Kinase-like domain-containing protein

Overview
NameKinase-like domain-containing protein
Smed IDSMED30026449
Length (bp)2284
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Kinase-like domain-containing protein (SMED30026449) t-SNE clustered cells

Violin plots show distribution of expression levels for Kinase-like domain-containing protein (SMED30026449) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Kinase-like domain-containing protein (SMED30026449) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Kinase-like domain-containing protein (SMED30026449) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026449

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026449SMESG000074921.1 SMESG000074915.1 dd_Smed_v4_1634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026449SMESG000074921.1 SMESG000074915.1 dd_Smed_v4_1634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026449SMESG000074921.1 SMESG000074915.1 dd_Smed_v4_1634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026449SMESG000074921.1 SMESG000074915.1 dd_Smed_v4_1634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026449SMESG000074921.1 SMESG000074915.1 dd_Smed_v4_1634_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026449SMESG000074921.1 SMESG000074915.1 dd_Smed_v4_1634_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: STK3 (serine/threonine kinase 3 [Source:HGNC Symbol;Acc:HGNC:11406])

HSP 1 Score: 118.627 bits (296), Expect = 1.730e-27
Identity = 77/243 (31.69%), Postives = 126/243 (51.85%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   46 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKN 280          
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: STK3 (serine/threonine kinase 3 [Source:HGNC Symbol;Acc:HGNC:11406])

HSP 1 Score: 119.013 bits (297), Expect = 1.801e-27
Identity = 77/243 (31.69%), Postives = 126/243 (51.85%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   74 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKN 308          
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 117.087 bits (292), Expect = 4.346e-27
Identity = 75/241 (31.12%), Postives = 124/241 (51.45%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            + ET + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD    F++ CL+ +PE+R T  QLL++ F+
Sbjct:   49 HKETGQIVAIKQVPVESDL-----QEIIKEISIMQQCD-SPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDNFTDFVKQCLVKSPEQRATATQLLQHPFV 281          
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 117.087 bits (292), Expect = 5.484e-27
Identity = 76/242 (31.40%), Postives = 125/242 (51.65%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPAR-YSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            + ET + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  +  TD +    +V     + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD    F++ CL+ +PE+R T  QLL++ F+
Sbjct:   49 HKETGQIVAIKQVPVESDL-----QEIIKEISIMQQCD-SPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDNFTDFVKQCLVKSPEQRATATQLLQHPFV 281          
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Match: STK24 (serine/threonine kinase 24 [Source:HGNC Symbol;Acc:HGNC:11403])

HSP 1 Score: 105.916 bits (263), Expect = 1.712e-23
Identity = 74/258 (28.68%), Postives = 127/258 (49.22%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            I K  F ++  G  N T++ + IK    + ++     +    +  +  +SQ    +V K  G Y  +  L+  MEY+   S L+ ++   PL E +I+   R+IL+GL YLH    IH +I+  N+++   G++KL  F ++  + +T  +  N  V    + APE+       S ADIWS G   I +  G  P+  L   +V+  I K++  +        S  LK F++ CL   P  RPT ++LL+++FI  ++
Sbjct:   42 IGKGSFGEVFKGIDNRTQKVVAIK----IIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPG-PLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLE---GNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNA 290          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: cst-2 (Caenorhabditis STE20-like kinase [Source:UniProtKB/TrEMBL;Acc:Q304D8])

HSP 1 Score: 114.005 bits (284), Expect = 9.723e-27
Identity = 77/243 (31.69%), Postives = 125/243 (51.44%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+   + IKK  + +++     ++IIKE+S+ Q   +S+  VK  G YF  + L+  MEY  A S+ + ++ +  PL E +IS   R  L+GL+YLH    IH +I+  NI+++  G  KL  F ++  + +T     N  +    + APE+ ++ G  + ADIWS G   I +  G  PY  +     +  I      +F  P    S E   F+++CLI  PE+R T  +L E+ FI N
Sbjct:   54 HRESGHVLAIKKVPVDTDL-----QEIIKEISIMQ-QCKSKYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEE-WSSEFNDFIRSCLIKKPEERKTALRLCEHTFIKN 288          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 114.39 bits (285), Expect = 1.540e-26
Identity = 78/244 (31.97%), Postives = 126/244 (51.64%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARY-SAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+   + IKK  + +++     ++IIKE+S+ Q  + S+  VK  G YF  + L+  MEY  A S+ + ++ +  PL E +IS   R  L+GL+YLH    IH +I+  NI+++  G  KL  F ++  +  TD +    +V    +  APE+ ++ G  + ADIWS G   I +  G  PY  +     +  I      +F  P    S E   F+++CLI  PE+R T  +L E+ FI N
Sbjct:   54 HRESGHVLAIKKVPVDTDL-----QEIIKEISIMQQCK-SKYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEE-WSSEFNDFIRSCLIKKPEERKTALRLCEHTFIKN 288          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 114.39 bits (285), Expect = 1.671e-26
Identity = 78/244 (31.97%), Postives = 126/244 (51.64%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARY-SAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+   + IKK  + +++     ++IIKE+S+ Q  + S+  VK  G YF  + L+  MEY  A S+ + ++ +  PL E +IS   R  L+GL+YLH    IH +I+  NI+++  G  KL  F ++  +  TD +    +V    +  APE+ ++ G  + ADIWS G   I +  G  PY  +     +  I      +F  P    S E   F+++CLI  PE+R T  +L E+ FI N
Sbjct:   54 HRESGHVLAIKKVPVDTDL-----QEIIKEISIMQQCK-SKYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEE-WSSEFNDFIRSCLIKKPEERKTALRLCEHTFIKN 288          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 102.064 bits (253), Expect = 3.854e-22
Identity = 78/256 (30.47%), Postives = 123/256 (48.05%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMS--VFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            I +  F ++  G  N T   + IK       I+LE  +D I+++   +  +SQ   Q+V K  G +   + L+  MEY+   S L+  K    L E+ I++  R+IL+GL YLH    IH +I+  N++V   G +K+  F ++  + ET    I +   P  + APE+         ADIWS G   I +  G  P+  L    V+  I K+         S  S   K F++ CL  +PE RP+   LL+++FI
Sbjct:   40 IGRGSFGEVYKGIDNRTGRVVAIKI------IDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGK-LDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPF-WMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQ--GSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 285          
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Match: gck-1 (Germinal center kinase 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L099])

HSP 1 Score: 101.679 bits (252), Expect = 4.886e-22
Identity = 78/256 (30.47%), Postives = 123/256 (48.05%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMS--VFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            I +  F ++  G  N T   + IK       I+LE  +D I+++   +  +SQ   Q+V K  G +   + L+  MEY+   S L+  K    L E+ I++  R+IL+GL YLH    IH +I+  N++V   G +K+  F ++  + ET    I +   P  + APE+         ADIWS G   I +  G  P+  L    V+  I K+         S  S   K F++ CL  +PE RP+   LL+++FI
Sbjct:   25 IGRGSFGEVYKGIDNRTGRVVAIKI------IDLEQAEDEIEDIQQEIQVLSQCDSQYVTKYFGSFLKGSKLWIIMEYLGGGSALDLTKSGK-LDESHIAVILREILKGLEYLHSERKIHRDIKAANVLVSEHGDVKVADFGVAGQLTETVKKRITFVGSPF-WMAPELIKQSSYDYKADIWSLGITAIELANGEPPHSDLHPMRVLFLIPKNPPPVLQ--GSQWSKPFKEFVEMCLNKDPENRPSASTLLKHQFI 270          
BLAST of Kinase-like domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0331920)

HSP 1 Score: 105.531 bits (262), Expect = 4.224e-23
Identity = 77/257 (29.96%), Postives = 127/257 (49.42%), Query Frame = 3
Query: 1416 DYFFQLLPGEYNETREKILIKKYSLLS--EINLESQ-KDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARY-SAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            D  ++L  G Y    + +  +  S+++   + +ES   +IIKE+S+ Q    S   V+  G YF +  L+  MEY  A S+ + ++ +   L E++I+      L+GL YLH    IH +I+  NI+++ +G  KL  F ++  +  TD +    +V    +  APE+ ++ G    ADIWS G   + +  G  PY  +     +  I +    SF  P    S E   F+  CL+  P+ R T  +LLE+EFI N
Sbjct:   43 DIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEISIMQQCD-SPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDR-WSTEFIDFVSKCLVKEPDDRATATELLEHEFIRN 295          
BLAST of Kinase-like domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0086500)

HSP 1 Score: 105.531 bits (262), Expect = 4.224e-23
Identity = 77/257 (29.96%), Postives = 127/257 (49.42%), Query Frame = 3
Query: 1416 DYFFQLLPGEYNETREKILIKKYSLLS--EINLESQ-KDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARY-SAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            D  ++L  G Y    + +  +  S+++   + +ES   +IIKE+S+ Q    S   V+  G YF +  L+  MEY  A S+ + ++ +   L E++I+      L+GL YLH    IH +I+  NI+++ +G  KL  F ++  +  TD +    +V    +  APE+ ++ G    ADIWS G   + +  G  PY  +     +  I +    SF  P    S E   F+  CL+  P+ R T  +LLE+EFI N
Sbjct:   43 DIMYKLGEGSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEISIMQQCD-SPYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDR-WSTEFIDFVSKCLVKEPDDRATATELLEHEFIRN 295          
BLAST of Kinase-like domain-containing protein vs. Ensembl Fly
Match: GckIII (gene:FBgn0266465 transcript:FBtr0083399)

HSP 1 Score: 100.138 bits (248), Expect = 1.808e-21
Identity = 74/256 (28.91%), Postives = 122/256 (47.66%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMS--VFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            I K  F ++  G  N T++ + IK       I+LE  +D I ++   +  +SQ    +V K  G +     L+  MEY+   S L+ +K  S  +E  I +  R++L+GL YLH    +H +I+  N+++  +G +KL  F ++  +  T      +   P  + APE+       + ADIWS G   I +  G  P   L    V+  I K++       T   +   K F++ CL  +PE RPT ++LL+  FI
Sbjct:   19 IGKGSFGEVFKGIDNRTQQVVAIKI------IDLEEAEDEIDDIQQEIMVLSQCDSPYVTKYYGSFLKGTKLWIIMEYLGGGSALDLMKAGS-FEEMHIGIILREVLKGLDYLHSERKLHRDIKAANVLLSEQGDVKLADFGVAGQLTNTTSKRNTFVGTPF-WMAPEVIKQSQYDAKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPQL---TGSYTKSFKDFVEACLNKDPENRPTAKELLKYPFI 263          
BLAST of Kinase-like domain-containing protein vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0074839)

HSP 1 Score: 93.2041 bits (230), Expect = 2.525e-19
Identity = 63/220 (28.64%), Postives = 109/220 (49.55%), Query Frame = 3
Query: 1509 ESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQK-DHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
             +QK+   +      S      VK    + D   +Y  +E  +  SM+E  K+   + E +   +  QI++G++YLH N +IH +++  N+ +++   +K+  F ++  I E +G           Y APEI   +G +   DIWS G V+  ++ G  P+ET +  +   +I+K ++R+  S+   P +D + A LQ     NPE RP   QLL  EF+
Sbjct:   64 HNQKEKTAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSITEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRI-EYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEYRVP-SYLRKPAADMVIAMLQP----NPESRPAIGQLLNFEFL 277          
BLAST of Kinase-like domain-containing protein vs. Ensembl Fly
Match: polo (gene:FBgn0003124 transcript:FBtr0100318)

HSP 1 Score: 93.2041 bits (230), Expect = 2.525e-19
Identity = 63/220 (28.64%), Postives = 109/220 (49.55%), Query Frame = 3
Query: 1509 ESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQK-DHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
             +QK+   +      S      VK    + D   +Y  +E  +  SM+E  K+   + E +   +  QI++G++YLH N +IH +++  N+ +++   +K+  F ++  I E +G           Y APEI   +G +   DIWS G V+  ++ G  P+ET +  +   +I+K ++R+  S+   P +D + A LQ     NPE RP   QLL  EF+
Sbjct:   64 HNQKEKTAQEITIHRSLNHPNIVKFHNYFEDSQNIYIVLELCKKRSMMELHKRRKSITEFECRYYIYQIIQGVKYLHDNRIIHRDLKLGNLFLNDLLHVKIGDFGLATRI-EYEGERKKTLCGTPNYIAPEILTKKGHSFEVDIWSIGCVMYTLLVGQPPFETKTLKDTYSKIKKCEYRVP-SYLRKPAADMVIAMLQP----NPESRPAIGQLLNFEFL 277          
BLAST of Kinase-like domain-containing protein vs. Ensembl Zebrafish
Match: stk3 (serine/threonine kinase 3 (STE20 homolog, yeast) [Source:NCBI gene;Acc:324125])

HSP 1 Score: 119.398 bits (298), Expect = 6.609e-28
Identity = 76/243 (31.28%), Postives = 125/243 (51.44%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ NPE+R T  QLL++ FI  
Sbjct:   45 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEH-WSDDFTDFVKKCLVKNPEQRATATQLLQHPFIVG 279          
BLAST of Kinase-like domain-containing protein vs. Ensembl Zebrafish
Match: stk3 (serine/threonine kinase 3 (STE20 homolog, yeast) [Source:NCBI gene;Acc:324125])

HSP 1 Score: 119.398 bits (298), Expect = 6.609e-28
Identity = 76/243 (31.28%), Postives = 125/243 (51.44%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ NPE+R T  QLL++ FI  
Sbjct:   45 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEH-WSDDFTDFVKKCLVKNPEQRATATQLLQHPFIVG 279          
BLAST of Kinase-like domain-containing protein vs. Ensembl Zebrafish
Match: stk24a (serine/threonine kinase 24a (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-070424-52])

HSP 1 Score: 105.145 bits (261), Expect = 1.285e-23
Identity = 83/283 (29.33%), Postives = 137/283 (48.41%), Query Frame = 3
Query: 1332 DIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            ++ +D    F  LER          I K  F ++  G  N T++ + IK   L  E   +  +DI +E++V  +SQ    F+ K  G Y  +  L+  MEY+   S L+ +   + L E  I+   R+IL+GL YLH    IH +I+  N+++  +G +KL  F ++  + +T  +  N  V    + APE+       S ADIWS G   I +  G  P+  L   +V+  I K++  +        +  LK F+  CL  +P  RPT ++LL+++ I  +S
Sbjct:    8 NLKLDPEKLFTKLER----------IGKGSFGEVFKGIDNRTQKVVAIKIIDL--EEAEDEVEDIQQEITV--LSQCDSLFITKYFGSYLKDTKLWIIMEYLGGGSALDLLGPGA-LDETHIATILREILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSEYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKENPPTLE---GNYNKALKEFVDACLNKDPNFRPTAKELLKHKLIVRYS 271          
BLAST of Kinase-like domain-containing protein vs. Ensembl Zebrafish
Match: stk25b (serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-GENE-040426-2537])

HSP 1 Score: 104.375 bits (259), Expect = 2.707e-23
Identity = 77/260 (29.62%), Postives = 125/260 (48.08%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPT--SPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            I K  F ++  G  N T+E + IK    + ++     +    +  +  +SQ    +V K  G Y     L+  MEY+   S L+ +K   PL+E  I+   R+IL+GL YLH    IH +I+  N+++  +G +KL  F ++  + +T  +  N  V    + APE+         ADIWS G   I +  G  P   L    V+  I K+     + PT     S   K F++ CL  +P  RPT ++LL+++FIT ++
Sbjct:   26 IGKGSFGEVYKGINNRTKEVVAIK----IIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKGTKLWIIMEYLGGGSALDLLKPG-PLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKN-----TPPTLEGSYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYT 274          
BLAST of Kinase-like domain-containing protein vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 102.064 bits (253), Expect = 1.344e-22
Identity = 76/254 (29.92%), Postives = 125/254 (49.21%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            I K  F ++  G  N T++ + IK   L    +        +E++V  +SQ    FV K  G Y  +  L+  MEY+   S L+ ++  S L E +I+   R+IL+GL YLH    IH +I+  N+++  +G++KL  F ++  + +T  +  N  V    + APE+       S ADIWS G   I +  G  P+  L   +V+  I K++  +           LK F++ CL   P  RPT ++LL+++ I
Sbjct:   18 IGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQ--QEITV--LSQCDSPFVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGS-LDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLE---GNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLI 262          
BLAST of Kinase-like domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 122.094 bits (305), Expect = 6.034e-29
Identity = 79/243 (32.51%), Postives = 125/243 (51.44%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E +I+   R  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SDE   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   47 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQ-QCDSHYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDEFTDFVKKCLVKNPEQRATATQLLQHPFIKN 281          
BLAST of Kinase-like domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 122.865 bits (307), Expect = 6.759e-29
Identity = 79/243 (32.51%), Postives = 125/243 (51.44%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E +I+   R  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SDE   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   43 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SHYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDEFTDFVKKCLVKNPEQRATATQLLQHPFIKN 277          
BLAST of Kinase-like domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 122.479 bits (306), Expect = 8.178e-29
Identity = 79/243 (32.51%), Postives = 125/243 (51.44%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E +I+   R  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SDE   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   42 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SHYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDEFTDFVKKCLVKNPEQRATATQLLQHPFIKN 276          
BLAST of Kinase-like domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 122.479 bits (306), Expect = 8.207e-29
Identity = 79/243 (32.51%), Postives = 125/243 (51.44%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E +I+   R  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SDE   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   50 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SHYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDEFTDFVKKCLVKNPEQRATATQLLQHPFIKN 284          
BLAST of Kinase-like domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 122.479 bits (306), Expect = 8.763e-29
Identity = 79/243 (32.51%), Postives = 125/243 (51.44%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E +I+   R  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SDE   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   45 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SHYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDEFTDFVKKCLVKNPEQRATATQLLQHPFIKN 279          
BLAST of Kinase-like domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 117.857 bits (294), Expect = 2.256e-27
Identity = 76/243 (31.28%), Postives = 126/243 (51.85%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ +PE+R T  QLL++ FI N
Sbjct:   44 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDDFTDFVKKCLVKSPEQRATATQLLQHPFIKN 278          
BLAST of Kinase-like domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 117.857 bits (294), Expect = 2.280e-27
Identity = 76/243 (31.28%), Postives = 126/243 (51.85%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ +PE+R T  QLL++ FI N
Sbjct:   46 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDDFTDFVKKCLVKSPEQRATATQLLQHPFIKN 280          
BLAST of Kinase-like domain-containing protein vs. Ensembl Mouse
Match: Stk4 (serine/threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1929004])

HSP 1 Score: 116.316 bits (290), Expect = 6.048e-27
Identity = 76/242 (31.40%), Postives = 125/242 (51.65%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPAR-YSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            + ET + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  +  TD +    +V     + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD    F++ CL+ +PE+R T  QLL++ F+
Sbjct:   49 HKETGQIVAIKQVPVESDL-----QEIIKEISIMQQCD-SPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDNFMDFVKQCLVKSPEQRATATQLLQHPFV 281          
BLAST of Kinase-like domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 110.153 bits (274), Expect = 4.061e-25
Identity = 66/207 (31.88%), Postives = 106/207 (51.21%), Query Frame = 3
Query: 1554 SQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + +S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ +PE+R T  QLL++ FI N
Sbjct:    6 ASKSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDDFTDFVKKCLVKSPEQRATATQLLQHPFIKN 210          
BLAST of Kinase-like domain-containing protein vs. Ensembl Mouse
Match: Stk24 (serine/threonine kinase 24 [Source:MGI Symbol;Acc:MGI:2385007])

HSP 1 Score: 104.375 bits (259), Expect = 3.584e-23
Identity = 74/258 (28.68%), Postives = 127/258 (49.22%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            I K  F ++  G  N T++ + IK    + ++     +    +  +  +SQ    +V K  G Y  +  L+  MEY+   S L+ ++   PL E +I+   R+IL+GL YLH    IH +I+  N+++   G++KL  F ++  + +T  +  N  V    + APE+       S ADIWS G   I +  G  P+  L   +V+  I K++  +        S  LK F++ CL   P  RPT ++LL+++FI  ++
Sbjct:   30 IGKGSFGEVFKGIDNRTQKVVAIK----IIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPG-PLDEIQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSELHPMKVLFLIPKNNPPTLE---GNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFIIRNA 278          
BLAST of Kinase-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54PX0|Y4251_DICDI (Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284251 PE=3 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 1.690e-29
Identity = 84/254 (33.07%), Postives = 136/254 (53.54%), Query Frame = 3
Query: 1398 GNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARY-SAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLEN 2156
            G  I +  F Q+  G   +T E + IK+    ++I+  S + +  E+ +     +    VK+LG+   +A L   +EY+E  S+ + I+K  PL E    ++  Q+L+GL YLH N +IH +I+ +NI++  +G +KL  F ++  I     L   +SV    Y  APE  +  GC+SA+DIWS GS +I ++TG+ PY TL     + +I  D      FPT  +S E   + Q     +P +RPT Q+LL++
Sbjct:   39 GEKIGRGAFGQVFKGLNGKTGEFVAIKQIDS-NKIDESSLQSVKGEVEILH-KLRHNNIVKVLGVVEVQAQLNFILEYVENGSLRDVIEKFGPLSEELCIIYLYQMLQGLAYLHSNKVIHRDIKASNILITKEGVIKLADFGVASQIDSESQL--RFSVVGTPYWMAPESIEISGCSSASDIWSLGSTMIELLTGNPPYYTLQPMAAMFRIVSDQHP--PFPTD-ISKEFLDYFQQSFKKDPTQRPTAQELLQH 285          
BLAST of Kinase-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6IP06|STK3_XENLA (Serine/threonine-protein kinase 3 OS=Xenopus laevis OX=8355 GN=stk3 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 5.374e-28
Identity = 78/243 (32.10%), Postives = 126/243 (51.85%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   R  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    +DE   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   45 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SHYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WTDEFTDFVKKCLVKNPEQRATATQLLQHPFIKN 279          
BLAST of Kinase-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q802A6|STK4_SQUAC (Serine/threonine-protein kinase 3/4 OS=Squalus acanthias OX=7797 GN=STK4 PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.134e-27
Identity = 78/244 (31.97%), Postives = 127/244 (52.05%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPAR-YSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++N+G  KL  F ++  +  TD +    +V     + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    +DE   F++ CL+ NPE+R    QLL++ FI N
Sbjct:   51 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDLIRIRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNNEGHAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGISAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WTDEFTDFVKQCLVKNPEQRAAATQLLQHPFIKN 285          
BLAST of Kinase-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7ZUQ3|STK3_DANRE (Serine/threonine-protein kinase 3 OS=Danio rerio OX=7955 GN=stk3 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 4.989e-27
Identity = 76/243 (31.28%), Postives = 125/243 (51.44%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ NPE+R T  QLL++ FI  
Sbjct:   45 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEH-WSDDFTDFVKKCLVKNPEQRATATQLLQHPFIVG 279          
BLAST of Kinase-like domain-containing protein vs. UniProt/SwissProt
Match: sp|Q13188|STK3_HUMAN (Serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=STK3 PE=1 SV=2)

HSP 1 Score: 118.627 bits (296), Expect = 8.307e-27
Identity = 77/243 (31.69%), Postives = 126/243 (51.85%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   46 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKN 280          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: A0A1Y1Z103 (Kinase-like protein OS=Basidiobolus meristosporus CBS 931.73 OX=1314790 GN=K493DRAFT_206350 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.631e-26
Identity = 82/271 (30.26%), Postives = 134/271 (49.45%), Query Frame = 3
Query: 1398 GNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEI----NLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKK-NSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPA-----RYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSP--VSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNH 2174
            GN I K  F  +      E  + + +K+  +        +L ++ D++K +S         Q VK  G    E +LY  +EY+E  SML+ +K       E  +  +  +ILEGL YLH   ++H +++  NI+    G +KL  F +S+N+   +    N S  P       + APEI + +G ++A+DIWS G  ++ +VTG  PY  L     + +I +D       P  P  +SD+L+AFL  C   +P KRPT ++L  +E++  H
Sbjct:    2 GNRIGKGQFGIVYKALNLENGQMVAVKRMRIADHKEHIDSLMNEVDLLKSLS-------HPQIVKYEGSIRTEDSLYIVIEYVENGSMLKTLKDFGGRFPEKLVKKYTLKILEGLMYLHDREVVHCDLKAANILSTKNGNIKLTDFGVSLNLKLLESNLTNVSANPTVAGTPNWMAPEIIELQGASTASDIWSLGCTIVELVTGKPPYYDLMPLTALFRIVED-----DCPPLPENISDKLRAFLLQCFQKDPTKRPTARELYRHEWLAEH 260          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: W5MLC4 (Serine/threonine kinase 4 OS=Lepisosteus oculatus OX=7918 GN=STK4 PE=4 SV=1)

HSP 1 Score: 124.79 bits (312), Expect = 2.052e-26
Identity = 79/244 (32.38%), Postives = 131/244 (53.69%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPAR-YSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            Y ET E + IK+  + S++     ++IIKE+S+ Q    S   V+  G YF  + L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++++G+ KL  F ++  +  TD +    +V     + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P +  S+  + F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   52 YKETGEIVAIKQVPVESDL-----QEIIKEISIMQQCN-SPHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNSEGQAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRSPEA-WSEPFQDFVKQCLVKNPEQRTTATQLLQHPFIKN 286          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: G1NHW2 (Serine/threonine kinase 3 OS=Meleagris gallopavo OX=9103 GN=STK3 PE=4 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 2.252e-26
Identity = 78/243 (32.10%), Postives = 126/243 (51.85%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SDE   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   39 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQ-QCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDEFTDFVKKCLVKNPEQRATATQLLQHTFIKN 273          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: A0A452GII3 (Serine/threonine kinase 3 OS=Gopherus agassizii OX=38772 GN=STK3 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 2.679e-26
Identity = 78/243 (32.10%), Postives = 126/243 (51.85%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SDE   F++ CL+ NPE+R T  QLL++ FI N
Sbjct:   42 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQ-QCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDEFTDFVKKCLVKNPEQRATATQLLQHTFIKN 276          
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Match: A0A3B3QMW9 (Uncharacterized protein OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 3.301e-26
Identity = 80/242 (33.06%), Postives = 128/242 (52.89%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPAR-YSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            Y ET E + IK+  + S++     ++IIKE+S+ Q    S   V+  G YF  + L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++++G+ KL  F ++  +  TD +    +V     + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    S+ LK F+  CL+ NPE R T  QLL++ FI
Sbjct:   50 YKETGEIVAIKQVPVESDL-----QEIIKEISIMQQCN-SPHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATITQSTLKGLEYLHFMRKIHRDIKAGNILLNSEGQAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRSPDR-WSEPLKDFVAQCLVKNPENRATATQLLQHPFI 282          
BLAST of Kinase-like domain-containing protein vs. Ensembl Cavefish
Match: stk3 (serine/threonine kinase 3 [Source:NCBI gene;Acc:103027492])

HSP 1 Score: 120.168 bits (300), Expect = 2.777e-28
Identity = 77/243 (31.69%), Postives = 127/243 (52.26%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ NPE+R T  QLL++ FIT+
Sbjct:   45 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDDFTDFVKKCLVKNPEQRATATQLLQHPFITS 279          
BLAST of Kinase-like domain-containing protein vs. Ensembl Cavefish
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 117.472 bits (293), Expect = 1.455e-27
Identity = 76/240 (31.67%), Postives = 124/240 (51.67%), Query Frame = 3
Query: 1440 GEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPAR-YSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLE 2153
              Y ET E + IK+  + S++     ++IIKE+S+ Q    S   V+  G YF  + L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++++G+ KL  F ++  +  TD +    +V     + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    S+  + F+  CL+ NPE R T  QLL+
Sbjct:   50 AHYKETGEIVAIKQVPVESDL-----QEIIKEISIMQQCN-SPHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRQRNKTLAEDEIAAILQSTLKGLEYLHFMRKIHRDIKAGNILLNSEGQAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDQ-WSEPFRDFVSQCLVKNPENRATATQLLQ 280          
BLAST of Kinase-like domain-containing protein vs. Ensembl Cavefish
Match: stk25a (serine/threonine-protein kinase 25 [Source:NCBI gene;Acc:103021644])

HSP 1 Score: 108.997 bits (271), Expect = 6.595e-25
Identity = 81/293 (27.65%), Postives = 137/293 (46.76%), Query Frame = 3
Query: 1302 LKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            + + + +++ +  +D    F  LER          I K  F ++  G  N T+E + IK    + ++     +    +  +  +SQ    FV K  G Y     L+  MEY+   S L+ +K   PL+E  I+   R+IL+GL YLH    IH +I+  N+++   G++KL  F ++  + +T  +  N  V    + APE+         ADIWS G   I +  G  P   L    V+  I K++  +        S   K F++ CL  +P  RPT ++LL+++FIT ++
Sbjct:    1 MAHLRGIHNQNTRLDPEQYFTKLER----------IGKGSFGEVYKGINNRTKEVVAIK----IIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYFGSYLKSTKLWIIMEYLGGGSALDMLKPG-PLEEAYIATILREILKGLDYLHSERKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPTLE---GSYSKAFKDFVEACLNKDPRFRPTAKELLKHKFITRYT 274          
BLAST of Kinase-like domain-containing protein vs. Ensembl Cavefish
Match: stk24b (serine/threonine-protein kinase 24-like [Source:NCBI gene;Acc:103028447])

HSP 1 Score: 106.686 bits (265), Expect = 2.965e-24
Identity = 77/258 (29.84%), Postives = 127/258 (49.22%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            I K  F ++  G  N T++ + IK   L    +        +E++V  +SQ    FV K  G Y     L+  MEY+   S L+ ++  + L E +I+   R+IL+GL YLH    IH +I+  N+++  +G++KL  F ++  + +T  +  N  V    + APE+       S ADIWS G   I +  G  P+  L   +V+  I K++  +        S  LK F++ CL   P  RPT ++LL+++ I  H+
Sbjct:    3 IGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQ--QEITV--LSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGSALDLLEPGA-LDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLE---GNYSKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRHA 251          
BLAST of Kinase-like domain-containing protein vs. Ensembl Cavefish
Match: stk24b (serine/threonine-protein kinase 24-like [Source:NCBI gene;Acc:103028447])

HSP 1 Score: 106.686 bits (265), Expect = 4.702e-24
Identity = 77/258 (29.84%), Postives = 127/258 (49.22%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            I K  F ++  G  N T++ + IK   L    +        +E++V  +SQ    FV K  G Y     L+  MEY+   S L+ ++  + L E +I+   R+IL+GL YLH    IH +I+  N+++  +G++KL  F ++  + +T  +  N  V    + APE+       S ADIWS G   I +  G  P+  L   +V+  I K++  +        S  LK F++ CL   P  RPT ++LL+++ I  H+
Sbjct:   30 IGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQ--QEITV--LSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGSALDLLEPGA-LDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLE---GNYSKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRHA 278          
BLAST of Kinase-like domain-containing protein vs. Ensembl Sea Lamprey
Match: map3k19 (mitogen-activated protein kinase kinase kinase 19 [Source:ZFIN;Acc:ZDB-GENE-081104-140])

HSP 1 Score: 100.523 bits (249), Expect = 1.098e-23
Identity = 67/272 (24.63%), Postives = 126/272 (46.32%), Query Frame = 3
Query: 1392 ITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSE--------QFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFN------ISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            I GN + K  F  +  G  N+ +  I +K+  L    +    +   K+  + ++  + E          V+ LG   +       ME++   ++ E ++   PL E+    +  Q+  GL YLH + ++HG+++ +N V+   G +KL+ F       ++++ +E  GL   +    A + APE+ +  G    AD+WS G  L  +  G  P+  ++    ++ I   + I    P +  S E + F++ C I +  KRP+ Q+LL + FI
Sbjct:   16 IKGNRLGKGAFGTVFLGLTNQGK-LIAVKELELRDAQSANGNQGGQKQSELQKLQDEVELLTTLHHPNVVEYLGTEMEGNRFSIFMEFVPGGTVAETVRGFGPLGESVCRSYIAQMTRGLAYLHGHGVMHGDVKGSNAVITPAGVVKLIDFGCAQRVALALSCHENGGLHSVHGT--AYWMAPEVINGTGYARRADVWSLGCTLHEMAVGRPPFADMAPMAALLHIGIRNGIMPGLPQA-FSKEAQEFVEQCFIRDKLKRPSSQELLSHPFI 283          
BLAST of Kinase-like domain-containing protein vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 97.0561 bits (240), Expect = 1.346e-21
Identity = 74/256 (28.91%), Postives = 123/256 (48.05%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIR--PTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            I K  F ++  G  N T+E + IK    + ++     +    +  +  +SQ    +V    G Y     L+  MEY+   S L+ IK   PL+E++I+   R+IL+GL YLH    IH +I+    N+++  +G +KL  F ++  + +T  +  N  V    + APE+         ADIWS G   I +  G  P   L    V+  I K++  +        S   K F+ +CL  +P+ RPT ++LL+++FI
Sbjct:   32 IGKGSFGEVFKGIDNRTKEVVAIK----IIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIKPG-PLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKNNPPTLE---GNYSKAFKEFVDSCLNKDPQFRPTAKELLKHKFI 278          
BLAST of Kinase-like domain-containing protein vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 95.5153 bits (236), Expect = 8.207e-21
Identity = 64/209 (30.62%), Postives = 112/209 (53.59%), Query Frame = 3
Query: 1560 QSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK--KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVT-GSQPYETLSESEVVIQIQKDHRISFSFPTSPVSD----ELKAFLQNCLIYNPEKRPT---CQQLLEN 2156
            Q ++ V+L  +  DE  ++   EY+E  S+L+F+K  + S LK+ K+   C Q+ EG+ ++   N IH ++R  NI+V+     K+  F ++  I + +      + FP +++APE  +    +  +D+WSFG +L  +VT G  PY  ++  EV+  +++ +R+       P  D    EL + +Q C    PE+RPT    Q LLE+
Sbjct:  298 QHDKLVRLHAVVTDEP-IFIVTEYMEKGSLLDFLKTSEGSRLKQPKMIDMCAQVAEGMAFIEDKNYIHRDLRAANILVNVNLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEMVTFGRIPYPGMTNPEVIRSLERGYRM-------PKPDNCPCELYSIMQECWRQKPEERPTFEYLQSLLED 498          
BLAST of Kinase-like domain-containing protein vs. Ensembl Sea Lamprey
Match: clul1 (clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GENE-031118-57])

HSP 1 Score: 94.7449 bits (234), Expect = 1.082e-20
Identity = 97/379 (25.59%), Postives = 168/379 (44.33%), Query Frame = 3
Query: 1086 NTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYD-YDIDMDS---SLSF---CFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSP--LKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVT-GSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPT---CQQLLENEFITNHS*Y 2183
             T  +YSL   DW ++         I+ L D+   Y  + + FD+++ L +++++        L L       + Q    D +++  DS    L     CF E W+G   T N   K     L PG              ++  E  LE +  I+K++       + ++ V+L  +   E  +Y   E++   S+L+F+K+     LK  ++     QI  G+ Y+   N IH ++R  NI+V +    K+  F ++  I + +      + FP +++APE       T  +D+WSFG +L  +VT G  PY  +   EV+ Q+++ +R+    P+ P S  L   +  C   +PE+RPT    Q  LE+ F      Y
Sbjct:  119 TTKGAYSLSIRDWDEVKGDNVKHYKIRKL-DNGGYYITTRAQFDTLQKLVQHYSEHADGLCYKLTLVCPNEKPQTQGLARDAWEMPRDSLKLELKLGQGCFGEVWAG---TWNGTTKVAIKTLKPG--------------TMSPEAFLE-EAQIMKKL-------RHDKLVQLYAV-VSEEPIYIVTEFMSKGSLLDFLKEGDGRYLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDNLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAAMFGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCP-PSCPES--LHELMMQCWKKDPEERPTFEYLQAFLEDYFTATEPQY 467          
BLAST of Kinase-like domain-containing protein vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 92.4337 bits (228), Expect = 1.965e-19
Identity = 69/209 (33.01%), Postives = 104/209 (49.76%), Query Frame = 3
Query: 1572 FVKLLGIYFDEAALYAEMEYIEAVS----MLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSA-----ADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
             V LL  ++ E  L+  +E+    +    MLE  +    L E +I + C+Q+LE L YLH + +IH +++  NI++  +G +KL  F +S     T     ++   P  + APE+   E    A     ADIWS G  LI +     P   L+   V+++I K+   S SFP S  S E   FL+ CL  NPE R    QLL++ FI+ 
Sbjct:   90 IVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERG---LAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQRRDSFIGTPY-WMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKNDPPSLSFP-SKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFISG 293          
BLAST of Kinase-like domain-containing protein vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 109.768 bits (273), Expect = 4.363e-25
Identity = 69/222 (31.08%), Postives = 115/222 (51.80%), Query Frame = 3
Query: 1503 NLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSP-LKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            N E   DI+ E+S+ + +      VK  G       LY  +EY    S+   I ++S  L EN+   +  Q L GL+YLH   +IH +I+  NI++     +KL  F +S  I  +  L +  ++    + APEI  + G ++ +DIWS G+ ++ ++T + PY  L+++ +   ++ D      +P S  S+ LK FL  C + N  KRPT  QLL++ +I
Sbjct:   60 NDEELNDIMAEISLLK-NLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVST-IVNSSALTLAGTL---NWMAPEILGNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVENDTY----YPPSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWI 272          
BLAST of Kinase-like domain-containing protein vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 97.0561 bits (240), Expect = 2.877e-21
Identity = 70/246 (28.46%), Postives = 122/246 (49.59%), Query Frame = 3
Query: 1461 EKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYF-DEAALYAEMEYIEAVSMLEFI---------KKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFIT 2168
            E++ IK+  L  +     ++ I+ E+ V   S+Q E  V  L  Y  D+  L+  MEY+E   + + +         + +SPL EN+++   ++  +GL++LH   +IH +I+  NI+++++G +K+  F   V + E           P  + APEI + +G     D+WS G +LI ++ G  PY      + +  I  +       P S VS + K FL  CL  N E R + ++LL  EF++
Sbjct:  401 ERVAIKQIRLSEQ---PKKQLIMNELLVMNDSRQ-ENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPY-WMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPES-VSKQTKQFLDACLQVNVESRASVRKLLTFEFLS 640          
BLAST of Kinase-like domain-containing protein vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 96.2857 bits (238), Expect = 5.404e-21
Identity = 65/230 (28.26%), Postives = 114/230 (49.57%), Query Frame = 3
Query: 1506 LESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNIS-----VNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSP--VSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNH 2174
            L+ + +++KE+         E  V   G   +   L   +EY+   S+   +    P +E+ I+ + RQIL G+ YLH  N+IH +I+  NI++D KG +K+  F IS     +N  +     +  SVF   + +PE+      T+ ADIWS G V+I + TG  P+   S+ + + +I  +     + P  P   + E K FL+     + + RP+  +LL++ ++  H
Sbjct:  501 LQHEMNLLKEL-------HHENIVTYYGASQEGGNLNIFLEYVPGGSVSSMLNNYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVF---WMSPEVVKQTATTAKADIWSTGCVVIEMFTGKHPFPDFSQMQAIFKIGTN-----TTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQHPWLDAH 715          
BLAST of Kinase-like domain-containing protein vs. Ensembl Yeast
Match: PKH2 (Serine/threonine protein kinase; involved in sphingolipid-mediated signaling pathway that controls endocytosis; activates Ypk1p and Ykr2p, components of signaling cascade required for maintenance of cell wall integrity; contains a PH-like domain; redundant with Pkh1p; PKH2 has a paralog, PKH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005460])

HSP 1 Score: 94.7449 bits (234), Expect = 2.148e-20
Identity = 66/221 (29.86%), Postives = 111/221 (50.23%), Query Frame = 3
Query: 1533 EMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFF---------NISVNIYETDGLFINYS-VFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSF-PTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEF 2162
            E +  Q    S   V+L   + DE++LY  +EY      L  +KK   L E     +  QI++ + YLH N +IH +I+P NI++D + K+KL  F         N SV+  E D    + S V  A Y +PE+ +D       DIW+FG +L  ++ G  P++  +E    +  QK  ++ ++F P  P+   ++  ++  L+ N ++R T  Q+ E+ F
Sbjct:  227 EKTALQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGSLDETCARYYAAQIIDAIDYLHSNGIIHRDIKPENILLDGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLSTRSKSFVGTAEYVSPELLNDSFTDYRCDIWAFGCILFQMIAGKPPFKATNE---YLTFQKVMKVQYAFTPGFPLI--IRDLVKKILVKNLDRRLTISQIKEHHF 442          
BLAST of Kinase-like domain-containing protein vs. Ensembl Yeast
Match: MKK2 (MAPKK involved in the protein kinase C signaling pathway; involved in control of cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk1p; MKK2 has a paralog, MKK1, that arose from the whole genome duplication [Source:SGD;Acc:S000006061])

HSP 1 Score: 91.2781 bits (225), Expect = 9.212e-20
Identity = 63/241 (26.14%), Postives = 116/241 (48.13%), Query Frame = 3
Query: 1509 ESQKDIIKEMSVFQISQQSEQFVKLLGIYFDE--AALYAEMEYIEAVSM----LEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVI-------------QIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNH 2174
            E QK I +E+  F  S +S+  V+  G++ DE  +++Y  MEY+   S+       +K+   + E  I      +L GL YLH   +IH +I+P NI+++ KG++KL  F +S     +  +    + F   Y APE    +  +   D+WS G  L+ +  G  P+E+   ++ V              Q++ +  +  S+     S   ++F+  CL  +  +RP+ +Q+L++ +I   
Sbjct:  253 EYQKQIFRELQ-FNKSFKSDYIVQYYGMFTDEQSSSIYIAMEYMGGKSLEATYKNLLKRGGRISERVIGKIAESVLRGLSYLHERKVIHRDIKPQNILLNEKGEIKLCDFGVSGEAVNSLAMTFTGTSF---YMAPERIQGQPYSVTCDVWSLGLTLLEVAGGRFPFESDKITQNVAPIELLTMILTFSPQLKDEPELDISW-----SKTFRSFIDYCLKKDARERPSPRQMLKHPWIVGQ 484          
BLAST of Kinase-like domain-containing protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 110.538 bits (275), Expect = 1.635e-26
Identity = 73/243 (30.04%), Postives = 122/243 (50.21%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + +++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + +K +N  L E +I    +  L+GL YLH    IH +I+  NI+++++G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   + +  G  PY  +     +  I      +F  P    S++ K F+  CL+ NPE+R T  +LL++ FI  
Sbjct:   43 HKESGQVVAIKQVPVDTDL-----QEIIKEISMMQ-QCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQ-WSEDFKDFVSKCLVKNPEERATATELLQHSFIQG 277          
BLAST of Kinase-like domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 103.219 bits (256), Expect = 2.004e-24
Identity = 67/217 (30.88%), Postives = 107/217 (49.31%), Query Frame = 3
Query: 1545 FQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARY-SAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSP-----VSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            F  + ++E+ V+  GI  D+  +Y  MEY+   S+ E IK++  L E+    + RQILEG+ YLH N ++H +I+  NI+ D  G +KL  F  S  +          SV    Y  APE+ + EG    AD+WS G  ++ ++T   P+        + +I          PT P     +S +   F+++ L  N + RP+  +LL   F+TN S
Sbjct:   57 FMKAFRNERIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQ-------PTEPELPSDLSVDAVEFVRSTLRMNSKSRPSADELLRFSFVTNSS 266          
BLAST of Kinase-like domain-containing protein vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 93.9745 bits (232), Expect = 1.739e-20
Identity = 71/254 (27.95%), Postives = 117/254 (46.06%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            I K  F ++  G  N T E + IK    + ++     +    +  +  +SQ    +V K  G Y     L+  MEY+   S L+ +K  + ++E  I+   R++L+GL YLH    +H +I+  N+++   G +KL  F ++  + +T      +   P  + APE+       S ADIWS G   I +  G  P   L    V+  I K++       T   S   K F+  CL  +P  RPT ++LL++ FI
Sbjct:   17 IGKGSFGEVFKGIDNRTNEVVAIK----IIDLEEAEDEIEDIQQEITVLSQCDSLYVTKYHGSYLKGTKLWIIMEYLGGGSALDLMKAGN-IEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPF-WMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNNPPEL---TGNFSKAFKEFVSLCLNKDPNDRPTAKELLKHRFI 261          
BLAST of Kinase-like domain-containing protein vs. Ensembl Nematostella
Match: EDO35743 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK8])

HSP 1 Score: 89.7373 bits (221), Expect = 2.350e-20
Identity = 61/204 (29.90%), Postives = 99/204 (48.53%), Query Frame = 3
Query: 1566 EQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSA---PEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSP----VSDELKAFLQNCLIYNPEKRPTCQQLLEN 2156
            E  VKL G    E  +   MEY++  S+  F+  N    E+ +    + ILE L +LH   ++H +++  N+++D+KG +KL  F  SV++ +T     N  + P    A   PE+   E    + DIWS    L  ++TG  P+   S   ++ Q+     I+   P  P     S E+K F+ +   + PE RPT  +LL+N
Sbjct:    2 ENVVKLYGAVQTEQKIIIFMEYMDGGSVEMFLSNNGSADEDSVKCVMQVILEALCWLHSKGVVHLDLKGGNVLMDSKGIVKLADFGASVHLDDTTTHTRN--IIPRGTEAFMSPEVCRSEPFGRSTDIWSAACTLYQMLTGEPPWMQYSGGSILYQVA----IATKPPGIPDSLECSQEIKDFMASMFSFVPEDRPTAAELLKN 199          
BLAST of Kinase-like domain-containing protein vs. Ensembl Nematostella
Match: EDO33652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRL3])

HSP 1 Score: 90.5077 bits (223), Expect = 6.538e-19
Identity = 55/198 (27.78%), Postives = 94/198 (47.47%), Query Frame = 3
Query: 1575 VKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFIT 2168
            V   G + DE   Y  +E     S+++ +K    L E ++  + +Q +E   YLH   +IH +I+  N  +++  +L+L  F ++V + + D   I        Y APE+   EG +   D W+ G V+  ++ G  P+ET S  E   +I+ +    ++ P S VSD     +Q  L  NPE RP    +  ++F  
Sbjct:   79 VGFHGSFQDEMNFYILLELCSRKSLVQMLKTRGKLTEPEVRFFMQQAIEACSYLHEQRVIHRDIKVGNFFINSNMELRLGDFGLAVRL-KPDEYKIRTMCGTPNYIAPEVLSKEGHSYEVDTWALGCVMYTMLVGHPPFETKSLRETYRRIRNN---DYTIP-SRVSDSAARLIQRMLHANPENRPKLSDIFSDDFFA 271          
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044704.1 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 119.013 bits (297), Expect = 5.605e-28
Identity = 77/241 (31.95%), Postives = 123/241 (51.04%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            Y ET E + IK+  + S++     ++IIKE+S+ Q    S   V+  G YF  + L+  MEY  A S+ + I+ +N  L E +I+      L+GL YLH+   IH +I+  NI+++ +G+ KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    S+  + F+  CL+ NPE R T  QLL++ FI
Sbjct:   52 YKETGEIVAIKQVPVESDL-----QEIIKEISIMQQCN-SPHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRIRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIKAGNILLNAEGQAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDL-WSENFRDFVSQCLVKNPENRATATQLLQHPFI 284          
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000024938.2 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 118.627 bits (296), Expect = 9.642e-28
Identity = 78/242 (32.23%), Postives = 124/242 (51.24%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPAR-YSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            Y ET E + IK+  + S++     ++IIKE+S+ Q    S   V+  G YF  + L+  MEY  A S+ + I+ +N  L E +I+      L+GL YLH+   IH +I+  NI+++ +G+ KL  F ++  +  TD +    +V     + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    S+  + F+  CL+ NPE R T  QLL++ FI
Sbjct:   52 YKETGEIVAIKQVPVESDL-----QEIIKEISIMQQCN-SPHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRIRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIKAGNILLNAEGQAKLADFGVAGQL--TDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDL-WSENFRDFVSQCLVKNPENRATATQLLQHPFI 284          
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Match: stk3 (serine/threonine-protein kinase 3 [Source:NCBI gene;Acc:101155570])

HSP 1 Score: 118.627 bits (296), Expect = 1.141e-27
Identity = 76/243 (31.28%), Postives = 126/243 (51.85%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITN 2171
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ NPE+R T  QLL++ FI+ 
Sbjct:   46 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDDFTDFVKKCLVKNPEQRATATQLLQHPFISQ 280          
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Match: stk3 (serine/threonine-protein kinase 3 [Source:NCBI gene;Acc:101155570])

HSP 1 Score: 118.627 bits (296), Expect = 1.153e-27
Identity = 76/242 (31.40%), Postives = 126/242 (52.07%), Query Frame = 3
Query: 1446 YNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIK-KNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFIT 2168
            + E+ + + IK+  + S++     ++IIKE+S+ Q    S   VK  G YF    L+  MEY  A S+ + I+ +N  L E++I+   +  L+GL YLH+   IH +I+  NI+++ +G  KL  F ++  + +T     N  +    + APE+  + G    ADIWS G   I +  G  PY  +     +  I  +   +F  P    SD+   F++ CL+ NPE+R T  QLL++ FI+
Sbjct:   49 HKESGQVVAIKQVPVESDL-----QEIIKEISIMQQCD-SPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKR-NTVIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEL-WSDDFTDFVKKCLVKNPEQRATATQLLQHPFIS 282          
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022068.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 109.768 bits (273), Expect = 2.514e-25
Identity = 77/258 (29.84%), Postives = 128/258 (49.61%), Query Frame = 3
Query: 1407 IEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFV-KLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            I K  F ++  G  N T++ + IK   L    +        +E++V  +SQ    F+ K  G Y     L+  MEY+   S L+ ++   PL E +I+   R+IL+GL YLH    IH +I+  N+++  +G++KL  F ++  + +T  +  N  V    + APE+       S ADIWS G   I +  G  P+  L   +V+  I K++  +        S  LK F++ CL  +P  RPT ++LL++ +I  H+
Sbjct:   28 IGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQ--QEITV--LSQCHSPFITKYFGSYLKSTKLWIIMEYLGGGSALDLLEPG-PLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTDTQ-IKRNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVLFLIPKNNPPTLE---GNYSKALKEFIEACLNKDPSFRPTAKELLKHRYIVKHA 276          
BLAST of Kinase-like domain-containing protein vs. Planmine SMEST
Match: SMESG000074921.1 (SMESG000074921.1)

HSP 1 Score: 1420.6 bits (3676), Expect = 0.000e+0
Identity = 714/719 (99.30%), Postives = 716/719 (99.58%), Query Frame = 3
Query:   21 MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSXXXXXXXXXXXXXXXRMSKIEDKMFQNQNNIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFKCLNCRQTQVNYQILKSRKYLENDNLFSKWNEVCQDMSRKMEDIDSRINGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSKIEEKIN+NQNIIT RMSKIEDKMFQNQN IINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFKCLNCRQTQVNYQILKSRKYLENDNLFSKWNEVCQDMSRKMEDIDSRINGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYA+MEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPT QQLLENEFITNHS
Sbjct:    1 MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSKIEEKINKNQNIITYRMSKIEDKMFQNQNIIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFKCLNCRQTQVNYQILKSRKYLENDNLFSKWNEVCQDMSRKMEDIDSRINGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAKMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTAQQLLENEFITNHS 719          
BLAST of Kinase-like domain-containing protein vs. Planmine SMEST
Match: SMESG000074921.1 (SMESG000074921.1)

HSP 1 Score: 1407.12 bits (3641), Expect = 0.000e+0
Identity = 698/719 (97.08%), Postives = 699/719 (97.22%), Query Frame = 3
Query:   21 MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSXXXXXXXXXXXXXXXRMSKIEDKMFQNQNNIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFKCLNCRQTQVNYQILKSRKYLENDNLFSKWNEVCQDMSRKMEDIDSRINGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFITNHS 2177
            MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMS                  KIEDKMFQNQN IINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFKCLNCRQTQVNYQILKSRKYLENDNLFSKWNEVCQDMSRKMEDIDSRINGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYA+MEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPT QQLLENEFITNHS
Sbjct:    1 MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMS------------------KIEDKMFQNQNIIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFKCLNCRQTQVNYQILKSRKYLENDNLFSKWNEVCQDMSRKMEDIDSRINGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAKMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTAQQLLENEFITNHS 701          
BLAST of Kinase-like domain-containing protein vs. Planmine SMEST
Match: SMESG000074914.1 (SMESG000074914.1)

HSP 1 Score: 387.111 bits (993), Expect = 9.491e-124
Identity = 244/754 (32.36%), Postives = 398/754 (52.79%), Query Frame = 3
Query:   39 IIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSXXXXXXXXXXXXXXXRMSKIEDKMFQNQNNIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFKCLNCRQTQVNYQILKSRKYLE---------------------------------------NDNLFSKWNEVCQDMSRKME-DIDSRINGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNIS--VNIYET---DGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            I+F FI +  ++  E+P S C   KP+K M  +CA++ +VC K  DK+C+N QNVC QCP+    +  FL                                    N+N     + + +Y I+ M   + + + +EVRFK+ TK         +  N+ IL+SRKY+                                        N  + SK + + + +   ++  ID +++ I   IEK LT      +KF ++GL KPIEL+VN  +NVIQIKR+IC++WP A+   YK M++    +YLDDN YLL  ++SI  T+ C ++  IN  + +V+ +  N+R+P++ Q+ K   + E+K +I+ I       + K+     +L D  T++  +L+DDDWI+II +E G L IKS+F++     I YSN D + +LK+  A K+  D  + VLF N   L    + +DY+ID +S++ FC L +     +    +++  F +L   ++    E +LIKKY   S+ NL   +DI+ E+  +QI++   +FV+L+ I  DE  LY  +E +E  S+  F+K N PL  + I  W  QIL+GL++LHYN +IH N+  +NI+VD    +KLL F+ S  ++ YET   D  F+  +   +RY APE+ + +   + ADIWSFG +L+ I+ G  PY   ++ E +  I++     + F +  +  +LK F++ CL  +P++R T ++L EN+F+
Sbjct:    2 ILFIFIIAT-VTYGEVPRSFCQNPKPYKVMVGTCASYSEVCYKKDDKDCENLQNVCAQCPSVTEKLLNFL------------------------------------NKNK--EDSHIFLYIIISMTAALFLYVIIEVRFKILTKCCCGFKGTASTRNHSILQSRKYIRGTQSKIDEKLTEITELLDFGIDFRIDSNCNVIDLVENSINLKIKSKLDNIAEMIKTTLDAKIDLKMDNIIVLIEKSLTFSN-SKLKFLISGLEKPIELHVNEKDNVIQIKRQICAKWPKAKPHYYKLMRLRYNERYLDDNQYLLLSVSSINVTVVCEMNHKINHSNIIVLKVNGNKRLPEMIQLHKDQKINEIKQIIAKIVYSAEFVIFKDGQNLIELKDNLTIKECNLKDDDWIRIIAKEKGKLVIKSVFEENEPCVIDYSNLDHVSDLKKKAAMKMICDPEDFVLFHNNKYLDEDNYFFDYEIDNESTVKFCCLTKLGQSTLFDGKLDEGDFSELFKAKWGAKFEDVLIKKYEKSSK-NLGDNQDILNELITYQITKSQPRFVQLIRICKDERFLYGILENMEGGSITTFLKDNWPLTNDDIKKWSFQILQGLKFLHYNKIIHRNLSTSNILVDGNRNVKLLSFSTSKYLHGYETQSFDKEFMGQTEKSSRYLAPEVVNRKQYGAQADIWSFGMILVEIINGKPPYFKSTDEEAIEIIKEIKESGYKFLSEKICSQLKHFVEICLHPDPKERATIEELFENKFL 714          
BLAST of Kinase-like domain-containing protein vs. Planmine SMEST
Match: SMESG000074914.1 (SMESG000074914.1)

HSP 1 Score: 369.777 bits (948), Expect = 1.802e-117
Identity = 233/725 (32.14%), Postives = 381/725 (52.55%), Query Frame = 3
Query:  126 MNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSXXXXXXXXXXXXXXXRMSKIEDKMFQNQNNIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFKCLNCRQTQVNYQILKSRKYLE---------------------------------------NDNLFSKWNEVCQDMSRKME-DIDSRINGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNIS--VNIYET---DGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
            M  +CA++ +VC K  DK+C+N QNVC QCP+    +  FL                                    N+N     + + +Y I+ M   + + + +EVRFK+ TK         +  N+ IL+SRKY+                                        N  + SK + + + +   ++  ID +++ I   IEK LT      +KF ++GL KPIEL+VN  +NVIQIKR+IC++WP A+   YK M++    +YLDDN YLL  ++SI  T+ C ++  IN  + +V+ +  N+R+P++ Q+ K   + E+K +I+ I       + K+     +L D  T++  +L+DDDWI+II +E G L IKS+F++     I YSN D + +LK+  A K+  D  + VLF N   L    + +DY+ID +S++ FC L +     +    +++  F +L   ++    E +LIKKY   S+ NL   +DI+ E+  +QI++   +FV+L+ I  DE  LY  +E +E  S+  F+K N PL  + I  W  QIL+GL++LHYN +IH N+  +NI+VD    +KLL F+ S  ++ YET   D  F+  +   +RY APE+ + +   + ADIWSFG +L+ I+ G  PY   ++ E +  I++     + F +  +  +LK F++ CL  +P++R T ++L EN+F+
Sbjct:    1 MVGTCASYSEVCYKKDDKDCENLQNVCAQCPSVTEKLLNFL------------------------------------NKNK--EDSHIFLYIIISMTAALFLYVIIEVRFKILTKCCCGFKGTASTRNHSILQSRKYIRGTQSKIDEKLTEITELLDFGIDFRIDSNCNVIDLVENSINLKIKSKLDNIAEMIKTTLDAKIDLKMDNIIVLIEKSLTFSN-SKLKFLISGLEKPIELHVNEKDNVIQIKRQICAKWPKAKPHYYKLMRLRYNERYLDDNQYLLLSVSSINVTVVCEMNHKINHSNIIVLKVNGNKRLPEMIQLHKDQKINEIKQIIAKIVYSAEFVIFKDGQNLIELKDNLTIKECNLKDDDWIRIIAKEKGKLVIKSVFEENEPCVIDYSNLDHVSDLKKKAAMKMICDPEDFVLFHNNKYLDEDNYFFDYEIDNESTVKFCCLTKLGQSTLFDGKLDEGDFSELFKAKWGAKFEDVLIKKYEKSSK-NLGDNQDILNELITYQITKSQPRFVQLIRICKDERFLYGILENMEGGSITTFLKDNWPLTNDDIKKWSFQILQGLKFLHYNKIIHRNLSTSNILVDGNRNVKLLSFSTSKYLHGYETQSFDKEFMGQTEKSSRYLAPEVVNRKQYGAQADIWSFGMILVEIINGKPPYFKSTDEEAIEIIKEIKESGYKFLSEKICSQLKHFVEICLHPDPKERATIEELFENKFL 685          
BLAST of Kinase-like domain-containing protein vs. Planmine SMEST
Match: SMESG000074938.1 (SMESG000074938.1)

HSP 1 Score: 355.525 bits (911), Expect = 2.541e-111
Identity = 229/744 (30.78%), Postives = 395/744 (53.09%), Query Frame = 3
Query:   51 FIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKTGDKECQNFQNVCQQCPAYNYSIQTFLDV-RTINDRMSXXXXXXXXXXXXXXXRMSKIEDKMFQNQNNIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTKIFK-----CLNCRQTQVNYQILKSRKYLENDN--------LFSKW---NEVCQDMSRKM----ED--IDSRINGITGWI--------EKLLTMPTIVI-----IKFQVTGLSKPIELNVNLNENVIQIKRRICSRWPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPEDFLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGKDLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDSIENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFLERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQKDIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKNSPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFFNIS--VNIYETDGLFINYS-VFPARYSAPEIFDDEGCTSAADIWSFGSVLIYIVTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNPEKRPTCQQLLENEFI 2165
             ++ I ++ +E PLS+C I +PFKTM+N+C NF ++CVK  D EC NF++VC QCP  NY+   F  + R I D+     +    N+ +    + K          +++N+  +L + I+  + L + +L++  + KL  K+         N  Q  +   ++ S++  EN+         + S+    NE   DM + +    +D  ID R      ++        +KL     I        KFQ+   + PIELN++++EN++QIKR+I S+ P  ++  YK MK+   GK LDDN Y  + ++     + C ++ S++P + +V+++ S  R+PDL Q+KKT  V E+K +IS   K I         E K+L D   +    L D DWIK+I +   ++ ++S+FD++    + + + D +  LK N A  +     N  LF     L + K ++DY I+  S + F  +     + +    I++ Y+  LL  +     + I++KKY+ +   +L     ++KE+S+FQ  +   +F+KL GIY +E   Y  ME ++  S+   IKKN PL E +I+ W +QILEGL+YLH    ++ +++ +NI++D+K  +KL   ++S  ++ Y      + Y    P RY APEI         AD+WSFG++++ +VTG QPY  L+E++ + +I +D  I ++  T+ +S  LK F+  CLI+NPE+R +  +L+ + F+
Sbjct:   12 LLFLISVTHQEQPLSICHIDRPFKTMDNTCMNFNELCVKKEDPECNNFKSVCTQCPPVNYTFIMFQKLNRLIEDQKRVEIKTKEINEAVEKLSLKK-------EIKSVLNS--ILAFVIILPVLLFIGLLYLIRKNKLSIKVRSRKVKISENEEQGDMLKPLIISQQVSENEEQGDMLKPLIISQQVSENEEQGDMLKPLIINQQDLKIDERFKEFKLFLDLKLEENFQKLQAFQGIFANQNKDTKFQLKAAAHPIELNIHIDENIVQIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCRDVIISCEVNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIIS---KIIQRKNFVIFQESKELIDSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVEFESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSEVKFVCIRNLHDVEVI-EEIDRGYYSVLLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYN--TTAISHNLKEFIGLCLIFNPEERSSDDKLMNHSFL 740          
The following BLAST results are available for this feature:
BLAST of Kinase-like domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK31.730e-2731.69serine/threonine kinase 3 [Source:HGNC Symbol;Acc:... [more]
STK31.801e-2731.69serine/threonine kinase 3 [Source:HGNC Symbol;Acc:... [more]
STK44.346e-2731.12serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
STK45.484e-2731.40serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
STK241.712e-2328.68serine/threonine kinase 24 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cst-29.723e-2731.69Caenorhabditis STE20-like kinase [Source:UniProtK... [more]
cst-11.540e-2631.97Serine/threonine-protein kinase cst-1 Serine/threo... [more]
cst-11.671e-2631.97Serine/threonine-protein kinase cst-1 Serine/threo... [more]
gck-13.854e-2230.47Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
gck-14.886e-2230.47Germinal center kinase 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpo4.224e-2329.96gene:FBgn0261456 transcript:FBtr0331920[more]
hpo4.224e-2329.96gene:FBgn0261456 transcript:FBtr0086500[more]
GckIII1.808e-2128.91gene:FBgn0266465 transcript:FBtr0083399[more]
polo2.525e-1928.64gene:FBgn0003124 transcript:FBtr0074839[more]
polo2.525e-1928.64gene:FBgn0003124 transcript:FBtr0100318[more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk36.609e-2831.28serine/threonine kinase 3 (STE20 homolog, yeast) [... [more]
stk36.609e-2831.28serine/threonine kinase 3 (STE20 homolog, yeast) [... [more]
stk24a1.285e-2329.33serine/threonine kinase 24a (STE20 homolog, yeast)... [more]
stk25b2.707e-2329.62serine/threonine kinase 25b [Source:ZFIN;Acc:ZDB-G... [more]
stk24b1.344e-2229.92serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elp46.034e-2932.51elongator acetyltransferase complex subunit 4 [Sou... [more]
elp46.759e-2932.51elongator acetyltransferase complex subunit 4 [Sou... [more]
elp48.178e-2932.51elongator acetyltransferase complex subunit 4 [Sou... [more]
elp48.207e-2932.51elongator acetyltransferase complex subunit 4 [Sou... [more]
elp48.763e-2932.51elongator acetyltransferase complex subunit 4 [Sou... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk32.256e-2731.28serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk32.280e-2731.28serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk46.048e-2731.40serine/threonine kinase 4 [Source:MGI Symbol;Acc:M... [more]
Stk34.061e-2531.88serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk243.584e-2328.68serine/threonine kinase 24 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54PX0|Y4251_DICDI1.690e-2933.07Probable serine/threonine-protein kinase DDB_G0284... [more]
sp|Q6IP06|STK3_XENLA5.374e-2832.10Serine/threonine-protein kinase 3 OS=Xenopus laevi... [more]
sp|Q802A6|STK4_SQUAC1.134e-2731.97Serine/threonine-protein kinase 3/4 OS=Squalus aca... [more]
sp|Q7ZUQ3|STK3_DANRE4.989e-2731.28Serine/threonine-protein kinase 3 OS=Danio rerio O... [more]
sp|Q13188|STK3_HUMAN8.307e-2731.69Serine/threonine-protein kinase 3 OS=Homo sapiens ... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Y1Z1031.631e-2630.26Kinase-like protein OS=Basidiobolus meristosporus ... [more]
W5MLC42.052e-2632.38Serine/threonine kinase 4 OS=Lepisosteus oculatus ... [more]
G1NHW22.252e-2632.10Serine/threonine kinase 3 OS=Meleagris gallopavo O... [more]
A0A452GII32.679e-2632.10Serine/threonine kinase 3 OS=Gopherus agassizii OX... [more]
A0A3B3QMW93.301e-2633.06Uncharacterized protein OS=Paramormyrops kingsleya... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk32.777e-2831.69serine/threonine kinase 3 [Source:NCBI gene;Acc:10... [more]
STK41.455e-2731.67serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
stk25a6.595e-2527.65serine/threonine-protein kinase 25 [Source:NCBI ge... [more]
stk24b2.965e-2429.84serine/threonine-protein kinase 24-like [Source:NC... [more]
stk24b4.702e-2429.84serine/threonine-protein kinase 24-like [Source:NC... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map3k191.098e-2324.63mitogen-activated protein kinase kinase kinase 19 ... [more]
stk25a1.346e-2128.91serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
hck8.207e-2130.62HCK proto-oncogene, Src family tyrosine kinase [So... [more]
clul11.082e-2025.59clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GE... [more]
slka1.965e-1933.01STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC154.363e-2531.08Protein kinase of the Mitotic Exit Network; locali... [more]
SKM12.877e-2128.46Member of the PAK family of serine/threonine prote... [more]
STE115.404e-2128.26Signal transducing MEK kinase; involved in pheromo... [more]
PKH22.148e-2029.86Serine/threonine protein kinase; involved in sphin... [more]
MKK29.212e-2026.14MAPKK involved in the protein kinase C signaling p... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428451.635e-2630.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414102.004e-2430.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319341.739e-2027.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357432.350e-2029.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO336526.538e-1927.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044704.15.605e-2831.95serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
ENSORLT00000024938.29.642e-2832.23serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
stk31.141e-2731.28serine/threonine-protein kinase 3 [Source:NCBI gen... [more]
stk31.153e-2731.40serine/threonine-protein kinase 3 [Source:NCBI gen... [more]
ENSORLT00000022068.22.514e-2529.84serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
back to top
BLAST of Kinase-like domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074921.10.000e+099.30SMESG000074921.1[more]
SMESG000074921.10.000e+097.08SMESG000074921.1[more]
SMESG000074914.19.491e-12432.36SMESG000074914.1[more]
SMESG000074914.11.802e-11732.14SMESG000074914.1[more]
SMESG000074938.12.541e-11130.78SMESG000074938.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026449 ID=SMED30026449|Name=Kinase-like domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2284bp
TCTATATAAATCTTATATGAATGTCGATTTTACTTGGAATTATTTTTACT
TTCATCTATTCAATCAAGATCAGCAGAGAAGAGCTGCCTTTATCAATGTG
TGGAATTGTAAAACCATTTAAAACAATGAACAATTCGTGTGCAAATTTTG
TGGACGTTTGCGTGAAAACTGGTGACAAAGAATGCCAAAATTTTCAAAAC
GTGTGTCAGCAATGCCCGGCATATAACTACAGCATTCAAACTTTTTTGGA
TGTAAGAACTATCAACGATAGAATGTCAAAAATCGAAGAGAAAATCAATC
AAAATCAGAACATTATAACCAATAGAATGTCAAAAATCGAAGATAAAATG
TTTCAAAATCAGAACAATATAATTAATACTACTTTGGTTTTGGTCTACTG
CATTATGTTCATGATATGTTTAATTTTGGTTGTTTTGTTTGTGGAGGTCA
GATTCAAGCTTTGCACTAAGATTTTCAAATGTTTAAACTGCAGACAGACA
CAAGTAAACTATCAGATCTTGAAAAGCAGAAAATATTTGGAAAATGATAA
CTTGTTCAGTAAATGGAATGAAGTTTGTCAAGATATGTCAAGGAAAATGG
AGGATATCGATTCAAGAATAAACGGCATCACTGGATGGATTGAGAAGTTA
TTAACTATGCCAACCATTGTAATCATAAAATTCCAAGTGACTGGACTATC
AAAACCCATCGAATTGAATGTCAATCTAAATGAGAATGTTATTCAAATTA
AGCGAAGAATATGCAGTCGATGGCCGGCAGCTCAAAGAGATTCCTACAAA
AAGATGAAAGTGATAGACAAAGGGAAATATCTGGATGATAACCACTATTT
GTTGACACAAATTAATTCAATTGCTAGTACTTTGAAATGTTCAATTGACG
ATTCCATTAATCCAGAGGACTTTCTCGTCATCAGTTTAAGAAGTAACCGG
CGGATTCCAGATCTATTTCAGGTCAAGAAAACTAGTACTGTCAAAGAGAT
GAAAATACTCATTTCCTCTATCAACAAATTCATTTCCGATCCAGTTATAA
AGGAAATGTACGAGGGAAAAGATTTGAATGACATGAATACTTTGGAGAGT
TATTCTTTACGAGATGACGATTGGATCAAGATTATAACTAGAGAATCCGG
CGATTTGACTATTAAATCTTTGTTTGACGACAAAATACAATATTCCATTT
CCTATTCCAATTTCGATAGCATTGAAAATCTCAAAAGGAATTTTGCTAAA
AAAATCCAATTGGATTCGGTAAATTTGGTTCTCTTTCTTAATGAATTGGA
TCTGAAGAACCAAAAATTTGTTTATGACTATGACATTGACATGGACTCCA
GTCTTAGTTTCTGTTTTTTGGAAAGATGGAGTGGAATAAATATCACCGGA
AATGCCATCGAAAAAGATTACTTTTTCCAATTACTTCCTGGCGAGTATAA
TGAAACTCGGGAAAAGATCTTAATTAAAAAGTATTCACTTTTGTCGGAAA
TAAATTTGGAAAGTCAAAAAGACATAATAAAAGAAATGAGTGTGTTTCAA
ATATCTCAACAAAGCGAACAATTCGTCAAATTGCTGGGCATTTATTTCGA
TGAGGCCGCCCTCTATGCCGAAATGGAATACATAGAAGCAGTTTCCATGT
TAGAATTTATAAAAAAAAATTCCCCTCTAAAAGAGAACAAAATTTCGTTA
TGGTGCCGACAAATCCTGGAGGGTCTCAGATATTTGCATTACAACAATAT
GATTCATGGAAATATCAGGCCAACAAATATTGTTGTTGACAACAAGGGAA
AACTAAAATTACTTTTTTTTAATATATCAGTGAATATTTATGAAACGGAT
GGACTTTTTATTAATTATAGTGTATTTCCGGCTCGGTATTCAGCCCCAGA
AATATTTGATGATGAAGGCTGCACTTCGGCAGCAGATATTTGGTCCTTTG
GGTCAGTCCTGATCTATATAGTTACAGGCAGTCAACCTTATGAAACTTTG
TCAGAATCAGAAGTAGTGATTCAGATACAGAAAGATCACAGAATTTCATT
CTCATTTCCAACTTCTCCAGTATCGGATGAGCTGAAAGCCTTCCTCCAGA
ATTGCTTGATATATAACCCAGAAAAACGGCCGACCTGCCAACAGTTACTA
GAAAATGAATTTATTACAAATCACTCATAATATTTTAGTTCATTTATAAA
ATTTGATAAAATATTTTTGAGTAATTTTTAATTTAAATTAATTTCTGTTT
GATGAATTCACTTTTTTGTAAATTTAAGTTTTAT
back to top

protein sequence of SMED30026449-orf-1

>SMED30026449-orf-1 ID=SMED30026449-orf-1|Name=SMED30026449-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=720bp
MSILLGIIFTFIYSIKISREELPLSMCGIVKPFKTMNNSCANFVDVCVKT
GDKECQNFQNVCQQCPAYNYSIQTFLDVRTINDRMSKIEEKINQNQNIIT
NRMSKIEDKMFQNQNNIINTTLVLVYCIMFMICLILVVLFVEVRFKLCTK
IFKCLNCRQTQVNYQILKSRKYLENDNLFSKWNEVCQDMSRKMEDIDSRI
NGITGWIEKLLTMPTIVIIKFQVTGLSKPIELNVNLNENVIQIKRRICSR
WPAAQRDSYKKMKVIDKGKYLDDNHYLLTQINSIASTLKCSIDDSINPED
FLVISLRSNRRIPDLFQVKKTSTVKEMKILISSINKFISDPVIKEMYEGK
DLNDMNTLESYSLRDDDWIKIITRESGDLTIKSLFDDKIQYSISYSNFDS
IENLKRNFAKKIQLDSVNLVLFLNELDLKNQKFVYDYDIDMDSSLSFCFL
ERWSGINITGNAIEKDYFFQLLPGEYNETREKILIKKYSLLSEINLESQK
DIIKEMSVFQISQQSEQFVKLLGIYFDEAALYAEMEYIEAVSMLEFIKKN
SPLKENKISLWCRQILEGLRYLHYNNMIHGNIRPTNIVVDNKGKLKLLFF
NISVNIYETDGLFINYSVFPARYSAPEIFDDEGCTSAADIWSFGSVLIYI
VTGSQPYETLSESEVVIQIQKDHRISFSFPTSPVSDELKAFLQNCLIYNP
EKRPTCQQLLENEFITNHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR000626Ubiquitin-like_dom
IPR029071Ubiquitin-like_domsf
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000626Ubiquitin-like domainPFAMPF00240ubiquitincoord: 316..374
e-value: 7.7E-5
score: 22.4
IPR000626Ubiquitin-like domainPROSITEPS50053UBIQUITIN_2coord: 302..378
score: 12.27
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 463..718
e-value: 1.4E-52
score: 180.4
NoneNo IPR availablePANTHERPTHR24348:SF44SERINE/THREONINE-PROTEIN KINASE DDB_G0278901-RELATEDcoord: 484..718
NoneNo IPR availablePANTHERPTHR24348SERINE/THREONINE-PROTEIN KINASE UNC-51-RELATEDcoord: 484..718
NoneNo IPR availableTMHMMTMhelixcoord: 116..138
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 478..715
e-value: 1.9E-41
score: 142.2
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 457..715
score: 32.188
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 315..380
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 215..277
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 465..717