ENL FW+A E  K  +    +   AQ IY+ ++S ++P+EV++D KTR      +  P+K TF  AQ+ ++ +M +D YPRFL S  ++ + +E + 
Sbjct:   25 PSSEEINEWGRSFERLLSSKNGIRVFHEFLKSEYSEENLLFWLAVERLKKETEPASVKNLAQTIYNDYVSTESPKEVSIDHKTRQVIDDEISQPTKETFSKAQQHVYYVMYQDCYPRFLSSSTFKTLQQECLN 157          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO32804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU35])

HSP 1 Score: 105.916 bits (263), Expect = 4.032e-27
Identity = 48/131 (36.64%), Postives = 79/131 (60.31%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRES 1226
            P  D++K W++    LL+ +YG+  F  FL+++Y +ENL FW+A E Y+ L  ++     A+ IY  ++S  +P E++LD+K R     S+  P + TFD AQ  I+ LM  D +PRF++S  Y+ + + S
Sbjct:   34 PTIDEMKNWKHDFHALLSSKYGVNQFQEFLRSQYGEENLCFWLAVEDYRRLEDRESRRDMARMIYEDYVSTLSPTEISLDAKIRATVDKSMSDPDQNTFDPAQDHIYTLMYHDCFPRFIKSKHYKNLIKSS 164          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO34351 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN2])

HSP 1 Score: 106.686 bits (265), Expect = 2.234e-25
Identity = 53/121 (43.80%), Postives = 80/121 (66.12%), Query Frame = 3
Query:  846 QIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            ++KRW +SL  LL D  G   F  FL+ E+S ENL FW+ACE  K+ +  K++ ++AQ+IY+++LS  +   +N+D KT  +   +L  P +  FD+AQ  IF LM+ DSY RFLRS++Y+
Sbjct:  269 RVKRWAFSLSELLKDPLGRKYFTRFLEKEFSAENLAFWLACERLKA-TPIKQVPEKAQEIYTEYLSEHSTSPINVDCKTHEEVEMNLEKPGRYMFDAAQDHIFQLMKSDSYSRFLRSELYK 388          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO43126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZM8])

HSP 1 Score: 105.916 bits (263), Expect = 2.904e-24
Identity = 52/130 (40.00%), Postives = 77/130 (59.23%), Query Frame = 3
Query:  846 QIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY-QIVYRESMG 1232
            ++ RW    + L+ D+ GL  F  FLK E+S+EN+ FW+ACE ++S+S  KKL   A  I+  HLS  A   VN+DS         L  P+   +   Q++++ LM+ DSYPRFL+SD+Y Q +  E+ G
Sbjct:  650 RVSRWALGFDKLMDDQAGLHCFEEFLKKEFSEENIVFWIACEEFRSISDPKKLKSAASTIFETHLSPNALMPVNIDSSAVKVAEEHLLNPTNHMYRVPQQQVYTLMKFDSYPRFLKSDLYRQCLMCEAEG 779          
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Match: EDO35193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM89])

HSP 1 Score: 51.9878 bits (123), Expect = 1.111e-7
Identity = 33/124 (26.61%), Postives = 59/124 (47.58%), Query Frame = 3
Query:  870 LEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQK---------KLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSL---GTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            L  ++ + + +  F  FL+ E     LEFW+  ++++S+   K         +   +A  IY ++ S+QA   +  D  TR+   +S+   G P    F    + I  L+E+   P FL+S+IY
Sbjct:   89 LSDIMYNEHAVFYFMEFLEQEGVRHMLEFWLTADNFQSMLKTKMDNGSYNASQALDDAMIIYERYFSMQASLPLGFDDVTRIHIENSICREGGPLPECFAIPMEHILCLLEEXFLPSFLQSEIY 212          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: rgs8 (regulator of G-protein signaling 8 [Source:NCBI gene;Acc:101157608])

HSP 1 Score: 155.221 bits (391), Expect = 5.337e-45
Identity = 70/138 (50.72%), Postives = 96/138 (69.57%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            +TD++ RW  S EHLL+ +YGLA F  FLK+E+SDEN+EFWMACE YK +    KL  +A KI+ + + VQ+PREVN+D +TR +T  SL  P+  + +  Q +I++LMEKDSYPRFLRS +YQ +   +   G R S
Sbjct:   36 STDEVVRWSDSFEHLLSHKYGLAAFRTFLKSEFSDENIEFWMACEEYKKIKSSTKLLSKANKIFKEFIEVQSPREVNIDYRTREKTKQSLADPTPTSLNEVQGKIYSLMEKDSYPRFLRSKMYQDMINRAHAQGQRRS 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: rgs8 (regulator of G-protein signaling 8 [Source:NCBI gene;Acc:101157608])

HSP 1 Score: 155.221 bits (391), Expect = 5.337e-45
Identity = 70/138 (50.72%), Postives = 96/138 (69.57%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNS 1250
            +TD++ RW  S EHLL+ +YGLA F  FLK+E+SDEN+EFWMACE YK +    KL  +A KI+ + + VQ+PREVN+D +TR +T  SL  P+  + +  Q +I++LMEKDSYPRFLRS +YQ +   +   G R S
Sbjct:   36 STDEVVRWSDSFEHLLSHKYGLAAFRTFLKSEFSDENIEFWMACEEYKKIKSSTKLLSKANKIFKEFIEVQSPREVNIDYRTREKTKQSLADPTPTSLNEVQGKIYSLMEKDSYPRFLRSKMYQDMINRAHAQGQRRS 173          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: si:ch211-117l17.5 (regulator of G-protein signaling 21-like [Source:NCBI gene;Acc:111947375])

HSP 1 Score: 137.887 bits (346), Expect = 3.251e-38
Identity = 61/122 (50.00%), Postives = 86/122 (70.49%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQ 1208
            D  ++W  SLE LL  +YGLA F+ FLK+E+SDEN+EFW+ CE YK      ++  +A+KIY Q +  ++P+E+N+D  TR Q   ++ TP+   FD AQK ++ LME+DSYPRFLRSDIY+
Sbjct:   49 DDTQQWSQSLERLLESKYGLATFHNFLKSEHSDENIEFWLTCEDYKKSRSSYRMSSKAKKIYEQFIKAESPKEINIDYHTREQIKRNVKTPTTQCFDEAQKIVYGLMERDSYPRFLRSDIYR 170          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 144.821 bits (364), Expect = 9.527e-38
Identity = 64/124 (51.61%), Postives = 94/124 (75.81%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P  ++  +W  SL+ LLA +YGLA F AFL+TE+S+ENLEFW+ACE YK +  Q K+  +A+KI+++++++Q+ +EVNLDS TR  T  +L   ++  F+ AQ+RI+ LMEKDSYPRFLRS++Y
Sbjct:  387 PTPEEALKWGDSLDKLLAHKYGLAAFRAFLRTEFSEENLEFWLACEEYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTRDHTKDNLQNVTRSCFELAQRRIYGLMEKDSYPRFLRSELY 510          
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Match: rgs3a (regulator of G protein signaling 3a [Source:ZFIN;Acc:ZDB-GENE-040801-150])

HSP 1 Score: 144.821 bits (364), Expect = 9.700e-38
Identity = 64/124 (51.61%), Postives = 94/124 (75.81%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P  ++  +W  SL+ LLA +YGLA F AFL+TE+S+ENLEFW+ACE YK +  Q K+  +A+KI+++++++Q+ +EVNLDS TR  T  +L   ++  F+ AQ+RI+ LMEKDSYPRFLRS++Y
Sbjct:  382 PTPEEALKWGDSLDKLLAHKYGLAAFRAFLRTEFSEENLEFWLACEEYKKIKSQSKMASKAKKIFAEYIAIQSCKEVNLDSYTRDHTKDNLQNVTRSCFELAQRRIYGLMEKDSYPRFLRSELY 505          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000027589.1 (SMESG000027589.1)

HSP 1 Score: 687.567 bits (1773), Expect = 0.000e+0
Identity = 344/345 (99.71%), Postives = 344/345 (99.71%), Query Frame = 3
Query:  234 MNNASPTFLITPPDNGEHQQPDQLAHHPTENHSDIFSHSQCLSPTSKIEIDKRSHGWEKIFSKPLQRSKSAGSRADVKANGIYNISARKVVQKTQLSADDASCEDIADFDRLKKNREKKGLFDVKEVLSFFHKKSAHDLAAIAVTSSLAESRSDGFGGSHGNLSTLGNISPVFNKQNKKQSLYPHDNXXXXXXXXXXXXXPATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNSCVDQLP 1268
            MNNASPTFLITPPDNGEHQQPDQLAHHPTENHSDIFSH QCLSPTSKIEIDKRSHGWEKIFSKPLQRSKSAGSRADVKANGIYNISARKVVQKTQLSADDASCEDIADFDRLKKNREKKGLFDVKEVLSFFHKKSAHDLAAIAVTSSLAESRSDGFGGSHGNLSTLGNISPVFNKQNKKQSLYPHDNKSSTSSSSKHGSHPATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNSCVDQLP
Sbjct:    1 MNNASPTFLITPPDNGEHQQPDQLAHHPTENHSDIFSHGQCLSPTSKIEIDKRSHGWEKIFSKPLQRSKSAGSRADVKANGIYNISARKVVQKTQLSADDASCEDIADFDRLKKNREKKGLFDVKEVLSFFHKKSAHDLAAIAVTSSLAESRSDGFGGSHGNLSTLGNISPVFNKQNKKQSLYPHDNKSSTSSSSKHGSHPATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNSCVDQLP 345          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000011723.1 (SMESG000011723.1)

HSP 1 Score: 159.073 bits (401), Expect = 5.379e-43
Identity = 76/133 (57.14%), Postives = 98/133 (73.68%), Query Frame = 3
Query:  837 ATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGY 1235
            + +QIK+W  S E LL D+YGLALF+ FL++E+SDEN+EFW+ACE Y++++  KKL   A+KIY+  + VQA REVNLDSKTR QT   +  P+  TFD AQKRI ALMEKDSY RFLRS++Y  + R    Y
Sbjct:  293 SIEQIKKWSNSFECLLHDKYGLALFHEFLRSEFSDENIEFWIACEEYRTITTNKKLQSRAEKIYNDFVGVQAAREVNLDSKTRQQTEIDIRNPNPHTFDQAQKRIQALMEKDSYQRFLRSELYGKLVRACEEY 425          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000048981.1 (SMESG000048981.1)

HSP 1 Score: 152.91 bits (385), Expect = 1.580e-40
Identity = 69/127 (54.33%), Postives = 96/127 (75.59%), Query Frame = 3
Query:  843 DQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIYQIVYRE 1223
            +QI+RW  S E LL D+YGLALF+ +LK+EYS+EN+EFW+ACE +K+++  KK+   AQKI    ++ QAP+EVN+DSKTR  T+ S+  P+   FD AQKRI +LME DSY RFLRS++YQ + ++
Sbjct:  342 EQIQRWNESFEQLLNDKYGLALFHDYLKSEYSEENIEFWIACEEFKTITNPKKMASRAQKIIKDFVTTQAPKEVNIDSKTRQITLESIQHPNANMFDMAQKRIQSLMEIDSYQRFLRSEMYQALMQD 468          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000012254.1 (SMESG000012254.1)

HSP 1 Score: 148.673 bits (374), Expect = 2.734e-39
Identity = 95/287 (33.10%), Postives = 158/287 (55.05%), Query Frame = 3
Query:  390 RSHGWEKIFSKPLQRSKSAGSRADVKANGIYNISARKVVQKTQ------------LSADDASCEDIADFDRLKKNREKKGL-FDVKEVLSFFHKKSAHDLAAIAVTSSLAESRSDGFGGSHGNLSTLGNISPVF--NKQNKKQSLYPHDNXXXXXXXXXXXXXPATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            R+ GW K+F+  LQRSKS  + +++  N    +  R   +  Q             +  D+   D     +L+  ++K+ +  D++E L+FF K+   + +     ++ A            N S+L  +SP F  N +N    ++   N             P+ +Q+  W  S E++L D++G+ LF  FL++E+SDENLEFW  C++Y+S+   KKL ++A +I+  +++ Q+P+E+NLDS TR+QT + +   +K TFD +QK+I ALMEKDSY RFLRS+I+
Sbjct:  174 RTSGWAKLFASTLQRSKSTVT-SEMTQNNQKTVKLRPGRKSEQPTTSVNSSISSSSTIQDSESSDSQANIKLEMRKKKRSIGVDMREKLNFFRKQQGENSSQPTSNTTAA------------NRSSL--VSPNFMINLEN----VWKATNGC-----------PSREQVLSWSQSFENILYDQHGITLFLEFLRSEFSDENLEFWSECQAYRSIKCPKKLQEKATQIFEDYVAEQSPKEINLDSVTRIQTATDIIHATKQTFDQSQKKIQALMEKDSYQRFLRSEIF 430          
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Match: SMESG000053355.1 (SMESG000053355.1)

HSP 1 Score: 127.102 bits (318), Expect = 2.240e-34
Identity = 59/124 (47.58%), Postives = 81/124 (65.32%), Query Frame = 3
Query:  834 PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKSLSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFDSAQKRIFALMEKDSYPRFLRSDIY 1205
            P  + I  W+  LE +L D YGL  FN FLK+EYS ENL FW+ACE +K++  +KKL + A  IY +++++ +  EVNLD+K R   I  + +P+K  F+ AQ  IF LM KDSY RFL+S  Y
Sbjct:   55 PTIENILSWKNGLEFILNDYYGLYYFNEFLKSEYSVENLNFWLACEKFKTIQSRKKLDEIANSIYQEYIAIGSENEVNLDAKLRRNIIEQMNSPNKKLFELAQSSIFILMAKDSYCRFLKSKCY 178          
The following BLAST results are available for this feature:
BLAST of Regulator of G-protein signaling vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RGS31.955e-4354.84regulator of G protein signaling 3 [Source:HGNC Sy... [more]
RGS33.261e-4354.84regulator of G protein signaling 3 [Source:HGNC Sy... [more]
RGS31.891e-4154.84regulator of G protein signaling 3 [Source:HGNC Sy... [more]
RGS31.891e-4154.84regulator of G protein signaling 3 [Source:HGNC Sy... [more]
RGS31.721e-4054.84regulator of G protein signaling 3 [Source:HGNC Sy... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs-23.348e-3244.88Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-24.502e-3244.88Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-25.427e-3244.88Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-26.549e-3244.88Regulator of G-protein signaling rgs-2 [Source:Un... [more]
rgs-13.117e-2740.77Regulator of G-protein signaling rgs-1 [Source:Un... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhit7.953e-2637.80gene:FBgn0028743 transcript:FBtr0340279[more]
Dhit8.707e-2637.80gene:FBgn0028743 transcript:FBtr0301142[more]
CG424503.748e-2440.48gene:FBgn0259927 transcript:FBtr0300218[more]
CG424504.108e-2440.48gene:FBgn0259927 transcript:FBtr0310343[more]
loco9.887e-2341.88gene:FBgn0020278 transcript:FBtr0084275[more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs82.507e-4147.10regulator of G protein signaling 8 [Source:NCBI ge... [more]
rgs82.507e-4147.10regulator of G protein signaling 8 [Source:NCBI ge... [more]
rgs82.507e-4147.10regulator of G protein signaling 8 [Source:NCBI ge... [more]
rgs82.507e-4147.10regulator of G protein signaling 8 [Source:NCBI ge... [more]
rgs3a4.453e-3950.00regulator of G protein signaling 3a [Source:ZFIN;A... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sppl2b1.381e-4053.60signal peptide peptidase like 2B [Source:Xenbase;A... [more]
nhlrc36.845e-4053.08NHL repeat containing 3 [Source:Xenbase;Acc:XB-GEN... [more]
cipc1.073e-3552.07CLOCK-interacting pacemaker [Source:Xenbase;Acc:XB... [more]
cipc1.881e-3552.07CLOCK-interacting pacemaker [Source:Xenbase;Acc:XB... [more]
fancd2os1.833e-3443.20FANCD2 opposite strand [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rgs33.540e-4254.03regulator of G-protein signaling 3 [Source:MGI Sym... [more]
Rgs33.883e-3954.03regulator of G-protein signaling 3 [Source:MGI Sym... [more]
Rgs82.634e-3851.22regulator of G-protein signaling 8 [Source:MGI Sym... [more]
Rgs82.634e-3851.22regulator of G-protein signaling 8 [Source:MGI Sym... [more]
Rgs32.833e-3854.03regulator of G-protein signaling 3 [Source:MGI Sym... [more]
back to top
BLAST of Regulator of G-protein signaling vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DGI0|RGS8_DANRE1.583e-4047.10Regulator of G-protein signaling 8 OS=Danio rerio ... [more]
sp|Q3T0T8|RGS5_BOVIN2.260e-3953.60Regulator of G-protein signaling 5 OS=Bos taurus O... [more]
sp|Q864Z2|RGS5_PIG5.912e-3952.80Regulator of G-protein signaling 5 OS=Sus scrofa O... [more]
sp|P49796|RGS3_HUMAN1.878e-3854.84Regulator of G-protein signaling 3 OS=Homo sapiens... [more]
sp|Q4R525|RGS4_MACFA1.816e-3752.89Regulator of G-protein signaling 4 OS=Macaca fasci... [more]
back to top
BLAST of Regulator of G-protein signaling vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HX401.553e-4964.80RGS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8H9V01.296e-4860.61RGS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8JB865.147e-4859.85RGS domain-containing protein OS=Macrostomum ligna... [more]
A0A267G5681.539e-4762.60RGS domain-containing protein OS=Macrostomum ligna... [more]
A0A1I8I9732.050e-4764.80RGS domain-containing protein OS=Macrostomum ligna... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs87.214e-4248.53regulator of G-protein signaling 8 [Source:NCBI ge... [more]
rgs87.214e-4248.53regulator of G-protein signaling 8 [Source:NCBI ge... [more]
rgs87.214e-4248.53regulator of G-protein signaling 8 [Source:NCBI ge... [more]
rgs3a1.037e-4051.61regulator of G protein signaling 3a [Source:ZFIN;A... [more]
rgs3a1.721e-4051.61regulator of G protein signaling 3a [Source:ZFIN;A... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006812.11.972e-4354.84pep scaffold:Pmarinus_7.0:GL476397:246833:248901:1... [more]
ENSPMAT00000008960.12.037e-4052.00pep scaffold:Pmarinus_7.0:GL487232:48:5367:1 gene:... [more]
ENSPMAT00000005413.19.793e-3648.78pep scaffold:Pmarinus_7.0:GL501287:7893:12072:-1 g... [more]
ENSPMAT00000003940.17.863e-2941.32pep scaffold:Pmarinus_7.0:GL476449:561747:569035:-... [more]
ENSPMAT00000008468.11.615e-2839.20pep scaffold:Pmarinus_7.0:GL476656:335513:340095:-... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO373706.708e-2837.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328044.032e-2736.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343512.234e-2543.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431262.904e-2440.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351931.111e-726.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rgs85.337e-4550.72regulator of G-protein signaling 8 [Source:NCBI ge... [more]
rgs85.337e-4550.72regulator of G-protein signaling 8 [Source:NCBI ge... [more]
si:ch211-117l17.53.251e-3850.00regulator of G-protein signaling 21-like [Source:N... [more]
rgs3a9.527e-3851.61regulator of G protein signaling 3a [Source:ZFIN;A... [more]
rgs3a9.700e-3851.61regulator of G protein signaling 3a [Source:ZFIN;A... [more]
back to top
BLAST of Regulator of G-protein signaling vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027589.10.000e+099.71SMESG000027589.1[more]
SMESG000011723.15.379e-4357.14SMESG000011723.1[more]
SMESG000048981.11.580e-4054.33SMESG000048981.1[more]
SMESG000012254.12.734e-3933.10SMESG000012254.1[more]
SMESG000053355.12.240e-3447.58SMESG000053355.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026464 ID=SMED30026464|Name=Regulator of G-protein signaling|organism=Schmidtea mediterranea sexual|type=transcript|length=1354bp
CTGAGAGTAGAAAAGAAGGTACAGAAAATTTCAGTTGCTCAACTTTGAGG
TCGGTACACAATGCGTCAATTTTGTATGCGAGCTGTGAATTCTGAACGCA
TCACTCTCAAGTGGATCAAGGAAATAATTCGTGTAATCACCTACTGAATT
AACTCGCGATTGATTTGAATGTATTTTGATCACCTGTTACTGGTCATTTG
TTGTCTCCATGTGATTAGATAACTTTCTCCATCATGAATAATGCTAGCCC
AACGTTTCTCATAACACCTCCTGACAATGGCGAACATCAGCAACCTGATC
AACTTGCACATCATCCCACTGAAAACCATTCAGACATTTTTTCTCATAGT
CAGTGCTTATCGCCAACATCGAAAATCGAGATTGACAAACGTAGTCATGG
ATGGGAGAAAATTTTTTCTAAGCCCCTACAAAGAAGTAAAAGTGCTGGTT
CCAGAGCAGACGTAAAAGCGAATGGAATATATAATATTTCTGCGAGAAAG
GTCGTGCAAAAAACCCAATTGAGTGCTGACGATGCCAGTTGTGAAGATAT
AGCGGATTTTGATAGATTGAAAAAGAACAGAGAAAAGAAGGGATTATTTG
ATGTCAAGGAGGTTTTATCTTTTTTCCACAAGAAATCTGCTCACGATTTA
GCAGCAATCGCTGTAACTTCATCCTTGGCAGAAAGCAGAAGCGACGGGTT
TGGAGGAAGTCATGGTAATTTGAGTACTCTCGGGAATATCTCCCCGGTTT
TCAATAAACAAAACAAAAAGCAAAGCCTGTATCCACATGACAACAAATCC
TCAACGTCCTCATCATCAAAGCATGGATCACATCCAGCAACTGATCAAAT
CAAGAGATGGGAATATAGTTTGGAACATTTATTAGCTGACAGATATGGGC
TGGCGCTCTTCAATGCGTTCCTTAAAACTGAGTACAGCGACGAAAATTTA
GAATTCTGGATGGCTTGTGAATCGTACAAATCTTTATCAGGACAGAAAAA
GCTTTACAAAGAAGCACAGAAAATTTATAGCCAGCATTTATCAGTACAAG
CTCCTAGAGAAGTGAATTTAGATTCCAAAACGCGCTTGCAAACTATTTCC
AGTCTCGGTACGCCATCCAAAATGACATTTGACTCTGCACAAAAACGTAT
TTTCGCCCTCATGGAAAAAGATTCTTATCCACGATTCCTAAGATCGGATA
TTTATCAGATAGTTTACAGGGAATCTATGGGTTACGGTCATAGAAATAGT
TGTGTAGATCAGTTACCTTAACTTTTACACGAAAGTTAATGCTCATTTTC
ACCTTTGTTCACAACAATTAATTTTGCCAGATATTATTATTATTATTATT
ATTA
back to top

protein sequence of SMED30026464-orf-1

>SMED30026464-orf-1 ID=SMED30026464-orf-1|Name=SMED30026464-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=346bp
MNNASPTFLITPPDNGEHQQPDQLAHHPTENHSDIFSHSQCLSPTSKIEI
DKRSHGWEKIFSKPLQRSKSAGSRADVKANGIYNISARKVVQKTQLSADD
ASCEDIADFDRLKKNREKKGLFDVKEVLSFFHKKSAHDLAAIAVTSSLAE
SRSDGFGGSHGNLSTLGNISPVFNKQNKKQSLYPHDNKSSTSSSSKHGSH
PATDQIKRWEYSLEHLLADRYGLALFNAFLKTEYSDENLEFWMACESYKS
LSGQKKLYKEAQKIYSQHLSVQAPREVNLDSKTRLQTISSLGTPSKMTFD
SAQKRIFALMEKDSYPRFLRSDIYQIVYRESMGYGHRNSCVDQLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0008277regulation of G-protein coupled receptor protein signaling pathway
GO:0009968negative regulation of signal transduction
GO:0043547positive regulation of GTPase activity
GO:0000188inactivation of MAPK activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036305RGS_sf
IPR016137RGS
IPR024066RGS_subdom1/3
Vocabulary: molecular function
TermDefinition
GO:0005096GTPase activator activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016137RGS domainPRINTSPR01301RGSPROTEINcoord: 260..283
score: 41.3
coord: 209..230
score: 42.29
coord: 231..249
score: 57.44
coord: 302..321
score: 64.67
IPR016137RGS domainSMARTSM00315RGS_3coord: 212..328
e-value: 1.2E-41
score: 154.3
IPR016137RGS domainPFAMPF00615RGScoord: 212..325
e-value: 1.7E-33
score: 115.4
IPR016137RGS domainPROSITEPS50132RGScoord: 212..324
score: 32.426
IPR024066RGS, subdomain 1/3GENE3DG3DSA:1.10.196.10coord: 309..331
e-value: 1.7E-6
score: 29.7
IPR024066RGS, subdomain 1/3GENE3DG3DSA:1.10.196.10coord: 202..238
e-value: 4.4E-11
score: 44.4
NoneNo IPR availableGENE3DG3DSA:1.10.167.10coord: 239..308
e-value: 2.4E-30
score: 107.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 178..201
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..38
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 178..200
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..18
NoneNo IPR availablePANTHERPTHR10845:SF242NOVEL PROTEIN SIMILAR TO VERTEBRATE REGULATOR OF G-PROTEIN SIGNALLING FAMILY-RELATEDcoord: 174..330
NoneNo IPR availablePANTHERPTHR10845REGULATOR OF G PROTEIN SIGNALINGcoord: 174..330
IPR036305RGS domain superfamilySUPERFAMILYSSF48097Regulator of G-protein signaling, RGScoord: 203..325