SHSP domain-containing protein

Overview
NameSHSP domain-containing protein
Smed IDSMED30026445
Length (bp)1004
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SHSP domain-containing protein (SMED30026445) t-SNE clustered cells

Violin plots show distribution of expression levels for SHSP domain-containing protein (SMED30026445) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SHSP domain-containing protein (SMED30026445) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SHSP domain-containing protein (SMED30026445) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026445

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026445SMESG000030562.1 SmedASXL_001986SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026445SMESG000030562.1 SmedASXL_001986SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30026445SMESG000030562.1 dd_Smed_v4_5406_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30026445SMESG000030562.1 dd_Smed_v4_5406_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30026445SMESG000030562.1 Contig49553newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026445SMESG000030562.1 Contig49553uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026445SMESG000030562.1 Contig49553newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026445SMESG000030562.1 Contig49553uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SHSP domain-containing protein vs. Ensembl Celegans
Match: hsp-16.2 (Heat shock protein Hsp-16.2 [Source:UniProtKB/Swiss-Prot;Acc:P06582])

HSP 1 Score: 53.1434 bits (126), Expect = 1.087e-8
Identity = 28/93 (30.11%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  616 WRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIE 894
            + +  N+ + FK +++K+    + + ++  +E KTD+ YS K  + VI +P++V+   + S L +DG+L +EAP K      +   G++IPI+
Sbjct:   32 FAINLNVSQ-FKPEDLKINLDGRTLSIQGEQELKTDHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPKK------EAVQGRSIPIQ 117          
BLAST of SHSP domain-containing protein vs. Ensembl Celegans
Match: hsp-16.2 (Heat shock protein Hsp-16.2 [Source:UniProtKB/Swiss-Prot;Acc:P06582])

HSP 1 Score: 53.5286 bits (127), Expect = 1.412e-8
Identity = 28/93 (30.11%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  616 WRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIE 894
            + +  N+ + FK +++K+    + + ++  +E KTD+ YS K  + VI +P++V+   + S L +DG+L +EAP K      +   G++IPI+
Sbjct:   50 FAINLNVSQ-FKPEDLKINLDGRTLSIQGEQELKTDHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPKK------EAVQGRSIPIQ 135          
BLAST of SHSP domain-containing protein vs. Ensembl Celegans
Match: hsp-16.11 (Heat shock protein Hsp-16.1/Hsp-16.11 [Source:UniProtKB/Swiss-Prot;Acc:P34696])

HSP 1 Score: 49.6766 bits (117), Expect = 2.384e-7
Identity = 27/93 (29.03%), Postives = 54/93 (58.06%), Query Frame = 1
Query:  616 WRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIE 894
            + +  N+ + FK +++K+      + ++  +E KT++ YS K  + VI +P++V+   + S L +DG+L +EAP K      +   G++IPI+
Sbjct:   50 FAINLNVSQ-FKPEDLKINLDGHTLSIQGEQELKTEHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPKK------EAIQGRSIPIQ 135          
BLAST of SHSP domain-containing protein vs. Ensembl Celegans
Match: hsp-16.1 (Heat shock protein Hsp-16.1/Hsp-16.11 [Source:UniProtKB/Swiss-Prot;Acc:P34696])

HSP 1 Score: 49.6766 bits (117), Expect = 2.384e-7
Identity = 27/93 (29.03%), Postives = 54/93 (58.06%), Query Frame = 1
Query:  616 WRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIE 894
            + +  N+ + FK +++K+      + ++  +E KT++ YS K  + VI +P++V+   + S L +DG+L +EAP K      +   G++IPI+
Sbjct:   50 FAINLNVSQ-FKPEDLKINLDGHTLSIQGEQELKTEHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPKK------EAIQGRSIPIQ 135          
BLAST of SHSP domain-containing protein vs. Ensembl Fly
Match: CG14207 (gene:FBgn0031037 transcript:FBtr0307161)

HSP 1 Score: 50.0618 bits (118), Expect = 2.601e-7
Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 1
Query:  229 VSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDD----FSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAP 432
            VS Y P E+ +K       + K+++HAKHE + D    + E  +   +PK V+ E +R+ LSKDGVL + AP
Sbjct:   72 VSQYAPEEIVVKT-----VDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAP 138          
BLAST of SHSP domain-containing protein vs. Ensembl Fly
Match: CG14207 (gene:FBgn0031037 transcript:FBtr0074733)

HSP 1 Score: 50.447 bits (119), Expect = 3.068e-7
Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 1
Query:  229 VSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDD----FSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAP 432
            VS Y P E+ +K       + K+++HAKHE + D    + E  +   +PK V+ E +R+ LSKDGVL + AP
Sbjct:  101 VSQYAPEEIVVKT-----VDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAP 167          
BLAST of SHSP domain-containing protein vs. Ensembl Fly
Match: CG14207 (gene:FBgn0031037 transcript:FBtr0345918)

HSP 1 Score: 50.447 bits (119), Expect = 3.068e-7
Identity = 28/72 (38.89%), Postives = 42/72 (58.33%), Query Frame = 1
Query:  229 VSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDD----FSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAP 432
            VS Y P E+ +K       + K+++HAKHE + D    + E  +   +PK V+ E +R+ LSKDGVL + AP
Sbjct:  101 VSQYAPEEIVVKT-----VDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAP 167          
BLAST of SHSP domain-containing protein vs. Ensembl Fly
Match: CG14207 (gene:FBgn0031037 transcript:FBtr0074734)

HSP 1 Score: 50.447 bits (119), Expect = 4.092e-7
Identity = 29/72 (40.28%), Postives = 44/72 (61.11%), Query Frame = 1
Query:  229 VSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDD----FSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAP 432
            VS Y P E+ +K  T ++   K+++HAKHE + D    + E  +   +PK V+ E +R+ LSKDGVL + AP
Sbjct:  110 VSQYAPEEIVVK--TVDQ---KLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAP 176          
BLAST of SHSP domain-containing protein vs. UniProt/SwissProt
Match: sp|P06582|HSP12_CAEEL (Heat shock protein Hsp-16.2 OS=Caenorhabditis elegans OX=6239 GN=hsp-16.2 PE=3 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.796e-7
Identity = 28/93 (30.11%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  616 WRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIE 894
            + +  N+ + FK +++K+    + + ++  +E KTD+ YS K  + VI +P++V+   + S L +DG+L +EAP K      +   G++IPI+
Sbjct:   50 FAINLNVSQ-FKPEDLKINLDGRTLSIQGEQELKTDHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPKK------EAVQGRSIPIQ 135          
BLAST of SHSP domain-containing protein vs. UniProt/SwissProt
Match: sp|P34696|HSP11_CAEEL (Heat shock protein Hsp-16.1/Hsp-16.11 OS=Caenorhabditis elegans OX=6239 GN=hsp-16.1 PE=2 SV=1)

HSP 1 Score: 49.6766 bits (117), Expect = 3.032e-6
Identity = 27/93 (29.03%), Postives = 54/93 (58.06%), Query Frame = 1
Query:  616 WRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIE 894
            + +  N+ + FK +++K+      + ++  +E KT++ YS K  + VI +P++V+   + S L +DG+L +EAP K      +   G++IPI+
Sbjct:   50 FAINLNVSQ-FKPEDLKINLDGHTLSIQGEQELKTEHGYSKKSFSRVILLPEDVDVGAVASNLSEDGKLSIEAPKK------EAIQGRSIPIQ 135          
BLAST of SHSP domain-containing protein vs. TrEMBL
Match: H1ZWN3 (Small HSP protein (Fragment) OS=Dugesia japonica OX=6161 GN=smallhsp PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 7.030e-76
Identity = 111/194 (57.22%), Postives = 151/194 (77.84%), Query Frame = 1
Query:  361 PKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLIDSHAVIVR-PRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEATNKSVGNDKMTVEN 939
            P NVD+E+LR+I++KDGVL+LKAPYK +  S V P+K+ R D WNGIWGELGRLN+QMN +ID   +    PRTEF+AD N  SGTWR+K N+GKDF SD+IKL+H N +IHLEA++E+K  +  SS+YI EV+++P+ +E DK+ SKL+D+G+LI+EAPCKKMP+L +G+ GK IP+E+ + S    KM + N
Sbjct:    1 PSNVDNENLRSIMTKDGVLVLKAPYKNTESSSVNPIKLNREDNWNGIWGELGRLNDQMNQMIDFGGIFSHHPRTEFVADDNKESGTWRMKVNVGKDFTSDDIKLKHQNNEIHLEAKKESKGQDSISSRYIKEVLTLPEGIEQDKIHSKLMDNGQLIIEAPCKKMPNLIRGDEGKVIPVESGDIS----KMAINN 190          
BLAST of SHSP domain-containing protein vs. TrEMBL
Match: A0A267DQU2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005128g1 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.858e-22
Identity = 72/247 (29.15%), Postives = 126/247 (51.01%), Query Frame = 1
Query:  187 GHKRKHNQWTASIPVSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRL-------NEQMNHLIDSHAVIVRPRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEATNK 906
            G KR   QWT S+ + G+EPSEV++K +       K+ I A+HE  +D +E+K+ + +P++VD E L +  +++G+L+L+AP+KE +    Q  ++++  T N +W EL  L        + M H+ D              DG G      L     ++FK +EI++R     + +EA  + +       K +  +  +PD  + D++ SKL  DG L + AP +  P+ +K    K +P+E   +
Sbjct:   60 GPKRP-RQWTRSVDLRGFEPSEVSVKRD-----GCKMRIAARHEDGEDVTEVKRTIDVPEDVDVEKLSSGFTREGILLLQAPFKEELRDQQQ-QQLQKQKTENSVWDELRELLRAPDISQDSMGHVED-------------VDGGGKRFCAELSV---REFKPEEIRVRQQGDCVLVEAEHKEEAGGQRVYKKLERIFQLPDGTKLDQVASKLSHDGRLTILAPFEAPPAQEKPHV-KDLPMETEQQ 282          
BLAST of SHSP domain-containing protein vs. TrEMBL
Match: A0A267FXZ9 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013453g2 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 4.897e-15
Identity = 61/244 (25.00%), Postives = 115/244 (47.13%), Query Frame = 1
Query:  211 WTASIPVSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRT---DTWNGIWGE--LGRLNEQMNHLIDSHAVIVRPRTEFI----------ADGNGVSGTWRLKFNI-GKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIE 894
            WT +I + G+ P E+ +K +       K+ I A+ E  +D +E+++ + IP  VD E + TIL+ +G L++KAP  +S     Q  + +R        G+ GE  +   ++Q     D   ++  P  + +           D   VS     +  I  ++F   EIK++    Q+++EA    + +     + +    ++P  V+ + L S+L +DG L++EAP   +        G+++PIE
Sbjct:  166 WTTAIDLVGFRPEEIVVKCDA-----DKLRIRARREEGEDLNEVRRTLTIPAEVDSEKVSTILTMEGALVVKAPLLQSFQQQQQQQQHQRGYSEAAAMGLGGEDTMSSCSQQDLSWDDVRTLVRGPGIQPLNCLVTARATDGDQRAVSSDKMFRAEILVREFHPQEIKVQQKADQVYVEAESRQEREGQTELRRMERSFTLPRGVDVENLVSRLTEDGRLLLEAPFLALADSASAGAGRSVPIE 404          
BLAST of SHSP domain-containing protein vs. TrEMBL
Match: A0A1I8I045 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 5.830e-15
Identity = 63/245 (25.71%), Postives = 115/245 (46.94%), Query Frame = 1
Query:  211 WTASIPVSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRT---DTWNGIWGE--LGRLNEQMNHLIDSHAVIVRPR--------TEFIADG--NGVSGTWRLKFNI-GKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEA 897
            WT +I + G+ P E+ +K +       K+ I A+ E  +D +E+++ + IP  VD E + TIL+ +G L++KAP  +S     Q  + +R        G+ GE  +   ++Q     D   ++  P         T    DG    VS     +  I  ++F   EIK++    Q+++EA    + +     + +    ++P  V+ + L S+L +DG L++EAP   +        G+++PIE 
Sbjct:  172 WTTAIDLVGFRPEEIVVKCDA-----DKLRIRARREEGEDLNEVRRTLTIPAEVDSEKVSTILTMEGALVVKAPLLQSFQQQQQQQQHQRGYSEAAAMGLGGEDTMSSCSQQDLSWDDVRTLVRGPGIQPLNCLVTARATDGEQRAVSSDKMFRAEILVREFHPQEIKVQQKADQVYVEAESRQEREGQTELRRMERSFTLPRGVDVENLVSRLTEDGRLLLEAPFLALADSASAGAGRSVPIEG 411          
BLAST of SHSP domain-containing protein vs. TrEMBL
Match: A0A267DBT8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013453g1 PE=3 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 3.445e-14
Identity = 62/256 (24.22%), Postives = 115/256 (44.92%), Query Frame = 1
Query:  211 WTASIPVSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVD-------------SYVQPLKIKRTDTWNGI------WGELGRLN-----EQMNHLIDSHAVIVRPRTEFIADG--NGVSGTWRLKFNI-GKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEA 897
            WT +I + G+ P E+ +K +       K+ I A+ E  +D +E+++ + IP  VD E + TIL+ +G L++KAP  +S               S    + +   DT +        W ++  L      + +N L+ + A           DG    VS     +  I  ++F   EIK++    Q+++EA    + +     + +    ++P  V+ + L S+L +DG L++EAP   +        G+++PIE 
Sbjct:  166 WTTAIDLVGFRPEEIVVKCDA-----DKLRIRARREEGEDLNEVRRTLTIPAEVDSEKVSTILTMEGALVVKAPLLQSFQQQQQQQQQHQRGYSEAAAMGLGGEDTMSSCSQQDLSWDDVRTLVRGPGIQPLNCLVTARAT----------DGEQRAVSSDKMFRAEILVREFHPQEIKVQQKADQVYVEAESRQEREGQTELRRMERSFTLPRGVDVENLVSRLTEDGRLLLEAPFLALADSASAGAGRSVPIEG 406          
BLAST of SHSP domain-containing protein vs. Planmine SMEST
Match: SMESG000030562.1 (SMESG000030562.1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 276/277 (99.64%), Postives = 277/277 (100.00%), Query Frame = 1
Query:  109 MLSSNIFRYLDEPICSSLFWPEITHVGHKRKHNQWTASIPVSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLIDSHAVIVRPRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEATNKSVGNDKMTVEN 939
            MLSSNIFRYLDEPICSSLFWPEITHVGHKRKHNQWTASIPVSGYEPSEVAIKEET+NEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLIDSHAVIVRPRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEATNKSVGNDKMTVEN
Sbjct:    1 MLSSNIFRYLDEPICSSLFWPEITHVGHKRKHNQWTASIPVSGYEPSEVAIKEETSNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLIDSHAVIVRPRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEATNKSVGNDKMTVEN 277          
BLAST of SHSP domain-containing protein vs. Planmine SMEST
Match: SMESG000059853.1 (SMESG000059853.1)

HSP 1 Score: 351.673 bits (901), Expect = 6.838e-122
Identity = 165/274 (60.22%), Postives = 223/274 (81.39%), Query Frame = 1
Query:  124 IFRYLDEPICSSLFWPEITH-VGHKRKHNQWTASIPVSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLID-SHAVIVRPRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEATNKSVGNDKMTVEN 939
            +FR+LDEPI +SL+WPE +H V + +++N W+ SIP++GY+P+E+AIKEE T EG  KII+HAKH +E+DF+E KK +KIPKNVDHE+LR+ ++K+G+L+LKAPYK S DS V+P+KI R DTW+GIWGELGRLN+QMNH+ID   A+  +PR EF+ D N  SGTWR+  N+GKDFKSD+IKLRH NK+I+LEA++ETKTDN  SS+YI EV+S+P+ +E DKL SKLLD+G+L++EAPCKKMPS+   + GK IP+E+ + +    KM V+N
Sbjct:    1 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHINEEDFAEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNKEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESGDAT----KMAVDN 270          
BLAST of SHSP domain-containing protein vs. Planmine SMEST
Match: SMESG000059879.1 (SMESG000059879.1)

HSP 1 Score: 350.903 bits (899), Expect = 1.569e-121
Identity = 165/274 (60.22%), Postives = 221/274 (80.66%), Query Frame = 1
Query:  124 IFRYLDEPICSSLFWPEITH-VGHKRKHNQWTASIPVSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLID-SHAVIVRPRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEATNKSVGNDKMTVEN 939
            +FR+LDEPI +SL+WPE +H V + +++N W+ SIP++GY+P+E+AIKEE T EG  KII+HAKH +E+DFSE KK +KIPKNVDHE+LR+ ++K+G+L+LKAPYK S DS V+P+KI R DTW+GIWGELGRLN+QMNH+ID   A+  +PR EF+ D N  SGTWR+  N+GKDFKSD+IKLRH N +I+LEA++ETKTDN  SS+YI EV+S+P+ +E DKL SKLLD+G+L++EAPCKKMPS+   + GK IP+E+   +    KM V+N
Sbjct:    1 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFSEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNNEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESDEST----KMAVDN 270          
BLAST of SHSP domain-containing protein vs. Planmine SMEST
Match: SMESG000059868.1 (SMESG000059868.1)

HSP 1 Score: 350.903 bits (899), Expect = 1.569e-121
Identity = 165/274 (60.22%), Postives = 221/274 (80.66%), Query Frame = 1
Query:  124 IFRYLDEPICSSLFWPEITH-VGHKRKHNQWTASIPVSGYEPSEVAIKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLID-SHAVIVRPRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSLDKGETGKAIPIEATNKSVGNDKMTVEN 939
            +FR+LDEPI +SL+WPE +H V + +++N W+ SIP++GY+P+E+AIKEE T EG  KII+HAKH +E+DFSE KK +KIPKNVDHE+LR+ ++K+G+L+LKAPYK S DS V+P+KI R DTW+GIWGELGRLN+QMNH+ID   A+  +PR EF+ D N  SGTWR+  N+GKDFKSD+IKLRH N +I+LEA++ETKTDN  SS+YI EV+S+P+ +E DKL SKLLD+G+L++EAPCKKMPS+   + GK IP+E+   +    KM V+N
Sbjct:    1 MFRFLDEPIFNSLYWPEYSHHVIYPKRNNLWSTSIPITGYQPNEIAIKEEKTEEGEVKIIVHAKHVNEEDFSEFKKCIKIPKNVDHENLRSTMTKEGLLVLKAPYKISEDSVVKPIKINREDTWSGIWGELGRLNDQMNHMIDFGGALSHQPRVEFVPDENKESGTWRMTINVGKDFKSDDIKLRHQNNEIYLEAKKETKTDNSSSSRYIKEVLSLPEGIEEDKLNSKLLDNGQLVIEAPCKKMPSIGHDDKGKVIPVESDEST----KMAVDN 270          
BLAST of SHSP domain-containing protein vs. Planmine SMEST
Match: SMESG000028601.1 (SMESG000028601.1)

HSP 1 Score: 50.447 bits (119), Expect = 9.917e-7
Identity = 47/201 (23.38%), Postives = 94/201 (46.77%), Query Frame = 1
Query:  235 GYEPSEVAIKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKDGVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLIDSHAVIVRPRTEFIADGNGVSG-TWRLKFNIGKDFKSDEIKLRHHNKQIHLEARRETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEA 834
             ++P ++ +    T  GN+  I+  K  S+ +  E+ K + IP ++D +  +  +++DG+LIL+AP K    + + P +         ++ +  +        +D + VIV+  T      N   G    L+  +  D+   +  +    K+I ++ R E KT N  S K  ++   IP+ ++   +   ++ DG LI+EA
Sbjct:  197 NFKPEDIKV----TCTGNNLNIVVEK--SDTNLVELHKSIVIPSSIDSQKFQCHITQDGILILEAPVKSPDYNSIVPQE--------KVFADACK-----TQTMDRNQVIVKRNTSGPVVLNDEKGKRLHLEIAVESDYVPGDFSVTAELKKISVKGRHEVKTSNSSSFKEFSQYYEIPETIDPMSINFSVI-DGTLIIEA 377          
The following BLAST results are available for this feature:
BLAST of SHSP domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hsp-16.21.087e-830.11Heat shock protein Hsp-16.2 [Source:UniProtKB/Swi... [more]
hsp-16.21.412e-830.11Heat shock protein Hsp-16.2 [Source:UniProtKB/Swi... [more]
hsp-16.112.384e-729.03Heat shock protein Hsp-16.1/Hsp-16.11 [Source:Uni... [more]
hsp-16.12.384e-729.03Heat shock protein Hsp-16.1/Hsp-16.11 [Source:Uni... [more]
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG142072.601e-738.89gene:FBgn0031037 transcript:FBtr0307161[more]
CG142073.068e-738.89gene:FBgn0031037 transcript:FBtr0074733[more]
CG142073.068e-738.89gene:FBgn0031037 transcript:FBtr0345918[more]
CG142074.092e-740.28gene:FBgn0031037 transcript:FBtr0074734[more]
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SHSP domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P06582|HSP12_CAEEL1.796e-730.11Heat shock protein Hsp-16.2 OS=Caenorhabditis eleg... [more]
sp|P34696|HSP11_CAEEL3.032e-629.03Heat shock protein Hsp-16.1/Hsp-16.11 OS=Caenorhab... [more]
back to top
BLAST of SHSP domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H1ZWN37.030e-7657.22Small HSP protein (Fragment) OS=Dugesia japonica O... [more]
A0A267DQU22.858e-2229.15Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FXZ94.897e-1525.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8I0455.830e-1525.71Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DBT83.445e-1424.22Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SHSP domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SHSP domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030562.10.000e+099.64SMESG000030562.1[more]
SMESG000059853.16.838e-12260.22SMESG000059853.1[more]
SMESG000059879.11.569e-12160.22SMESG000059879.1[more]
SMESG000059868.11.569e-12160.22SMESG000059868.1[more]
SMESG000028601.19.917e-723.38SMESG000028601.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026445 ID=SMED30026445|Name=SHSP domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1004bp
TTTTTTTTCTATAGCCAATTAAAATTAAGAGAGAAATAGCTGGAAATTTC
TACAAGTATATATAAATAAATTATTTTTTACAGTTAATATTATTTTAAAT
TTGTTAAAATGTTGTCATCAAATATTTTTCGCTATTTAGATGAGCCGATA
TGTAGTTCATTATTTTGGCCAGAAATTACTCATGTTGGTCATAAAAGAAA
ACACAATCAATGGACAGCGTCGATTCCTGTTTCAGGATATGAACCAAGTG
AAGTAGCAATAAAAGAAGAAACTACCAATGAAGGAAATTCGAAAATAATA
ATTCATGCTAAACATGAAAGCGAAGATGATTTTTCTGAAATGAAAAAGGT
TGTGAAAATTCCCAAAAATGTGGATCACGAGCACCTTAGAACTATTTTAT
CAAAAGATGGCGTATTGATATTAAAAGCTCCATACAAAGAATCTGTTGAT
TCATATGTTCAACCATTAAAAATTAAGCGAACAGACACATGGAACGGAAT
ATGGGGCGAACTTGGTCGACTCAATGAACAAATGAATCATCTAATTGATT
CGCATGCAGTTATTGTAAGACCTCGAACAGAATTCATTGCCGATGGAAAT
GGAGTTAGTGGCACATGGCGTTTAAAGTTCAATATTGGAAAAGATTTCAA
ATCCGATGAGATAAAGCTCCGCCATCATAACAAACAAATTCATTTGGAAG
CCCGGCGGGAAACTAAAACTGACAATGATTATAGTTCTAAGTATATTAAT
GAAGTAATCTCAATTCCAGATGAAGTTGAAGCTGATAAATTGAAATCGAA
ACTATTAGATGATGGCGAGTTGATCGTGGAGGCCCCGTGTAAGAAAATGC
CGAGTCTAGATAAAGGAGAAACTGGAAAGGCAATCCCAATTGAAGCTACC
AACAAGTCAGTTGGGAATGATAAAATGACTGTTGAAAACTAAATTATTTG
TATTATATGTATCTGTGTTTTGTGTAATATATTTTGTATTAGTTTGAAAA
AAAA
back to top

protein sequence of SMED30026445-orf-1

>SMED30026445-orf-1 ID=SMED30026445-orf-1|Name=SMED30026445-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MLSSNIFRYLDEPICSSLFWPEITHVGHKRKHNQWTASIPVSGYEPSEVA
IKEETTNEGNSKIIIHAKHESEDDFSEMKKVVKIPKNVDHEHLRTILSKD
GVLILKAPYKESVDSYVQPLKIKRTDTWNGIWGELGRLNEQMNHLIDSHA
VIVRPRTEFIADGNGVSGTWRLKFNIGKDFKSDEIKLRHHNKQIHLEARR
ETKTDNDYSSKYINEVISIPDEVEADKLKSKLLDDGELIVEAPCKKMPSL
DKGETGKAIPIEATNKSVGNDKMTVEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR002068A-crystallin/Hsp20_dom
IPR008978HSP20-like_chaperone
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008978HSP20-like chaperoneGENE3DG3DSA:2.60.40.790coord: 138..276
e-value: 1.4E-13
score: 52.5
coord: 18..129
e-value: 1.3E-10
score: 42.8
IPR008978HSP20-like chaperoneSUPERFAMILYSSF49764HSP20-like chaperonescoord: 20..115
IPR002068Alpha crystallin/Hsp20 domainPFAMPF00011HSP20coord: 30..114
e-value: 1.1E-5
score: 25.5
coord: 170..261
e-value: 5.4E-8
score: 32.9
IPR002068Alpha crystallin/Hsp20 domainPROSITEPS01031SHSPcoord: 17..125
score: 10.884
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 251..277
NoneNo IPR availablePANTHERPTHR45640FAMILY NOT NAMEDcoord: 166..265
coord: 31..116
NoneNo IPR availableCDDcd06526metazoan_ACDcoord: 170..244
e-value: 3.1882E-9
score: 50.5963
NoneNo IPR availableCDDcd06526metazoan_ACDcoord: 31..108
e-value: 1.12577E-10
score: 54.8335