SMED30026442

Overview
NameSMED30026442
Smed IDSMED30026442
Length (bp)3789
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30026442 (SMED30026442) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30026442 (SMED30026442) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30026442 (SMED30026442) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30026442 (SMED30026442) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026442

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026442SMESG000054136.1 SMESG000046458.1 SmedASXL_009253SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026442SMESG000054144.1 SMESG000046463.1 SmedASXL_003470SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026442SMESG000054136.1 SMESG000046458.1 SmedASXL_007258SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026442SMESG000054144.1 SMESG000054136.1 SMESG000046463.1 SMESG000046458.1 dd_Smed_v6_27312_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30026442 vs. TrEMBL
Match: A0A267G6I5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004104g2 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.563e-28
Identity = 137/644 (21.27%), Postives = 294/644 (45.65%), Query Frame = 2
Query: 1445 LDFKDESLWKKSLESAENHWIEKVARSRKIIDFFMILENVLKLVQFESALVPEEFNFEVVKQEIILILNSPAYKLYTLTQQNLTLRQVMYSFHEHCRNDVVAFMFKNFIASLQSSLEDLRLK---NFVSFNKIVIKKLEKRIKKFLSKKPELI-SSEVMLELRYYNSVSSYLLWQIVQDIXXXXXXXXXXXINEIRVKYSQN--SKDEVLLLKSFEFANDVFLFTMKSDSSTQNALAETHNRDVLDLLTKENFGVY---------WKLFVNKFMSINSFNPTFNPINILAKYLHLASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIFGSKLSL-----SLFAGLSSKNLLKLVKIFDCGLYETKKDMLQAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICAKFYVKHEWRYLPLLKHFRFHFIEINKPQLHNVAYKDIANLERFQLLFFTEESAN-GFYQINSLESSERKIYEANEK----IDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFSVMETNSFSLISNE 3301
            +DF  +S  +K ++     W   +ARS  + + F ++ +++ L+  +   V +E   +V +      L S A ++++L  QN  +R+++ +F     + +V   F  +   ++  L+ +  +     ++  + +  +L         K   +I S + +L+LR+ N     +  ++V+ ++      +++ ++++R  Y +     ++ +   + E+  +  L + +        LAE    +  +++ +     Y         W+ F+   +S N+F    NP   L      A+++  L   +   +   L     +L++S   +Y++   + +G K SL     + +  LSS  L  LV       +  K+ + +A + T   G++S YG++ P +R +++ D+VYI  P  C  E  + F  ++ +  +++D      + V  GIF     KRWS+ EI +     + +I +   L   I  K Y +++WRY+ + K+FR+ ++  +K +   V + D    E +Q +FF +E A   F +  + E  +  I  A  +     D    EC R Q +      +L KSL ++   ++ E  ++ +S   +L++LN +NK +Q L+  V+   +F+   ++
Sbjct:  461 IDFSPDS--RKVIDPVRIAWERHIARSHFVPEAFDVVHHMILLMLLDRKSVSDEHFIQVHR-----FLRSSAARMHSLMMQNQFIREIIENFDRAEESQIVQRQFMEYRHGIKDLLDSVYRECSSEMITCGRAIETRLYDMSHSVEGKGSNIILSPKSVLDLRFINHYCYPIFLRLVE-VMLPQVPLITAFVDKLRKAYPEEVLRFEDAMPNPNVEYGYEEPLISKQHHQFIDTELAEAECNESKEIVKETVLMQYLLDTRVDEVWEGFMMDILSSNTFPQ--NPYPRLITDFRRAALKMSLCYDTDEKIVKDLYHSEPQLLDSTTFVYQMPGSDAYGYKSSLYAIDTAAYFALSS-FLFPLVH----ENFTEKRGVYRASVCTCTVGEVSTYGRLDPYLRQVQMADHVYIKGPVRCSREGMELFTHILTEYAMQLD---REQDFVVMGIFLGSLSKRWSVKEISERKATFITEIERVLILKENIFLKLYAQYDWRYICVTKYFRYRYVSFDKTEY--VKFFDEIPTEPYQSIFFDQEKAAFHFKRGGAHECCDPFIGPAIRQSMLYADAQIAECHRRQDFFGVHRWLLLKSLASKGGNNVAEGWRMMHSTASELNFLNCINKALQDLILYVLSDMTFAQTKDD 1084          
BLAST of SMED30026442 vs. TrEMBL
Match: A0A267EEN8 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004104g1 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 8.602e-28
Identity = 136/644 (21.12%), Postives = 294/644 (45.65%), Query Frame = 2
Query: 1445 LDFKDESLWKKSLESAENHWIEKVARSRKIIDFFMILENVLKLVQFESALVPEEFNFEVVKQEIILILNSPAYKLYTLTQQNLTLRQVMYSFHEHCRNDVVAFMFKNFIASLQSSLEDLRLK---NFVSFNKIVIKKLEKRIKKFLSKKPELI-SSEVMLELRYYNSVSSYLLWQIVQDIXXXXXXXXXXXINEIRVKYSQN--SKDEVLLLKSFEFANDVFLFTMKSDSSTQNALAETHNRDVLDLLTKENFGVY---------WKLFVNKFMSINSFNPTFNPINILAKYLHLASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIFGSKLSL-----SLFAGLSSKNLLKLVKIFDCGLYETKKDMLQAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICAKFYVKHEWRYLPLLKHFRFHFIEINKPQLHNVAYKDIANLERFQLLFFTEESAN-GFYQINSLESSERKIYEANEK----IDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFSVMETNSFSLISNE 3301
            +DF  +S  +K ++     W   +ARS  + + F ++ +++ L+  +   V +E   +V +      L S A ++++L  QN  +R+++ +F     + +V   F  +   ++  L+ +  +     ++  + +  +L         K   +I S + +L+LR+ N     +  ++V+ ++      +++ ++++R  Y +     ++ +   + E+  +  L + +        LAE    +  +++ +     Y         W+ F+   +S N+F    NP   L      A+++  L   +   +   L     +L++S   +Y++   + +G K SL     + +  LSS  L  LV       +  K+ + +A + T   G++S YG++ P +R +++ D+VYI  P  C  E  + F  ++ +  +++D      + V  GIF     KRWS+ EI +     + +I +   L   I  K Y +++WRY+ + K+FR+ ++  +K +   V + D    E +Q +FF +E A   F +  + E  +  I  A  +     D    +C R Q +      +L KSL ++   ++ E  ++ +S   +L++LN +NK +Q L+  V+   +F+   ++
Sbjct:  462 IDFSPDS--RKVIDPVRIAWERHIARSHFVPEAFDVVHHMILLMLLDRKSVSDEHFIQVHR-----FLRSSAARMHSLMMQNQFIREIIENFDRAEESQIVQRQFMEYRHGIKDLLDSVYRECSSEMITCGRAIETRLYDMSHSVEGKGSNIILSPKSVLDLRFINHYCYPIFLRLVE-VMLPQVPLITAFVDKLRKAYPEEVLRFEDAMPNPNVEYGYEEPLISKQHHQFIDTELAEAECNESKEIVKETVLMQYLLDTRVDEVWEGFMMDILSSNTFPQ--NPYPRLITDFRRAALKMSLCYDTDEKIVKDLYHSEPQLLDSTTFVYQMPGSDAYGYKSSLYAIDTAAYFALSS-FLFPLVH----ENFTEKRGVYRASVCTCTVGEVSTYGRLDPYLRQVQMADHVYIKGPVRCSREGMELFTHILTEYAMQLD---REQDFVVMGIFLGSLSKRWSVKEINERKATFITEIERVLILKENIFLKLYAQYDWRYICVTKYFRYRYVSFDKTEY--VKFFDEIPTEPYQSIFFDQEKAAFHFKRGGAHECCDPFIGPAIRQSMLYADAQIADCHRRQDFFGVHRWLLLKSLASKGENNVAEGWRMMHSTASELNFLNCINKALQDLILYVLSDMTFAQTKDD 1085          
BLAST of SMED30026442 vs. TrEMBL
Match: A0A210PWT5 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15985 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 3.751e-21
Identity = 102/407 (25.06%), Postives = 192/407 (47.17%), Query Frame = 2
Query: 2102 MKSDSSTQNALAETHNRDVLDLLTKENFGVYWKLFVNKFMSINSFNPTFNPINILAKYLHLASIRYDL---KSISVTNLQGKLATVNLELINSEFNLYKLKDVEIFGSKLSLSLFAGLSSKNLLKLVKIFDCGLYETKKDMLQAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQLV---IQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEI--KKNPRESLIQIGKCAELSN---TICAKFYVKHE-WRYLPLLKHFRFHFIEINKPQLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEANEK-----IDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFSVME 3271
            M  D+ST   +A      +L  L   +  + W  F+    +   F P  NP  +L   L   ++R DL   +S ++T  Q   +  N++L + + ++Y +  V+  G+  +L++    +   L + +K+F+   Y  +K   +  I   + G    YG++ P +  IEL +++YI  P GC  EA Q FA +V   + +L+K +  P        G +  + + RW+  EI  KKN       I +C  + +   T+  K YV  + WRY+P+ K+F FHF+  +  +   V Y D   +  +Q +F +++ A   YQ    ++    +  AN +     ++++  +      W      +L +SL+N+D   + E  ++ +S   Q+ Y+  + +T+Q L+  +ME
Sbjct:  701 MNKDTSTSKQIAR--EAVLLRYLVDTHVDLVWHDFLLDIATGEHFPP--NPYPLLVSILCQCAMRMDLCFERSDTIT--QRMWSAENMQLEDPDNHVYHIPGVDGHGTPSALAVLDTGAYVPLTETLKVFEQQSYIQRKGAYRVAICMAMCGPGILYGKMQPYLNEIELHEHIYIQGPPGCQGEAIQLFALIVYNHLSDLIKKEEIP------VMGAYFGDGQTRWTWAEIMTKKNGF-----ISECVAICSSKETVFMKAYVFLDLWRYVPVRKYFLFHFLTDDDVEA-EVFYPD-NPVAFYQSIFLSQDRAAFHYQNGGPKNGGSPMNGANTRTAHQFLNRMLGDAKLHCDWLTVHRGLLLRSLLNQDQYHIAEAWRMLHSMAAQIEYVIFMVETLQDLIQLMME 1088          
BLAST of SMED30026442 vs. TrEMBL
Match: R7UG63 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_227162 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 6.736e-18
Identity = 85/390 (21.79%), Postives = 170/390 (43.59%), Query Frame = 2
Query: 2195 WKLFVNKFMSINSFNPTFNPINILAKYLHLASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIFGSKLSLSLFAGLSSKNLLKLVKIFDCGLYETKKDMLQAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICAKFYVKHEWRYLPLLKHFRFHFIEINKPQLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEANEKIDKISY------ECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFSVMETNSFSLISNELNKTAKTS*FDSCDK 3346
            W  F+   +S  +F P  NP   L       +++ DL       ++ +L      L N E +++ +   E  G + +L L    S  +L+ L++ F    +  K+   +  + T + G  + +G++ P +R + L ++ YI  P GC  EA + + ++   N +K +L+   SN    G     S  RWSI ++ +  +       K       I  K +++ +WR +P+ KHFRFH+  +N  +  +  +      E ++ +FF EE A    Q + ++S     + ++   + + +         + Q WT     +L + LI ++   + +  ++F+S   Q  Y   + + +Q L    ++    S  S +     ++S  DS  +
Sbjct:  729 WPKFLIDLLSGPTFPP--NPFPRLVTTFRQCAMKMDLCYEKENKVRERLTHGAARLKNEEHHVHHIPGTEAHGLQSALRLLDSQSFSDLISLLQPFIQTNFMLKRGPYRVAVCTAVRGAATLFGRMDPYLREVILDEHCYIRGPDGCAVEASEIYTKITY-NFIK-ELS-EKSNHFISGFHIGTS--RWSIDDLIERKKAFAQDFEKACSKKEAIFVKIFIQQDWRLVPVEKHFRFHY--LNDDETSHETFFPYDPTEIYESVFFDEERAAFHVQYSDIKSLTSNPFGSSTVRNAVQFLEDHILSLAKRQNWTSVHRKLLLRDLILQESSMVVDSWRMFHSIASQFEYAIHLGRALQDLTLLCIDRRGKSHGSVKEGSNRQSSQADSVSQ 1109          
BLAST of SMED30026442 vs. TrEMBL
Match: A0A2T7PH72 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_08219 PE=4 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 7.680e-18
Identity = 101/371 (27.22%), Postives = 174/371 (46.90%), Query Frame = 2
Query: 2246 FNPINILAKYLHL---ASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIFGSKLSLSLFAGLSSKNLLKLVKIFDCGL----YETKKDMLQAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQLVIQNLLK-IDLNPSTSNLVCQGIFAEESKKRWSIMEI---KKNPRESLIQIGKCAELSNTICAKFYVKHE-WRYLPLLKHFRFHFIEINKPQLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEANEKI--DKISYECCRSQK---WTKYFEAILTKSLINE-DLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFSVMETNSFSLISNEL 3304
            F P N   ++L L     ++ DL    V+ L+ +L T  + +I++   ++ L   + FG + +L +   +     + + K+ +  L    Y  +K   +  I  G+    + YG++ P +  IEL ++ YI  P GC  +A Q F ++V  ++ + IDL    ++    GI     K RWS ++I   ++   E L  +  CA     I  K Y+K E WRYL + K+F  HFI  +   L N  Y        ++ +FFT+E A   YQ +            N +I    +  E  R+Q+   W   +  +L KSLI + D  +  E  ++F+S  GQ +Y+  + +++Q L+F  +E   +S   NEL
Sbjct:  572 FMPANPYPQFLGLMRACCMKMDLFYEKVSTLESRLMTSGIYIIDANNFIFHLPGCDAFGPESALIM---MDPGAYVPIYKLIEENLTNKSYIHRKGPYRVGICLGMVAPSTLYGKMSPYLHSIELHEHYYIQGPLGCEADARQLFGRMVQAHVAEMIDL----ASFPVYGIVMGNDKIRWSWVDIINKRQGFWEELEMV--CAR-KEPIVLKAYIKTEDWRYLRVNKYFLLHFITDDS--LENTKYFPENPAIFYETVFFTKERAAFHYQNDGPPRGGNPNSLTNARIVGQYLDREILRTQEEADWIMAYRYLLLKSLITKRDSGAAAEAWRMFHSVAGQAAYVASLCESLQDLVFLTLEYMEYS-SQNEL 929          
BLAST of SMED30026442 vs. Ensembl Nematostella
Match: EDO41913 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2Z8])

HSP 1 Score: 73.1738 bits (178), Expect = 6.782e-13
Identity = 123/601 (20.47%), Postives = 251/601 (41.76%), Query Frame = 2
Query: 1631 EIILILNSPAYKLYTLTQQNLTLRQVMYSF--HEHCRNDVVAFMFKNFIASLQ----SSLEDLRLKNFVSFNKIVIKKLEKRIKKFLSK---KPELISSEVMLELRYYNSVSSYLLWQIVQDIXXXXXXXXXXXINEIRVKYSQNSKDEVLLLKSFEFA------------NDVFLFTMKSDSST--QNALAETHNRDVLDLLTKENFGVYWKLFVNKFMSINSFNPTFNPINILAKYLHLASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIFGSKLSLSLFAGLSSKNLLK-----LVKIFDCGLYETKKDMLQAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICA------KFYVKHEWRYLPLLKHFRFHFIEINKPQLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEAN-----EKIDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFSVMETNSFSLISNELNKTA 3316
            E + ++ S +YKL+ + ++N  L+ ++  F   E   + +V   + ++  S+Q    + L++ R + ++   +++++KL+    K  S    +   +  EV+ EL   N   + ++  +V D LS C            V++    +D+   L SF               +++FL   +   +   Q  +A +  R  L       F    + F+   +S +   P  NP   L  +L LA+   +L       L  KL   + +L++S+ +++     E +G+  ++S     +   LL+     + K+  C      +   +A +   + G    YG++ P +  IEL ++ +I  P     +A Q+F +L                    G+F   ++ R S+ EI    R         A L++T+ A      K YV+ +WR + + K F  H+IE    +      K    L  +Q +F ++E A+ F +    +        AN       +D +         +   +  +LT+SL+ ++   + E   + +S   QL YL  +N+T+Q L++  + + +F+  S + + ++
Sbjct:  496 EAMHLVQSSSYKLHLIIEKNFHLQDLIKHFLAKESSDSHLVQSQYLDYRRSIQMLFFNELQE-RSREYMVAGRVLLEKLDAIAIKPTSPNQTRALPLCDEVLKELDVINRYCTTVMMGMVDDALSFCPHL---------VRHFPTLEDKTRDLSSFRHTKHGVEMPSLMTQDNMFLNVEQGKQAIGLQGPIATSSTR--LKYFVDTRFDETLETFLGDLLSGSCLPP--NPYPRLVSHLRLAANSMELLGEKRDRLLSKLLPDSAQLVDSQNHIFHPPGCEAYGTLSAVSSIDSRAYNELLEKLRFVINKVNPC----ITEIGFKATVGACLTGFSPLYGRLMPYVHEIELEEHYFIRGPRHAKADAIQYFNKL--------------------GVFLGLAEVRRSLQEIVPTQRRKAF----VALLTSTVNAKQPVYIKVYVQMDWRLVLVKKSFMLHYIEGAFTKYERFYTKSPLGL--YQNVFSSQEVASLFVRSCGPQDRGDPCGGANLSLSMVHVDHVIERARHDGNYLDIYRWLLTRSLMKQESSFVFEAWCMMHSTPAQLEYLQTLNRTLQALVYEEL-SRTFAPASQDADHSS 1051          
BLAST of SMED30026442 vs. Planmine SMEST
Match: SMESG000054136.1 (SMESG000054136.1)

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 400/407 (98.28%), Postives = 403/407 (99.02%), Query Frame = 2
Query: 2102 MKSDSSTQNALAETHNRDVLDLLTKENFGVYWKLFVNKFMSINSFNPTFNPINILAKYLHLASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIFGSKLSLSLFAGLSSKNLLKLVKIFDCGLYETKKDMLQAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICAKFYVKHEWRYLPLLKHFRFHFIEINKPQLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEANEKIDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFSVMETNSFSLISNELNKTAKT 3322
            MKSDSSTQNALAET NRDVLDLLTKENFGVYWKLFVNKFMSINSFNP FNPINILAKYLH ASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIFGSKLSLSLFAGLSSKNLLKLVKIFDCGLYETKKDMLQAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICAKFYVKHEWRYLPL+KHFRFHFIEINK QLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEANEKIDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLF+VMETNSFSLISNELNKTAK+
Sbjct:    1 MKSDSSTQNALAETQNRDVLDLLTKENFGVYWKLFVNKFMSINSFNPAFNPINILAKYLHFASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIFGSKLSLSLFAGLSSKNLLKLVKIFDCGLYETKKDMLQAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICAKFYVKHEWRYLPLVKHFRFHFIEINKLQLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEANEKIDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFAVMETNSFSLISNELNKTAKS 407          

HSP 2 Score: 148.288 bits (373), Expect = 2.540e-37
Identity = 69/72 (95.83%), Postives = 72/72 (100.00%), Query Frame = 3
Query: 3318 RRPDLTAVTNSFRCYYYVITKLFDNESLRHIYMLEEILSILNEICFMDTKSQQIDIIPSSENIQKMEQLRQV 3533
            +RPDLTAVTNSFRCYYYVITKLFDNESLRHIYMLEEILSILNEICFMD+KSQQIDIIPSSENIQKMEQLRQ+
Sbjct:  408 KRPDLTAVTNSFRCYYYVITKLFDNESLRHIYMLEEILSILNEICFMDSKSQQIDIIPSSENIQKMEQLRQI 479          
BLAST of SMED30026442 vs. Planmine SMEST
Match: SMESG000054136.1 (SMESG000054136.1)

HSP 1 Score: 502.286 bits (1292), Expect = 2.586e-169
Identity = 243/246 (98.78%), Postives = 245/246 (99.59%), Query Frame = 2
Query: 2588 MIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICAKFYVKHEWRYLPLLKHFRFHFIEINKPQLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEANEKIDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFSVMETNSFSLISNELNKTAKTS 3325
            MIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICAKFYVKHEWRYLPL+KHFRFHFIEINK QLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEANEKIDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLF+VMETNSFSLISNELNKTAKTS
Sbjct:    1 MIELIDYVYITAPHGCITEACQFFAQLVIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKCAELSNTICAKFYVKHEWRYLPLVKHFRFHFIEINKLQLHNVAYKDIANLERFQLLFFTEESANGFYQINSLESSERKIYEANEKIDKISYECCRSQKWTKYFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFAVMETNSFSLISNELNKTAKTS 246          
BLAST of SMED30026442 vs. Planmine SMEST
Match: SMESG000054144.1 (SMESG000054144.1)

HSP 1 Score: 248.825 bits (634), Expect = 1.558e-76
Identity = 121/124 (97.58%), Postives = 122/124 (98.39%), Query Frame = 2
Query:  479 MSSERKNDESIFGLYPIMRVSDPCALYTPRNLANILHSLSTRSFQLASSTESLTVQSILSLAGRSISIGGIYPYVESYDFRMDFFFHILLTQIQNAVDSFYDAINYHLNFVVKSNGAIILDITI 850
            MSSERKNDESIFGLYPIMRVSDPCALYTPRNLANILHSLSTRSFQLASSTESLTVQSILSLAGRSISIGGIYPYVESYDFRMDFFFHILLTQIQNAVDSFYDAINYHLNFVVKSNGAIIL + I
Sbjct:    1 MSSERKNDESIFGLYPIMRVSDPCALYTPRNLANILHSLSTRSFQLASSTESLTVQSILSLAGRSISIGGIYPYVESYDFRMDFFFHILLTQIQNAVDSFYDAINYHLNFVVKSNGAIILGMKI 124          
BLAST of SMED30026442 vs. Planmine SMEST
Match: SMESG000046463.1 (SMESG000046463.1)

HSP 1 Score: 248.825 bits (634), Expect = 1.558e-76
Identity = 121/124 (97.58%), Postives = 122/124 (98.39%), Query Frame = 2
Query:  479 MSSERKNDESIFGLYPIMRVSDPCALYTPRNLANILHSLSTRSFQLASSTESLTVQSILSLAGRSISIGGIYPYVESYDFRMDFFFHILLTQIQNAVDSFYDAINYHLNFVVKSNGAIILDITI 850
            MSSERKNDESIFGLYPIMRVSDPCALYTPRNLANILHSLSTRSFQLASSTESLTVQSILSLAGRSISIGGIYPYVESYDFRMDFFFHILLTQIQNAVDSFYDAINYHLNFVVKSNGAIIL + I
Sbjct:    1 MSSERKNDESIFGLYPIMRVSDPCALYTPRNLANILHSLSTRSFQLASSTESLTVQSILSLAGRSISIGGIYPYVESYDFRMDFFFHILLTQIQNAVDSFYDAINYHLNFVVKSNGAIILGMKI 124          
BLAST of SMED30026442 vs. Planmine SMEST
Match: SMESG000046458.1 (SMESG000046458.1)

HSP 1 Score: 204.912 bits (520), Expect = 2.359e-61
Identity = 101/103 (98.06%), Postives = 101/103 (98.06%), Query Frame = 2
Query: 2102 MKSDSSTQNALAETHNRDVLDLLTKENFGVYWKLFVNKFMSINSFNPTFNPINILAKYLHLASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIF 2410
            MKSDSSTQNALAET NRDVLDLLTKENFGVYWKLFVNKFMSINSFNP FNPINILAKYLHLASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIF
Sbjct:    1 MKSDSSTQNALAETQNRDVLDLLTKENFGVYWKLFVNKFMSINSFNPAFNPINILAKYLHLASIRYDLKSISVTNLQGKLATVNLELINSEFNLYKLKDVEIF 103          
The following BLAST results are available for this feature:
BLAST of SMED30026442 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G6I52.563e-2821.27Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EEN88.602e-2821.12Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A210PWT53.751e-2125.06Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
R7UG636.736e-1821.79Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A2T7PH727.680e-1827.22Uncharacterized protein OS=Pomacea canaliculata OX... [more]
back to top
BLAST of SMED30026442 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO419136.782e-1320.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30026442 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026442 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000054136.12.540e-3798.28SMESG000054136.1[more]
SMESG000054136.12.586e-16998.78SMESG000054136.1[more]
SMESG000054144.11.558e-7697.58SMESG000054144.1[more]
SMESG000046463.11.558e-7697.58SMESG000046463.1[more]
SMESG000046458.12.359e-6198.06SMESG000046458.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026442 ID=SMED30026442|Name=SMED30026442|organism=Schmidtea mediterranea sexual|type=transcript|length=3789bp
AATTATTTTACTTTGAAATTTTTACTTGTTAAATATCAATAAATTGTTTT
TTGGCTAATTTCTTTAAAAATTCTTTAATAAATTGTTTTTTTTGATATTT
TAACTTTATTGGTACGACATGATTGAAGAAAAATTAAATGAAGCCCTCGG
AAAAGAAGTGGCGGAATCATACATTATTAGTTTAATTAACGAATATCAGG
AACATCTTTATTTCACAAAAAAGATTACAAGATCTTCATATGGTTCATTT
TATAATTCTATTTGTAATTTACGAAAAGCTATTCTCCATCCACAATTTAT
AAACAGTTTCAAAAATTCTATAATAAAAATCAAACAAGTGAAAATTGATT
CTTTTAATCCTTATCCAATAATAATCAAGGAAATTCAAAATTGTTGTCTT
AGAAAAACGGATAATATTATTATTTTTGAAAATATTCCCGAGCCGACAAA
TATTGTACATCTTTATAAGCTATACTTTATGTCATCTGAACGCAAGAATG
ATGAAAGTATTTTTGGTTTATATCCTATAATGAGAGTTTCTGATCCATGT
GCCTTATATACGCCAAGGAATCTAGCCAATATATTGCATTCCTTATCAAC
TAGATCGTTTCAATTAGCTTCTTCAACCGAGTCACTTACTGTGCAGTCCA
TCTTATCGTTGGCTGGAAGGTCAATTTCAATTGGTGGAATATATCCATAT
GTCGAAAGTTATGATTTTAGAATGGATTTCTTTTTCCATATACTGTTGAC
TCAGATTCAAAATGCTGTGGATAGTTTCTATGATGCAATTAATTATCATT
TGAATTTTGTGGTGAAATCTAATGGTGCAATTATTCTTGACATAACAATA
CCAAATATTTCATCTGAAAAGAACAAAGTGGTATTTGATAATTATTTAGT
GTTGTCCCACAGTGATTGGAACAATGAGAATATAGCTGTTAGGAATCAAG
TAAACAGATTAGCCTACATTCACGTCATTGAAGGCCAGAGTGTTCCTTTT
ATTATTGTGGAATTATTATTGAATAATAACTGTACAGTGAACCATATTCC
TGTAAATAAATATGAAAAAGTACGAATTCAATATACGATAAACGCTCTTC
AATATAAAGAAATAAAGCAGCAGAAAGAAATTTGGTCGTTTTTCGGAAAC
AACGAAAGCAATTTCTTGCACAATATGCTAGAAAGTGTATTTTTCGACCA
GGCTTCGGCAGAAGTGTATATGACACATTTATTAAAAAAGACTACACATT
TAGCCGACAGTGATCTCACTGGAAGTTCTCAAAGCGGTTCAATTAATAAT
AACGTCATTTCGGCTATTTCAAATAAAGGAATACCCTCCACAAATCTAAT
ATTTGAAGAAAAGCCAAAGATTTTCGAAAAATTTAAATTTTCCAACGATT
TAATAATGAAAGAAACAAATACTAGACAGAAAGTTTTGCAGAATTTAGAT
TTTAAAGATGAGAGTCTTTGGAAAAAATCGCTTGAATCAGCCGAAAATCA
CTGGATAGAAAAAGTAGCTAGAAGTAGAAAAATTATAGATTTTTTCATGA
TTCTTGAAAATGTATTAAAGCTCGTCCAATTTGAAAGTGCGTTAGTTCCA
GAAGAATTTAATTTTGAAGTTGTGAAGCAAGAGATAATTTTAATTTTGAA
TTCACCTGCATATAAACTTTATACACTCACTCAACAAAATTTGACATTGA
GGCAAGTAATGTACAGCTTCCACGAACACTGCCGAAATGATGTTGTTGCC
TTTATGTTTAAAAACTTTATTGCTAGTCTACAAAGTTCATTGGAGGATCT
CAGGTTGAAAAATTTCGTATCATTTAATAAAATTGTCATAAAGAAACTTG
AAAAAAGAATAAAGAAATTTCTTAGTAAAAAGCCAGAATTAATTTCCAGT
GAAGTGATGCTGGAACTAAGGTATTATAATTCAGTCTCCTCCTATCTGCT
ATGGCAGATTGTTCAAGATATTCTCAGCAGTTGTTGCCAACAATTGTCAA
GTCTTATTAATGAGATTCGAGTAAAATATTCACAAAATAGTAAAGATGAA
GTATTATTGTTGAAAAGCTTCGAATTTGCAAATGATGTGTTTTTATTTAC
CATGAAATCAGATTCATCTACACAGAATGCACTTGCCGAAACTCATAATC
GTGATGTACTGGACCTTCTAACAAAAGAAAATTTTGGAGTTTATTGGAAG
TTATTTGTAAATAAATTCATGTCAATCAATTCATTTAATCCTACATTCAA
TCCTATTAATATATTAGCTAAATATTTGCATTTGGCGTCAATACGATATG
ATCTCAAATCAATTTCGGTTACTAATTTACAAGGAAAATTAGCTACTGTC
AATCTGGAACTAATAAATTCAGAATTCAATCTATACAAATTGAAAGACGT
TGAAATATTCGGTTCAAAATTATCACTGTCTCTGTTTGCTGGTCTTTCAA
GTAAAAATTTGTTGAAGTTAGTCAAAATCTTTGATTGTGGACTTTATGAA
ACTAAAAAAGACATGTTACAGGCATTCATATCAACTGGAATTTATGGCCA
ATTATCATTTTATGGACAAATTTATCCCAATATCAGAATGATTGAATTAA
TAGATTATGTATACATTACAGCCCCACATGGCTGCATAACTGAAGCCTGT
CAATTTTTTGCTCAATTAGTGATACAGAATTTACTCAAGATAGATCTAAA
CCCTTCAACCAGCAATTTGGTATGTCAAGGAATATTTGCCGAAGAATCGA
AAAAGAGATGGAGTATCATGGAAATTAAAAAAAATCCACGCGAATCATTG
ATTCAAATTGGAAAATGTGCTGAATTATCAAACACTATTTGTGCAAAATT
TTATGTAAAACATGAATGGCGATATTTACCGCTACTCAAACACTTCCGGT
TTCACTTTATTGAAATCAATAAACCGCAGCTTCACAATGTGGCTTACAAA
GATATTGCAAATTTGGAAAGATTTCAATTATTATTTTTTACTGAAGAAAG
TGCAAATGGTTTTTACCAAATTAACTCTTTGGAAAGCTCTGAAAGGAAAA
TATACGAAGCCAATGAGAAAATTGACAAAATTTCTTATGAGTGCTGCCGA
TCTCAAAAATGGACAAAATACTTTGAAGCTATATTGACAAAAAGTTTAAT
AAATGAAGATTTAAAATCTATGGAAGAGATGGCTAAAATTTTCTATAGTT
TCTTCGGTCAATTAAGCTATTTAAATATAGTAAATAAGACAATTCAGCAT
TTACTTTTCTCCGTGATGGAAACGAATTCGTTTTCATTAATATCAAATGA
ATTGAATAAAACTGCTAAGACGTCCTGATTTGACAGCTGTGACAAACAGT
TTTAGATGTTACTATTATGTCATCACTAAATTATTTGACAATGAAAGTTT
ACGTCATATCTATATGTTGGAAGAAATATTATCTATTTTAAATGAGATTT
GTTTCATGGATACTAAAAGTCAACAAATTGACATAATTCCATCTTCTGAA
AATATTCAAAAAATGGAACAGTTAAGACAGGTTAAATCATTTAAAATTTT
ATTATTGAAAAACAAACTTAATGAGTTTGAAATTCATTTTGAAAAATTGA
GTTTAATGAATTTTATAGTTTAAAATAAGTAAAGTTTATGAGAGTGATCC
TATACACATTAAGCCTCTCTTATATATGGGTGAATTATCGACAAATTAAG
GCCTAATATAAGGTATAATTTATGTATACATATAGAAAATATATACACCT
ACTTTGAAATAATGACAAAGGTTATGTGGATATATTTTA
back to top

protein sequence of SMED30026442-orf-1

>SMED30026442-orf-1 ID=SMED30026442-orf-1|Name=SMED30026442-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1070bp
MIEEKLNEALGKEVAESYIISLINEYQEHLYFTKKITRSSYGSFYNSICN
LRKAILHPQFINSFKNSIIKIKQVKIDSFNPYPIIIKEIQNCCLRKTDNI
IIFENIPEPTNIVHLYKLYFMSSERKNDESIFGLYPIMRVSDPCALYTPR
NLANILHSLSTRSFQLASSTESLTVQSILSLAGRSISIGGIYPYVESYDF
RMDFFFHILLTQIQNAVDSFYDAINYHLNFVVKSNGAIILDITIPNISSE
KNKVVFDNYLVLSHSDWNNENIAVRNQVNRLAYIHVIEGQSVPFIIVELL
LNNNCTVNHIPVNKYEKVRIQYTINALQYKEIKQQKEIWSFFGNNESNFL
HNMLESVFFDQASAEVYMTHLLKKTTHLADSDLTGSSQSGSINNNVISAI
SNKGIPSTNLIFEEKPKIFEKFKFSNDLIMKETNTRQKVLQNLDFKDESL
WKKSLESAENHWIEKVARSRKIIDFFMILENVLKLVQFESALVPEEFNFE
VVKQEIILILNSPAYKLYTLTQQNLTLRQVMYSFHEHCRNDVVAFMFKNF
IASLQSSLEDLRLKNFVSFNKIVIKKLEKRIKKFLSKKPELISSEVMLEL
RYYNSVSSYLLWQIVQDILSSCCQQLSSLINEIRVKYSQNSKDEVLLLKS
FEFANDVFLFTMKSDSSTQNALAETHNRDVLDLLTKENFGVYWKLFVNKF
MSINSFNPTFNPINILAKYLHLASIRYDLKSISVTNLQGKLATVNLELIN
SEFNLYKLKDVEIFGSKLSLSLFAGLSSKNLLKLVKIFDCGLYETKKDML
QAFISTGIYGQLSFYGQIYPNIRMIELIDYVYITAPHGCITEACQFFAQL
VIQNLLKIDLNPSTSNLVCQGIFAEESKKRWSIMEIKKNPRESLIQIGKC
AELSNTICAKFYVKHEWRYLPLLKHFRFHFIEINKPQLHNVAYKDIANLE
RFQLLFFTEESANGFYQINSLESSERKIYEANEKIDKISYECCRSQKWTK
YFEAILTKSLINEDLKSMEEMAKIFYSFFGQLSYLNIVNKTIQHLLFSVM
ETNSFSLISNELNKTAKTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR014010REJ_dom