Peptidase M60 domain-containing protein

Overview
NamePeptidase M60 domain-containing protein
Smed IDSMED30026439
Length (bp)3264
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase M60 domain-containing protein (SMED30026439) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase M60 domain-containing protein (SMED30026439) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase M60 domain-containing protein (SMED30026439) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase M60 domain-containing protein (SMED30026439) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026439

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30026439h1SMcG0000404 dd_Smed_v4_10257_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026439h1SMcG0000404 dd_Smed_v4_10257_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026439h1SMcG0000404 dd_Smed_v4_10257_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30026439h1SMcG0000404 dd_Smed_v6_10257_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30026439h1SMcG0000404 dd_Smed_v4_10257_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30026439h1SMcG0000404 dd_Smed_v4_10257_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 125.946 bits (315), Expect = 1.076e-28
Identity = 95/381 (24.93%), Postives = 169/381 (44.36%), Query Frame = 1
Query: 1921 IYLGIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG----DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            +  G+YL  G    V+ SE A +    + I  H  D+   +   + P    +  +   E RS+S  +GGLL +   +  +   V +     +  P +    + + +   + ++  +PW  LA D  +  +P+ +L+ L DP PV+ +W  + +    L          E I AD Q   G+MHSGYPI   ++SV       +  +   ++   G WG +HE+GHN Q   + F   + E T N++++   E++ G             +  +    ++  G    D+N W      AL  Y QL+  FGWE + Q+  +Y+ L+ +P        +  ++ LW+ + S   K NL P +E W +P+  ++   L   P +
Sbjct:  545 VSTGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESV-------KEIINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQEAFGWEPFTQLFAEYQTLSHLP------KDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLPEW 906          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 125.561 bits (314), Expect = 1.291e-28
Identity = 95/381 (24.93%), Postives = 169/381 (44.36%), Query Frame = 1
Query: 1921 IYLGIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG----DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            +  G+YL  G    V+ SE A +    + I  H  D+   +   + P    +  +   E RS+S  +GGLL +   +  +   V +     +  P +    + + +   + ++  +PW  LA D  +  +P+ +L+ L DP PV+ +W  + +    L          E I AD Q   G+MHSGYPI   ++SV       +  +   ++   G WG +HE+GHN Q   + F   + E T N++++   E++ G             +  +    ++  G    D+N W      AL  Y QL+  FGWE + Q+  +Y+ L+ +P        +  ++ LW+ + S   K NL P +E W +P+  ++   L   P +
Sbjct:  441 VSTGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESV-------KEIINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQEAFGWEPFTQLFAEYQTLSHLP------KDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLPEW 802          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2 (TRPM8 channel associated factor 2 [Source:HGNC Symbol;Acc:HGNC:26878])

HSP 1 Score: 125.561 bits (314), Expect = 1.291e-28
Identity = 95/381 (24.93%), Postives = 169/381 (44.36%), Query Frame = 1
Query: 1921 IYLGIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG----DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            +  G+YL  G    V+ SE A +    + I  H  D+   +   + P    +  +   E RS+S  +GGLL +   +  +   V +     +  P +    + + +   + ++  +PW  LA D  +  +P+ +L+ L DP PV+ +W  + +    L          E I AD Q   G+MHSGYPI   ++SV       +  +   ++   G WG +HE+GHN Q   + F   + E T N++++   E++ G             +  +    ++  G    D+N W      AL  Y QL+  FGWE + Q+  +Y+ L+ +P        +  ++ LW+ + S   K NL P +E W +P+  ++   L   P +
Sbjct:  441 VSTGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESV-------KEIINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQEAFGWEPFTQLFAEYQTLSHLP------KDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLPEW 802          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF2C (TRPM8 channel associated factor 2C [Source:HGNC Symbol;Acc:HGNC:53641])

HSP 1 Score: 124.405 bits (311), Expect = 1.919e-28
Identity = 95/381 (24.93%), Postives = 169/381 (44.36%), Query Frame = 1
Query: 1921 IYLGIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG----DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            +  G+YL  G    V+ SE A +    + I  H  D+   +   + P    +  +   E RS+S  +GGLL +   +  +   V +     +  P +    + + +   + ++  +PW  LA D  +  +P+ +L+ L DP PV+ +W  + +    L          E I AD Q   G+MHSGYPI   ++SV       +  +   ++   G WG +HE+GHN Q   + F   + E T N++++   E++ G             +  +    ++  G    D+N W      AL  Y QL+  FGWE + Q+  +Y+ L+ +P        +  ++ LW+ + S   K NL P +E W +P+  ++   L   P +
Sbjct:  338 VSTGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESV-------KEIINEMDMRSRGVWGPIHELGHNQQWHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQQAFGWEPFTQLFAEYQTLSHLP------KDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLPEW 699          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Match: TCAF1 (TRPM8 channel associated factor 1 [Source:HGNC Symbol;Acc:HGNC:22201])

HSP 1 Score: 114.775 bits (286), Expect = 3.182e-25
Identity = 97/390 (24.87%), Postives = 174/390 (44.62%), Query Frame = 1
Query: 1930 GIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISG-NNSWSLKNYW--IDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF----LPLDFLTEM 3066
            G+Y+P      V+  E A +   ++ I  H  D+      ++ P   I        T+SI+  +GGLL I   ++ +   V +     +  P +    + + +     ++   PW  LA D  +  +P+ +LR L +P P++ +W  + +    L          + I AD Q   G+MH+GYPI   ++SV       +  +    I   G WG +HE+G N Q   + F   + E T N++ +   E++ G   S +    W  + EK ++ ++   K  +  NW  N   AL  Y QL+  FGWE + ++  +Y+    +P        + +K+ LW+   S+  + NL P +E W +P+  ++   L   P +    + L  LT+M
Sbjct:  548 GLYIPGRQIIEVSLPEAAASADLKIQIGCHTDDLTRASKLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPVTVKGAVHAPYYKLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVARLGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESV-------QELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLS--KGPNVKNW--NAWTALETYLQLQEAFGWEPFIRLFTEYRNQTNLP------TENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYLPEWKENIMKLYLLTQM 919          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 59.6918 bits (143), Expect = 1.207e-8
Identity = 38/126 (30.16%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  103 IGLSCIQCKSSFFQDIERCRFTQ-----IGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNS 465
            I +     +SS   ++ R   T       G +Y G    T SG+ C  W       F +   P  +N  N+CRNP G  + PWC+ +   G  EYC++  C  D+Y   + D   E S K  +S S
Sbjct:  304 IPVMSTALQSSPVAEVNRGHLTHWCYVNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPELMNSKNYCRNPGGKKSRPWCY-SKPMGQEEYCDVPQCPSDMYPHLN-DKKVEGSTKGGVSES 427          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 59.6918 bits (143), Expect = 1.240e-8
Identity = 38/126 (30.16%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  103 IGLSCIQCKSSFFQDIERCRFTQ-----IGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNS 465
            I +     +SS   ++ R   T       G +Y G    T SG+ C  W       F +   P  +N  N+CRNP G  + PWC+ +   G  EYC++  C  D+Y   + D   E S K  +S S
Sbjct:  330 IPVMSTALQSSPVAEVNRGHLTHWCYVNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPELMNSKNYCRNPGGKKSRPWCY-SKPMGQEEYCDVPQCPSDMYPHLN-DKKVEGSTKGGVSES 453          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Match: cam-1 (Tyrosine-protein kinase receptor cam-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EGK5])

HSP 1 Score: 59.3066 bits (142), Expect = 1.461e-8
Identity = 38/126 (30.16%), Postives = 55/126 (43.65%), Query Frame = 1
Query:  103 IGLSCIQCKSSFFQDIERCRFTQ-----IGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNS 465
            I +     +SS   ++ R   T       G +Y G    T SG+ C  W       F +   P  +N  N+CRNP G  + PWC+ +   G  EYC++  C  D+Y   + D   E S K  +S S
Sbjct:  171 IPVMSTALQSSPVAEVNRGHLTHWCYVNSGTQYEGTVAQTSSGKQCAPWIDSTSRDFNVHRFPELMNSKNYCRNPGGKKSRPWCY-SKPMGQEEYCDVPQCPSDMYPHLN-DKKVEGSTKGGVSES 294          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.3 (si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-13])

HSP 1 Score: 124.02 bits (310), Expect = 3.213e-28
Identity = 108/406 (26.60%), Postives = 178/406 (43.84%), Query Frame = 1
Query: 1843 PGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVT--SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLS-ISCTEDK-ERVHLRFLDVIIVPIFDSRNSLISKHWLEK-KDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            P   N RV+      +  N   S E I  G+YL PG +T +T   EI   N+ ++ +     ++       + P    +F L S E   +   +GGL+  ++  E K + V +     +  P F S  + ++  W+ K +   +PW  L  +  V  LPS  +RNL  P  V  +W  + +    L         +E    D Q   G+MHSGYPI  L  S +   N  E         +H  WG LH++GHN Q  ++ F   + E T N++++   E + G N          +   +   EY   G DF NW  N   AL  Y QL+  FGW+ ++++   Y  +  +P        +  K+ L+    S +   NL P +++W +P+ P  + +L+  P++
Sbjct:  522 PTVSNARVR------ITANTADSEEWISTGLYLCPGMKTYITIPQEIIGTNW-QVQLGCQTNNIGGSNVLKRAPVVHERFPLDS-EKVQVCNLWGGLIYFVAPPESKVDGVEIVVQTAVQAPYFKSGETSVAD-WVGKIRQRPAPWAELEFENLVMTLPSDFIRNLERPDQVAKLWDAIMRSVSDLAATPAKFPRKERFVGDVQISAGFMHSGYPIMMLSSSASELLNVKEAH-------KHDFWGPLHKLGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNKAKAHPCMTLQSRQERIKEYFSGGKDFENW--NTWTALETYMQLQEKFGWDAFKKVFSLYHDMKDVP------NDNAGKMNLYAKTFSKVVNHNLSPFFKVWGWPIQPNTEQELSHLPAW 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.2 (si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-33])

HSP 1 Score: 121.709 bits (304), Expect = 1.567e-27
Identity = 107/406 (26.35%), Postives = 175/406 (43.10%), Query Frame = 1
Query: 1843 PGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVT--SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLS-ISCTEDK-ERVHLRFLDVIIVPIFDSRNSLISKHWLEK-KDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            P   N RV+      +  N   S E I  G+YL PG +T +T   EI    + ++ +     ++       + P    +F L S E   +   +GGL+  ++  E K + V +     +  P F S  + ++  W+ K +   +PW  L  +  V  LPS  +RNL  P  V  +W  + +    L         +E    D Q   G+MHSGYPI  L  S +   N  E         +H  WG LHE+GHN Q  ++ F   + E T N++++   E + G N          E       +Y   G D  NW    + AL  Y QL+  FGW+ ++++   Y  +  +P   N       K+ L+    S +   NL P +++W +P+ P  + +L+  P++
Sbjct:  518 PTVSNARVR------ITANTADSEEWISTGLYLSPGMKTYITIPPEIIGTKW-QVQLGCQTDNIGGSNVLKRAPVVHERFPLDS-EKVQVCNLWGGLIYFVAPPESKVDGVEIVVQTAVQAPYFKSGETSVAD-WVGKIRQRPAPWAELEFENLVMTLPSDFIRNLERPDEVAKLWDAIMRSVSDLAATPAKFRRKERFVGDVQISAGFMHSGYPIMMLSSSASQLLNVKEAH-------KHDFWGPLHELGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNKAKAHPCMTLESRQACIKKYFSGGKDLKNWTK--ATALETYMQLQEKFGWDAFKKVFSLYHDMKDVP---NDNAG---KMNLYAKTFSKVVNHNLSPFFKVWGWPIQPNTEQELSHLPAW 899          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-210b2.4 (si:ch211-210b2.4 [Source:ZFIN;Acc:ZDB-GENE-131122-12])

HSP 1 Score: 121.324 bits (303), Expect = 2.005e-27
Identity = 107/406 (26.35%), Postives = 176/406 (43.35%), Query Frame = 1
Query: 1843 PGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVT--SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLS-ISCTEDK-ERVHLRFLDVIIVPIFDSRNSLISKHWLEK-KDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            P   N RV+      +  N     E I  G+YL PG +T +T   EI +  + ++ +     D+   K   + P    +F L S E   +   +GGL+  ++  + K + V +     +  P F S  + ++  W+ K +   +PW  L  +  V  LPS  +RNL  P  V ++W  + +    L         +E    D Q   G+MHSGYPI  L  S +   N  E         +H  WG LHE+GHN Q  ++ F   + E T N++++   E + G N          E       +Y   G D  NW    + AL  Y QL+  FGW+ ++++   Y  +  +P   N       K+ L+    S +   NL P ++ W +P+ P  + +L+  P++
Sbjct:  522 PTVSNARVR------ITANTAGCEEWISTGLYLSPGMKTYITIPPEIIEKKW-QVQLGCQTDDIGRLKILKRAPVVHEQFPLDS-EKVQVCNLWGGLIYFVAPPKSKVDGVEIVVQTAVQAPYFKSGETSVAD-WVGKIRQRPAPWAELEFENLVMTLPSDLIRNLERPDEVAELWDAIMRSVSDLAATPAKFPRKERFVGDVQISAGFMHSGYPIMMLSSSASQLLNVKEAH-------KHDFWGPLHELGHNQQRKVWEFPPHTTECTCNLWSVYVHEKVLGVNRAKAHPCMTLESRQACIKKYFSGGKDLKNWTK--ATALETYMQLQEKFGWDAFKKVFSLYHDMKDVP---NDNAG---KMNLYAKTFSKVVNHNLSPFFKTWGWPIQPNTEQELSHLPAW 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 108.612 bits (270), Expect = 2.015e-23
Identity = 99/401 (24.69%), Postives = 170/401 (42.39%), Query Frame = 1
Query: 1855 NQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHET--RVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLS-ISCTEDK-ERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            N RV+      +  N     E I  G+YL PG +T   V  EI   N+ ++ +     ++       + P    +F L S E   +   +GGL+  I+ ++ K + V +     +  P F S  + ++      +   +PW  L  +  +    S  +RNL+ P  V  +W  + +    L  R      +E   AD Q   G+MH+GYPI     S     N  E +       + G WG +HE+GHN Q  ++ F   + E T N+++L   E + G  S +                Y   G D N+W     +AL  Y QL+  FGW+ ++++   Y  +  +P        +  K+ L+    S +  +NL P ++ W +P+ P  +  L+  P++
Sbjct:  526 NARVR------ITANTGGCEEWISTGLYLSPGMKTYIAVPPEIVGKNW-QVQLGCQTDNIGGSNTLKRAPVVHARFPLDS-EMVQVWNLWGGLIYLIAPSQTKVDGVEIVVQTAVQAPYFKSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAY-------KCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKMYFDGGKDLNSWCM--WMALETYMQLQEKFGWDAFKKVFSLYHDMTGVP------NDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHLPAW 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:162193 (zgc:162193 [Source:NCBI gene;Acc:323315])

HSP 1 Score: 108.612 bits (270), Expect = 2.015e-23
Identity = 99/401 (24.69%), Postives = 170/401 (42.39%), Query Frame = 1
Query: 1855 NQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHET--RVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLS-ISCTEDK-ERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            N RV+      +  N     E I  G+YL PG +T   V  EI   N+ ++ +     ++       + P    +F L S E   +   +GGL+  I+ ++ K + V +     +  P F S  + ++      +   +PW  L  +  +    S  +RNL+ P  V  +W  + +    L  R      +E   AD Q   G+MH+GYPI     S     N  E +       + G WG +HE+GHN Q  ++ F   + E T N+++L   E + G  S +                Y   G D N+W     +AL  Y QL+  FGW+ ++++   Y  +  +P        +  K+ L+    S +  +NL P ++ W +P+ P  +  L+  P++
Sbjct:  526 NARVR------ITANTGGCEEWISTGLYLSPGMKTYIAVPPEIVGKNW-QVQLGCQTDNIGGSNTLKRAPVVHARFPLDS-EMVQVWNLWGGLIYLIAPSQTKVDGVEIVVQTAVQAPYFKSGETSVADWVSHIRQAPAPWAELEFENLIMTFDSAFIRNLDRPDEVAKLWDTIMRTITDLAARPPKLPRKERFVADVQISYGFMHAGYPIMMHSGSAPGLVNVEEAY-------KCGLWGAIHELGHNQQRGVWEFPPHTTECTCNLWSLYVHEQVFGIKSANAHPAITPADRQARTKMYFDGGKDLNSWCM--WMALETYMQLQEKFGWDAFKKVFSLYHDMTGVP------NDNAGKMNLYAQTFSKVVNLNLSPFFKAWGWPIQPNTEQNLSHLPAW 903          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045101.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 124.405 bits (311), Expect = 3.651e-28
Identity = 106/380 (27.89%), Postives = 179/380 (47.11%), Query Frame = 1
Query: 1930 GIYLPPGHETRVTSEIAKA--NFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVII-----VPIF-DSRNSLISKHWLEK-KDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVE-YIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYP 3033
            G+YL P  +T V    A A     ++ +  H  D+  +  +Y+ P    K  ++  E   +S  +GGLL I     KER +L  + V +      P +   + SL S  WL+  +D   PW  L  +  +  +PS ++R+LNDP  ++  W  +      L     T    E I AD Q   G+MH+GYP+   + SV       +Y    + + + G WG +HE+GHN Q  ++ F   + E T N++++   E++ G       N  ++     + +E Y+K G    NW  N   AL  Y QL+  FGWE ++Q+ + Y+ ++ +      +  +  K+ LW  + S   + NL P +E W +P+  + + KL+  P
Sbjct:  533 GLYLSP-KKTAVLVFPASAVQQGLQVQVGCHSDDLGSKDEFYRAPIVVRKISVHR-EKVQVSCYWGGLLYIIV---KERSNLGTIPVQVYGAEPAPTYIKGKTSLDS--WLQSLRDLPPPWAELITENIILTVPSDAIRSLNDPEELLGFWDRMMVAITELAAIPTTFSRPERIVADVQISAGWMHAGYPVMVHLASV-------KYLTNLSCMQKEGLWGPIHELGHNQQQKVWEFPPHTTEATCNLWSVFVNETVVGVPR-DKANSALEPASRAACIEAYLKTGPKLENW--NVWTALETYLQLQEGFGWEPFKQLFKDYQSMSGI------SNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSALP 889          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045039.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 109.383 bits (272), Expect = 1.447e-23
Identity = 72/262 (27.48%), Postives = 125/262 (47.71%), Query Frame = 1
Query: 2257 SPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEH-GRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYP 3033
            +PW  L  +  +  +PS ++R+L+DP  ++ +W  +      L     T    E   AD Q   G+MH+GYPI   ++S           L   N+ +  G WG +HE+GHN Q I + F   + E T N++++   E++ G            E       EY+KNG +   W  +   AL  Y QL+  FGWE ++++ + Y+ ++ +      +  +  K+ LW  + S   + NL P +E W +P+    ++KL++ P
Sbjct:  644 APWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHLESAKE--------LTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPRNKAHGSLQPETRACYIQEYVKNGSNLEQW--DVWTALETYLQLQEGFGWEPFKRLFKDYQSMSGI------SNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEATRIKLSVLP 889          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045059.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 108.612 bits (270), Expect = 2.203e-23
Identity = 73/262 (27.86%), Postives = 124/262 (47.33%), Query Frame = 1
Query: 2257 SPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEH-GRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYP 3033
            +PW  L  +  +  +PS ++R+L+DP  ++ +W  +      L     T    E   AD Q   G+MH+GYPI   ++S           L   N+ +  G WG +HE+GHN Q I + F   + E T N++++   E++ G            E       EY+KNG +   W  +   AL  Y QL+  FGWE ++Q+ + Y+ ++ +      +  +  K+ LW  + S   + NL P +E W +P+  + + KL+  P
Sbjct:  644 APWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHLESAKE--------LTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPRNKAHGSLQPETRACYIQEYVKNGSNLEQW--DVWTALETYLQLQEGFGWEPFKQLFKDYQSMSGI------SNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEETRSKLSALP 889          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000045084.1 (TRPM8 channel-associated factor 2 [Source:NCBI gene;Acc:100170200])

HSP 1 Score: 108.227 bits (269), Expect = 3.747e-23
Identity = 72/262 (27.48%), Postives = 124/262 (47.33%), Query Frame = 1
Query: 2257 SPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEH-GRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYP 3033
            +PW  L  +  +  +PS ++R+L+DP  ++ +W  +      L     T    E   AD Q   G+MH+GYPI   ++S           L   N+ +  G WG +HE+GHN Q I + F   + E T N++++   E++ G            E       EY+KNG +   W  +   AL  Y QL+  FGWE ++++ + Y+ ++ +      +  +  K+ LW  + S   + NL P +E W +P+    ++KL+  P
Sbjct:  644 APWAELITENIILTVPSDAIRSLSDPEALLSLWDKIMVSITELAAIPKTFPRPERFVADVQISAGWMHAGYPIMCHLESAKE--------LTDLNVMQTVGIWGPIHELGHNQQKINWEFPPHTTEATCNLWSVYVHETVLGIPRNKAHGSLQPETRACYIQEYVKNGSNLEQW--DVWTALETYLQLQEGFGWEPFKRLFKDYQSMSGI------SNDNKSKMNLWAEKFSEAVQTNLIPFFEAWGWPIEEATRIKLSALP 889          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000002244.1 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:100489234])

HSP 1 Score: 98.5969 bits (244), Expect = 3.114e-20
Identity = 90/376 (23.94%), Postives = 159/376 (42.29%), Query Frame = 1
Query: 1930 GIYLPPGHETRVT--SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIF-DSRNSLISKHWLEK-KDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYP 3033
            G+YLPP     +   +   +  F ++ +  H  D   ++   + P    +  +   +    SF +GGLL I    +     V +R       PI+   + SL S  WL   +   +PW  L  +  +  +PS ++R+L +P  ++ +W  +      L  +       E I AD Q   G+MH+GYPI   ++S        +     +++ + G WG +HE+GHN Q   + F   + E T N++ +   E++ G                     Y++NG +   W      AL  Y QL+   GW+ +R++ R        P +   +  +  K+ LW  + S   + NL P +E W +P+    + KL+  P
Sbjct:  511 GLYLPPRKAVVIEFPASAVQQGF-QVQVGCHSDDPSAKETLNRAPVVVRRIHVDRQKVPVSSF-WGGLLYIIVRSNSNFGTVPVRVYGAEPAPIYIKGKTSLDS--WLHSIRQLPAPWAELVTENIILTVPSDAVRSLKNPEALLSLWDRIMAAIADLAAKPKKFPRPERIVADVQISAGWMHAGYPIMCDLESA-------KELTDLHHMEKEGIWGPIHELGHNQQKTQWEFPPHTTEATCNLWAVYVHETVLGIPRDRAHGNLQPNVRTSRIKSYLQNGANLEQWDG--WTALETYLQLQEGLGWDPFRRLYRD-------PSISGMSNENTFKMNLWAEKFSRAAQTNLVPFFEAWGWPIDQSTRSKLSALP 866          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf3 (TRPM8 channel-associated factor 3 [Source:MGI Symbol;Acc:MGI:3042585])

HSP 1 Score: 136.732 bits (343), Expect = 3.441e-32
Identity = 104/382 (27.23%), Postives = 180/382 (47.12%), Query Frame = 1
Query: 1876 SSFDVNLNMEFSNEVIYLGIYLPPGHETRV--TSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTE--DKERVHLRFLDVIIVPIFDSRNSLISKHWLEK-KDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYI--KNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPV 2997
            S   + ++ +  N  +  G+YLP G   +V   SE   A   ++ I  H  ++   + +++ P     + L S +T SIS+ +GGLL I      +++ V +     +  P F        + W        +PW  LA D  +  +P+++L+ L DP+P++ +W  + +    L  R       E +  D Q   G++HSGYPI  LI  V       E  ++   I  HG WG++HE+GHN Q   +TF   + E   N++T+   E++  N      +  ++ +L +  ++Y   K    +NW      AL  Y QL+  FGWE + Q+   Y+ L+ +P       ++++K+ LW+ + S     NL P +E W +PV
Sbjct:  521 SPITIKISTDNDNSWVSTGLYLPEGQVAQVLLPSEATHAKL-KVLIGCHRDNISQARTYFRPPVMTYVYHLTSSQT-SISWLYGGLLYIMVPNKYNQDNVSVTIRGAVSAPYF-RLGKTTQEEWKNLITHSKAPWGELATDNIILTIPTVNLKELQDPYPLLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQISFGFLHSGYPIMGLISIV-------EGIISEFKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNLWTIYVHETVL-NIPREQAHPSLNPELRRQRIKYHLNKGAPLSNWIM--WTALETYLQLQEGFGWEPFIQVFADYRTLSGLP------QNNEDKMNLWVKKFSEAVHKNLAPFFEAWGWPV 883          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf2 (TRPM8 channel-associated factor 2 [Source:MGI Symbol;Acc:MGI:2385258])

HSP 1 Score: 127.487 bits (319), Expect = 2.586e-29
Identity = 104/377 (27.59%), Postives = 175/377 (46.42%), Query Frame = 1
Query: 1930 GIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFD-SRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDE-KIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            G+YL  G  T ++ SE A +   ++ I  H  D+      ++ P    +  +   + RS+S  +GGLL I   +  +   V +   + +  P +   + SL       +K+ G PW  LA D  +  +P+ SL+ L +P P++ +W  + +    L  +       E I AD Q   G+MHSGYPI   ++SV       +  ++  NI   G WG +HE+GHN Q   + F   + E T N++++   E++ G            E+  K   E+++ G    NW  N   AL  Y QL+  FGWE +  +  +Y+ +  +P        D+E K+ +W+   S   + NL P +E W +P+   +   L  YPS+
Sbjct:  549 GLYLLEGQSTEISVSEPAASAGLKVQIGCHTDDLTFAIKLFRAPVVTYQCCMNRTQ-RSVSCLWGGLLYIIVPKGCQLGPVSVTITNAVPAPYYKLGKTSLEEWKSCIQKNLG-PWGELATDNVILTVPTASLKTLENPEPLLQLWDEMMQAVARLASQPFPFQRPERIVADVQLSAGWMHSGYPIMCHMESV-------QELVSLANIRSKGLWGPIHELGHNQQCRGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHPQLKPEEREKRIKEHLQKGAPLQNW--NVWTALETYLQLQEVFGWEPFITLFAEYQTIFYIP-------EDNECKMNIWLKLFSEKVQKNLVPFFEAWGWPIQKDVAEDLACYPSW 907          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 111.309 bits (277), Expect = 3.201e-24
Identity = 104/397 (26.20%), Postives = 173/397 (43.58%), Query Frame = 1
Query: 1930 GIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLEKKDE-GSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISG-NNSWSLKNYW--IDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDD------EKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF----LPLDFLTEM 3066
            G+Y+P      V+  E A +   ++ I  H  D+      ++ P   I        T+SI+  +GGLL I   ++ +   V L     +  P F        + W  +  E   PW  LA D  +  +P+ +LR L +P P++ +W  + +    L G        + I AD Q   G+MH+GYPI   ++SV       +  +    I   G WG +HE+G N Q   + F   + E T N++ +   E++ G   S +    W  + EK ++ ++   K     +W  N   AL  Y QL+  FGWE + ++  +Y+         NQT S        +K+ LW+   S   + NL P +E W +P+  ++   L   P +    + L  LT+M
Sbjct:  548 GLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAP-FYKLGETSKEEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESV-------QELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLS--KGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYR---------NQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYLPEWKENIMKLYLLTQM 922          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 111.309 bits (277), Expect = 3.201e-24
Identity = 104/397 (26.20%), Postives = 173/397 (43.58%), Query Frame = 1
Query: 1930 GIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLEKKDE-GSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISG-NNSWSLKNYW--IDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDD------EKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF----LPLDFLTEM 3066
            G+Y+P      V+  E A +   ++ I  H  D+      ++ P   I        T+SI+  +GGLL I   ++ +   V L     +  P F        + W  +  E   PW  LA D  +  +P+ +LR L +P P++ +W  + +    L G        + I AD Q   G+MH+GYPI   ++SV       +  +    I   G WG +HE+G N Q   + F   + E T N++ +   E++ G   S +    W  + EK ++ ++   K     +W  N   AL  Y QL+  FGWE + ++  +Y+         NQT S        +K+ LW+   S   + NL P +E W +P+  ++   L   P +    + L  LT+M
Sbjct:  548 GLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAP-FYKLGETSKEEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESV-------QELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLS--KGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYR---------NQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYLPEWKENIMKLYLLTQM 922          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Match: Tcaf1 (TRPM8 channel-associated factor 1 [Source:MGI Symbol;Acc:MGI:1914665])

HSP 1 Score: 111.309 bits (277), Expect = 3.201e-24
Identity = 104/397 (26.20%), Postives = 173/397 (43.58%), Query Frame = 1
Query: 1930 GIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLEKKDE-GSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISG-NNSWSLKNYW--IDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDD------EKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF----LPLDFLTEM 3066
            G+Y+P      V+  E A +   ++ I  H  D+      ++ P   I        T+SI+  +GGLL I   ++ +   V L     +  P F        + W  +  E   PW  LA D  +  +P+ +LR L +P P++ +W  + +    L G        + I AD Q   G+MH+GYPI   ++SV       +  +    I   G WG +HE+G N Q   + F   + E T N++ +   E++ G   S +    W  + EK ++ ++   K     +W  N   AL  Y QL+  FGWE + ++  +Y+         NQT S        +K+ LW+   S   + NL P +E W +P+  ++   L   P +    + L  LT+M
Sbjct:  548 GLYIPGRQVIDVSVPESAASADLKIQIGCHTDDLTRASKLFRGPLV-INRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPLTVKGAVRAP-FYKLGETSKEEWKRRLLEYPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEMMQAVAKLGGETFPLRLPQRIVADVQISVGWMHAGYPIMCHLESV-------QELINEKLIRTKGLWGPVHELGRNQQRQEWEFPPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLS--KGPSVKHW--NAWTALETYLQLQEAFGWEPFIRLFTEYR---------NQTTSSSPPSDNVDKMNLWVKMFSQQVQRNLAPFFEAWGWPIQKEVATSLAYLPEWKENIMKLYLLTQM 922          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6QR59|TCAF3_MOUSE (TRPM8 channel-associated factor 3 OS=Mus musculus OX=10090 GN=Tcaf3 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.407e-31
Identity = 104/382 (27.23%), Postives = 180/382 (47.12%), Query Frame = 1
Query: 1876 SSFDVNLNMEFSNEVIYLGIYLPPGHETRV--TSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTE--DKERVHLRFLDVIIVPIFDSRNSLISKHWLEK-KDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYI--KNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPV 2997
            S   + ++ +  N  +  G+YLP G   +V   SE   A   ++ I  H  ++   + +++ P     + L S +T SIS+ +GGLL I      +++ V +     +  P F        + W        +PW  LA D  +  +P+++L+ L DP+P++ +W  + +    L  R       E +  D Q   G++HSGYPI  LI  V       E  ++   I  HG WG++HE+GHN Q   +TF   + E   N++T+   E++  N      +  ++ +L +  ++Y   K    +NW      AL  Y QL+  FGWE + Q+   Y+ L+ +P       ++++K+ LW+ + S     NL P +E W +PV
Sbjct:  521 SPITIKISTDNDNSWVSTGLYLPEGQVAQVLLPSEATHAKL-KVLIGCHRDNISQARTYFRPPVMTYVYHLTSSQT-SISWLYGGLLYIMVPNKYNQDNVSVTIRGAVSAPYF-RLGKTTQEEWKNLITHSKAPWGELATDNIILTIPTVNLKELQDPYPLLQLWDKMVRAVAKLAARPFPFQRAERVVLDKQISFGFLHSGYPIMGLISIV-------EGIISEFKIRSHGIWGVIHELGHNHQKSGWTFPPHTTEALCNLWTIYVHETVL-NIPREQAHPSLNPELRRQRIKYHLNKGAPLSNWIM--WTALETYLQLQEGFGWEPFIQVFADYRTLSGLP------QNNEDKMNLWVKKFSEAVHKNLAPFFEAWGWPV 883          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P6V7|TCAF3_RAT (TRPM8 channel-associated factor 3 OS=Rattus norvegicus OX=10116 GN=Tcaf3 PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.894e-30
Identity = 108/397 (27.20%), Postives = 184/397 (46.35%), Query Frame = 1
Query: 1876 SSFDVNLNMEFSNEVIYLGIYLPPGHETRVT--SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTE--DKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEG-SPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFK-GSEEVTNNIFTLAAMES---ISGNNSWSLKNYWIDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            S   + ++    N  +  G+YLP G   +VT  +E   A    L I  H+ ++   K + + P     + L S +T SIS+ +GGLL I   +  +++ V +     +  P F        + W    +   +PW  LA D  +  +P+++L+ L DP+P++ +W  + K    L  R       E I  D Q   G++HSGYPI  LI  V       E  +    I  HG WG+ HE+GHN Q   +TF+  + E   N++++   E+   I  + +    N  + ++ +K  +   K    +NW      AL  Y QL+  FGWE + Q+   Y+ L  +P       ++++K+ LW+ + S + + NL P ++ W +PV   +   L   P +
Sbjct:  521 SPMTIKISTGNDNSWVSTGLYLPEGQVAQVTLPTEATHAKLKVL-IGCHIDNISQAKTYIRPPVMTYVYHLTSSQT-SISWLYGGLLYIMVPDKYNQDNVSVTISGAVSAPYF-RLGKTTQEEWKNLIEHSKAPWGELATDNIILTIPTVNLKVLQDPYPLLQLWDKIVKAVAKLAARPFPFQRPERIVLDKQISFGFLHSGYPIMGLIIIV-------EGIINEFKIRSHGVWGVTHELGHNHQKPGWTFRPHTTEALCNLWSIYVHETVLNIPRDQAHPSLNPELRKQRIKDHLN--KGAPLSNWIV--WTALETYLQLQEGFGWEPFIQLFANYQTLTGLPQ------NNEDKMNLWVKKFSEVVQKNLAPFFKAWGWPVQHAVAKSLASLPEW 897          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q921K8|TCAF2_MOUSE (TRPM8 channel-associated factor 2 OS=Mus musculus OX=10090 GN=Tcaf2 PE=1 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 1.809e-28
Identity = 104/377 (27.59%), Postives = 175/377 (46.42%), Query Frame = 1
Query: 1930 GIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFD-SRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDE-KIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            G+YL  G  T ++ SE A +   ++ I  H  D+      ++ P    +  +   + RS+S  +GGLL I   +  +   V +   + +  P +   + SL       +K+ G PW  LA D  +  +P+ SL+ L +P P++ +W  + +    L  +       E I AD Q   G+MHSGYPI   ++SV       +  ++  NI   G WG +HE+GHN Q   + F   + E T N++++   E++ G            E+  K   E+++ G    NW  N   AL  Y QL+  FGWE +  +  +Y+ +  +P        D+E K+ +W+   S   + NL P +E W +P+   +   L  YPS+
Sbjct:  549 GLYLLEGQSTEISVSEPAASAGLKVQIGCHTDDLTFAIKLFRAPVVTYQCCMNRTQ-RSVSCLWGGLLYIIVPKGCQLGPVSVTITNAVPAPYYKLGKTSLEEWKSCIQKNLG-PWGELATDNVILTVPTASLKTLENPEPLLQLWDEMMQAVARLASQPFPFQRPERIVADVQLSAGWMHSGYPIMCHMESV-------QELVSLANIRSKGLWGPIHELGHNQQCRGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHPQLKPEEREKRIKEHLQKGAPLQNW--NVWTALETYLQLQEVFGWEPFITLFAEYQTIFYIP-------EDNECKMNIWLKLFSEKVQKNLVPFFEAWGWPIQKDVAEDLACYPSW 907          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|A6NFQ2|TCAF2_HUMAN (TRPM8 channel-associated factor 2 OS=Homo sapiens OX=9606 GN=TCAF2 PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 5.168e-28
Identity = 95/381 (24.93%), Postives = 169/381 (44.36%), Query Frame = 1
Query: 1921 IYLGIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG----DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            +  G+YL  G    V+ SE A +    + I  H  D+   +   + P    +  +   E RS+S  +GGLL +   +  +   V +     +  P +    + + +   + ++  +PW  LA D  +  +P+ +L+ L DP PV+ +W  + +    L          E I AD Q   G+MHSGYPI   ++SV       +  +   ++   G WG +HE+GHN Q   + F   + E T N++++   E++ G             +  +    ++  G    D+N W      AL  Y QL+  FGWE + Q+  +Y+ L+ +P        +  ++ LW+ + S   K NL P +E W +P+  ++   L   P +
Sbjct:  545 VSTGLYLLEGQNAEVSLSEAAASAGLRVQIGCHTDDLTKARKLSRAPVVTHQCWMDRTE-RSVSCLWGGLLYVIVPKGSQLGPVPVTIRGAVPAPYYKLGKTSLEEWKRQMQENLAPWGELATDNIILTVPTTNLQALKDPEPVLRLWDEMMQAVARLAAEPFPFRRPERIVADVQISAGWMHSGYPIMCHLESV-------KEIINEMDMRSRGVWGPIHELGHNQQRHGWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHEALSPPERERRIKAHLGKGAPLCDWNVWT-----ALETYLQLQEAFGWEPFTQLFAEYQTLSHLP------KDNTGRMNLWVKKFSEKVKKNLVPFFEAWGWPIQKEVADSLASLPEW 906          
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Match: sp|A6QLU7|TCAF2_BOVIN (TRPM8 channel-associated factor 2 OS=Bos taurus OX=9913 GN=TCAF2 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.267e-25
Identity = 97/396 (24.49%), Postives = 172/396 (43.43%), Query Frame = 1
Query: 1879 SFDVNLNMEFSNEVIYLGIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSI----SCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISG---NNSWSLKNYWIDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            + ++N      +  +  G+ LP G  T V   E A     +L I  H  +++      + P    +  +   E + +S  +GGLL +     C      + ++    +  P +    + +       ++  +PW  LA D  +  +P+  LR L DP P++ +W  + +    L  +       E I AD Q   G+MHSGYPI   ++SV+         +    +   G WG +HE+GHN Q   + F   + E T N++++   E++ G     +    +    E  +K+ +E  K     +WK     AL  Y QL+  FGWE + Q+  +Y+ L+ +P        +  K+ LW+ + S   + NL P +E W +PV  ++   L   P +
Sbjct:  530 TVEINARNPSDDAWMSTGLNLPNGQLTEVCLCEAAACAGLKLQIGCHTDNLMSASKLSRAPVVTHQCHMDRTE-QLVSNLWGGLLYVIVPTGCNLGPMSITIK--RAVPAPYYKLGETSLEAWRSCIQESPAPWGELATDNIILTVPTADLRALEDPEPLLRLWDEMMEAIARLAAQPFPFRRPERIVADVQISAGWMHSGYPIMCHLESVSE-------LIDETGMRSRGLWGPVHELGHNQQREQWEFPPHTTEATCNLWSVYVHETVLGIPRAQAHPALSPPERENRIKTHLE--KGAPLCDWKV--WTALETYLQLQEAFGWEPFTQLFAEYQTLSDIP------NDNPGKMNLWVRKFSEKVQKNLAPFFEAWGWPVEKEVASSLACLPEW 905          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3I0H4 (TRPM8 channel-associated factor 2-like OS=Lingula unguis OX=7574 GN=LOC106159184 PE=4 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 1.677e-56
Identity = 173/676 (25.59%), Postives = 314/676 (46.45%), Query Frame = 1
Query: 1207 KTVNIIEIDELSIANLHELVELNQTSNLLALW--NPREDNNEIFSEDILALVYRGLKLVIGISPW----LHDSGT--RLLETSFLKSI---FIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDYAIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFK--VFNHLTRA----NVPCLEMPLFHIKRFKRNLIKLMNFILLYPMGNIFVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVT------SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANP----RNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSW---SLKNYWIDE--KLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGEKLVSRTPKK 3138
            +T+  +++ E+S        +L    + + LW  +PR+   E F+E +LA +  G  LV G+ PW    L+   T   L  +  L  +   +I G +      + D++    H    +  +S  L+ +           +  V  L  + L   +F+ +          +FK  +  +L  A    N+P  + P  +   F+ ++  L     + P       PGI  +PG  + +  P+ +  +NL  +   + +  G Y+P G   +VT      ++++    C  + +  L +V  ++ W +WP+  +  +L +  T ++S  +GGLL     E    + +   +V+  P FD     I + W  +++    W  LA    VF +PS S+R ++DP  ++ +W      +  L G +     RE + AD Q   GYMH+GYPI + +  V +P       + +  + + +  +G WG+ HEIGHN+Q   +TF G  EVTNNIFTL   E+++GN++W   ++K +  ++  +LL+S          ++WK +P  AL +Y+QL   FGW  ++ + R Y+   K     NQ   D  KI +W    S + + NL P+ + W  P+   ++  L ++P+FLP D +T       ++++  Y G   + R+P +
Sbjct:   91 QTLEHVDLKEISFG-----CDLPPPGSCVLLWHLDPRKPTAE-FTEAVLAHLQYGGFLVCGMCPWGWLQLNPGKTLDELPHSPVLARLGLSYIQGYVNGQSLNVNDNMAQWAHIGRAIEDVSRDLNRS-----------EKYVELLSGMSLIPQSFRSL----------IFKENLIGYLNPAQLESNIPSPKSPA-NTSAFRASVRVLGMLYRMTPPQAFCKLPGIGVFPGDFSSK-PPLQTVRLNLTTKH-RQRLSTGYYVPAGQPVKVTVTSDQGTDLSGWKICIGAHDDSLVNV--KEPWRRWPDVAVLEELKA--TTALSSPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWAELAGRHIVFTVPSTSVREIDDPTTILALWDSAVAAQHDLRGTDRNLQKRERVVADEQPSAGYMHAGYPIVTHLD-VVDPNFQYNGSDNFVFSESGMKSYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAWNNPTMKKFRAEKLPRLLQS------QPSLSDWKKDPFFALCVYSQLAHEFGWRSFKTVFRLYENSVKKEEESNQ--DDGAKIDMWFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNYPG---IVRSPSR 720          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A2E5X6P1 (Peptidase M60 domain-containing protein OS=Planctomycetes bacterium OX=2026780 GN=CMK00_08720 PE=4 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 4.537e-56
Identity = 131/416 (31.49%), Postives = 204/416 (49.04%), Query Frame = 1
Query: 1810 NIFVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLL-SISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEY--FLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPL 3048
             +  A G   +PG+++   K I +  +      S E +  G+Y  PG   RV  +  KA    L I  H   +     W +WPN   +F+L   E   ++  FGGL+  +     K+ V L+F  V+  P+F S  S   KHWL ++D  +PW  LA +  +  +PS +LRNL+DP  + D W  + +    L GR++       + AD Q   GYMHSGYPI + +  V  P + ++Y   L  + +   G WG  HE+GHN Q   +TF G+ EVT N+FTL AM+ +SG   W+       ++  + F+E  K  DF  WK   +LAL +YAQ++  FGWE +  +  +Y+ L        +  +D  K   W+   S     NL P +  W  PV  +   +++    ++P+
Sbjct:  106 GVETAEGAELFPGAVHVDAKRIGA--IRRFRGASGEWLSTGLYAAPGEALRVRVKSGKATGWGLRIGAHSDSIFYHGEWRRWPNISHRFQLREKEV-WVASPFGGLIYVVPAGHMKDEVCLQFSHVVPAPLFRSFESNAEKHWLNERDAPAPWAELAGEYLILTVPSEALRNLDDPARITDYWDRVIQANCQLGGRSLPDRPERFV-ADVQISAGYMHSGYPIMTHL-DVTRPSDGHKYGRVLDIDWLEAEGSWGHFHELGHNRQRGEWTFDGAGEVTCNLFTLHAMDKVSGIEPWTHPFLDGAKEEYRDFIE--KGADFEVWKREHALALLMYAQVQHAFGWEPFYAVFAEYESLPDD----QRPRTDQGKRDQWLIRLSRAVDRNLGPFFVHWGIPVTEQALDQVSTLDPWMPV 510          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: V3ZHF7 (Peptidase M60 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_236481 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 3.775e-55
Identity = 144/509 (28.29%), Postives = 247/509 (48.53%), Query Frame = 1
Query: 1591 DMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHLTRANVPCLEMPLFHIKRFKRNLIKLMNFI--LLYPMGNIFVA-PGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFC--ELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKY 3102
            D   S L ++   D   + +Q  +K    ++ K+ +      +P  + P+        ++ K + F+  +L   GN +   PGI  +PG   +   P+S   + +  E        G Y+  G E  +     ++  C  E+ I  H   +       +WP    K K+     + +    GGL+ +   +   ++ +   + I  P+FD        +W   +     W  L     VF LP+ S+ +L DP  V++ W  +     HL G +     RE I AD Q   GYMHSGYPI + +  VA+P +++ + L +  + E G WG+ HE+GHN+Q   +TF+G+ EVT NIFTL AM+ I+  + W   + W++ K+ K+      +  F+ W+S+P +AL +YAQL + FGW  Y++  R+Y++ +  P    Q  +++EKI  W    S  ++ NL PL ++W  P+    + +L ++PSFLP D +T+ + +   E+  KY
Sbjct:  220 DNCCSTLSQI--NDCPVKVLQSVMKKSGEKVHKIISEKEHECIPSEKRPV------SSSIGKSVMFLHDVLAKTGNGYKKMPGIDLFPGDFTED-PPLSDGRIIIESEIP-AAHPTGFYVRAGEEVELEIVTEESLNCGWEIQIGCHSDHLQTSNAMKRWPIITEKQKITQKNLK-MKTPIGGLMYVWSPKMASKIIINVKNAIESPLFDLTQPETIINWKTNRQAPGLWADLGGHHIVFTLPAKSVGDLEDPTAVLESWDRVVCAHHHLRGTDPNSQRREWIVADVQPSCGYMHSGYPIVTHL-DVADP-SKSSFLLNNKTLLESGNWGLFHELGHNMQKPTWTFRGTGEVTCNIFTLHAMDVIAQKSPWI--HSWLEGKVPKARQFIRSSAGFSKWQSDPGIALFVYAQLYNQFGWSVYKKTFRQYEEQDMPP----QLKTEEEKIDYWFETMSKFSEYNLAPLADLWSIPLSDTCREQLKVFPSFLPDDEITQGVPEKVEELEKKY 709          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: R7UHN9 (Peptidase M60 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_195748 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 5.220e-54
Identity = 129/434 (29.72%), Postives = 222/434 (51.15%), Query Frame = 1
Query: 1822 APGISFYPGSINQRVKPISSFDVNLNMEFSNEVIY-LGIYLPPGH--ETRVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGE 3111
            APG+  +PG     V+      V +N++ +   I+   +YLP G   E  +          ++ I  H  D++    W + P   IK +L S +T  I   +GG +     +++ ++ +   +V+  P +       + HW+ ++D    W  LA    +  LPS S+++L DP  V+  W  +      +   +V+ + ++ I  D Q   GYMHSGYPI + +  VA+P + +++ L  + +   G WG+ HE+GHN+Q + +TF+G+ EVT N+FTL AM+ ++G   W   + W++ + + +   Y+  G DF  WK  P +ALGIYAQL    GW  Y+ + RKY+ ++       +  +DDEKI+LWI   +     NL  L+  W F +   L+  L   P FLP+D +T  + +   +++ ++ GE
Sbjct:  283 APGVHAFPGDFEGDVQHKC---VRINLDSARRDIFPAAVYLPAGETLEIEIHEGSTDPQKWKVWIGAHSDDLVRSSQWKRLPKVHIKQRL-SEDTNVIFSPYGGNVYFESPDEESQLDVTVSNVVESPCY-------TDHWIGQRDAPGLWADLAGRHIMITLPSSSIKDLVDPSEVLAFWDSVVAAHHVVRTTDVSSHRKQWIVCDVQPVVGYMHSGYPIVTHMD-VADPTS-DQFLLNHDKLKAEGNWGLYHELGHNMQRLEWTFQGTSEVTVNVFTLHAMDVVNGVKPWI--HPWLNNQ-MNAIKRYLMAGADFTTWKKEPGIALGIYAQLAHHLGWGTYKAVFRKYEVMSN----EQKPKTDDEKIRLWITTFAECCGQNLCALFRFWGFTIPNDLQRNLAELPLFLPMDEMTLFVPERIAKVVAEFDGE 696          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S3KG34 (TRPM8 channel-associated factor 2 OS=Lingula unguis OX=7574 GN=LOC106181552 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.902e-53
Identity = 166/657 (25.27%), Postives = 301/657 (45.81%), Query Frame = 1
Query: 1228 IDELSIANLHELVELNQTSNLLALW--NPREDNNEIFSEDILALVYRGLKLVIGISPW--LHDSGTRLLETSFLKSIFIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDYAIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHLT-RANVPCLEMPLFHIKRFKRNLIKLMNFILLYPMGNIFVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVT------SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANP----RNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSW---SLKNYWIDE--KLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGEKLVSRTPKK 3138
            ++ + +  +    +L    + + LW  +PR+   E F+E +LA +  G  LV G+ PW  L  +  + L+      +    GL      I    + V     N+   +++   AI  +      ++  V  L  + L   +F+ +  K       L    N     +N P  + P  +    + N+  L     + P       PGI  +PG  + +  P+ +  +NL  +   + +  G Y+P G   +V       ++++    C  + +  L +V  ++ W +WP+  +  +L +  T ++S  +GGLL     E    + +   +V+  P FD     I + W  +++    W  LA    VF +PS S+R ++DP  ++ +W      +  L G +     RE + AD Q   GYMH+GYPI + +  V +P       + +  + + +  +G WG+ HEIGHN+Q   +TF G  EVTNNIFTL   E+++GN++W   ++K +  ++  +LL++          N+WK +P  AL +Y+QL   FGW  ++ + R Y+   K     NQ   D  KI ++    S + + NL P+ + W  P+   ++  L ++P+FLP D +T       ++++  Y G   + R P +
Sbjct:   93 LEHVDLKEISSGCDLPPPGSCVLLWHLDPRKTTAE-FTEAVLAHLQYGGFLVCGMCPWGWLQLNPGKTLDELPHSPVLARLGLCYIQGYIDGQSLNVND---NMAQWAHI-GRAIEDVSRDLNRSERYVELLSGMSLIPQSFRSLMFKDN-----LIGYLNPAQLESNFPSPKSPA-NTSTLRANVRVLGMLYRMTPPQAFCKLPGIDVFPGDFSFK-PPLQTVRLNLTTKH-RQRLSTGYYVPAGQPVKVAVTSDQGTDLSGWKICIGAHDDSLVNV--KEPWRRWPDVAVLEELKA--TTALSSPYGGLLFFDSPERNAELTVIVCNVVEAPFFDLTKPEIVEDWSRRRNAPGLWTELAGRHIVFTVPSTSVREIDDPTTILALWDSAVAAQHDLRGTDPNFQKRERVVADEQPSAGYMHAGYPIVTHL-DVVDPNFQYNGSDNFVFSESGMKLYGNWGLFHEIGHNMQRKAWTFSGMGEVTNNIFTLYTYEAVTGNDAWNNPTMKKFRAEKLPRLLQT------QPSLNDWKKDPFFALCVYSQLAHEFGWGSFKTVFRLYENSVKKEEESNQ--DDGAKIDMYFGRFSEIVRHNLSPMCDFWGIPLSTGVRNNLTLFPAFLPNDEITAAGQARVDQVLPNYPG---IVRGPSR 720          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-210b2.3 (si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-13])

HSP 1 Score: 95.9005 bits (237), Expect = 1.158e-19
Identity = 102/414 (24.64%), Postives = 169/414 (40.82%), Query Frame = 1
Query: 1816 FVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHET--RVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSI----SCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYP 3033
            F+   I   P   N R++      V+ N     E I  G+YL PG  T   V +EI    + +L I      +       + P    +F L   +   +   +GGL+ +     C  D   V ++    I  P + S  + ++    E ++  +PW  L  +  +  L S  +R L+ P    D  +F  K  F                AD Q   G+MH+GYPI  +I S + P       +   +  + G WG +HE+GHN Q   + F   + E T N++++   E + G N  S       E+       Y   G   + W      AL  Y QL+  FGW+ ++++   Y  +N +P        ++ K+ L+    S +  MNL P ++ W +P+ P  +  L+  P
Sbjct:  514 FIITDIPNLPSVSNARIR------VSANTGDGEEWISTGLYLSPGMRTFVAVPAEIMDKGW-QLQIGCQTDHLGHADVLRRAPVVHERFAL-DKDMLQVWNLWGGLIYLIAPPKCKLDGVEVIVQ--TAIKAPYYKSGETSVANWMNEIRNAPAPWAELEFENIIITLQSEVIRQLDRP----DEVAFPRKERF---------------VADVQISHGFMHAGYPI--MILSCSAPE-----LVNPESARKFGIWGAIHELGHNQQRWAWEFPPNTTECTCNLWSVYVHEEVLGVNRASAHENMSPERRWGRAQSYAMGGRQLDQWSM--WTALETYMQLQDRFGWDAFKKVFTAYHTINNVP------GDNNGKMNLYAETFSKVVNMNLAPFFKAWGWPIQPSTEDALSSLP 883          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000051129.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:5658439:5662219:-1 gene:ENSAMXG00000036822.1 transcript:ENSAMXT00000051129.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.8037 bits (203), Expect = 3.162e-17
Identity = 56/214 (26.17%), Postives = 97/214 (45.33%), Query Frame = 1
Query: 2413 RELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG----DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            +E   AD Q   G+MHSGYPI  ++ +V+ P   N Y    ++      WG +HE+GHN Q   + F   + E T N++++   E + G            ++      +YI+ G    D+  W      AL  Y QL+  FGW+ ++++   Y  +  +P        +  K+ L+    S +   NL P ++ W +P+ P  + +L   P +
Sbjct:   17 KERFVADVQILAGFMHSGYPI--MMHTVSAPDLVNPYVSGKSDF-----WGPVHELGHNQQHSDWEFPPYTTECTCNLWSVYVHEVVLGVKKADAHGQMTPQRRQNRIKKYIEGGRNLKDWTVW-----TALETYMQLQEEFGWDAFKKVFAAYHDMTGVPQ------DNKGKMNLYAETFSKVVNRNLTPFFKAWGWPIQPSTEEQLCSLPEW 212          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018419.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 63.929 bits (154), Expect = 7.405e-10
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 1
Query:  172 IGMEYVGHQNFTESGRICESWNTI--NMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKEN 453
            IG +Y G ++ T+SG +C+ W +   +      R+ P    + NFCRNP G   GPWC+       WE C+I  C  +  +C   +Y  + S  E+
Sbjct:  104 IGTDYRGTKSKTKSGTLCQRWESTFPHKPNITPRSHPKADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDCTEECMHCSGENYRGKISTTES 199          

HSP 2 Score: 56.225 bits (134), Expect = 1.894e-7
Identity = 27/78 (34.62%), Postives = 39/78 (50.00%), Query Frame = 1
Query:  166 TQIGMEYVGHQNFTESGRICESWN--TINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCH 393
            T  G+ Y G  + T +G  C++W+  T +++ F  +  P      N CRNP G  NGPWC+       W+YC I  C 
Sbjct:  478 TGSGISYRGSVSKTVAGVTCQAWSASTPHLSSFTPQAHPDKGLDSNKCRNPDGDVNGPWCYTTDPNKKWDYCQIPECE 555          

HSP 3 Score: 52.373 bits (124), Expect = 2.812e-6
Identity = 33/107 (30.84%), Postives = 51/107 (47.66%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWNT--INMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDV------YNCKDTDYDFEYSGKENLSNSGR 471
            G  Y G  + TESG  C+ W++   + + ++    P    + N+CRNP G    PWCF  S    WE+C++S C           NC   D +  Y G  +++ SG+
Sbjct:  187 GENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYLEENYCRNPDGEPK-PWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNCTTGDGN-TYRGTVSVTESGK 291          

HSP 4 Score: 52.373 bits (124), Expect = 2.812e-6
Identity = 27/77 (35.06%), Postives = 37/77 (48.05%), Query Frame = 1
Query:  166 TQIGMEYVGHQNFTESGRICESWNT--INMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            T  G  Y G  + TESG+ C+SW +   + +     N P      N+CRNP      PWC+    +  WEYCN+  C
Sbjct:  274 TGDGNTYRGTVSVTESGKTCQSWASQLPHKHSRTPDNYPCKGLDQNYCRNPDN-ERKPWCYTTDPETRWEYCNVESC 349          

HSP 5 Score: 51.6026 bits (122), Expect = 5.277e-6
Identity = 26/74 (35.14%), Postives = 35/74 (47.30%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWNTINMNIFV--IRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            G  Y G    T SG+ C++W ++  +  V   +N P    + N CRNP G    PWC+       WEYC I  C
Sbjct:  371 GSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFPTADLRRNLCRNPDG-DRAPWCYTTDPSVRWEYCRIERC 443          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000018418.2 (plasminogen [Source:NCBI gene;Acc:103036400])

HSP 1 Score: 63.929 bits (154), Expect = 8.708e-10
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 1
Query:  172 IGMEYVGHQNFTESGRICESWNTI--NMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKEN 453
            IG +Y G ++ T+SG +C+ W +   +      R+ P    + NFCRNP G   GPWC+       WE C+I  C  +  +C   +Y  + S  E+
Sbjct:  115 IGTDYRGTKSKTKSGTLCQRWESTFPHKPNITPRSHPKADLESNFCRNPDGDKGGPWCYTTDPAKRWENCDIQDCTEECMHCSGENYRGKISTTES 210          

HSP 2 Score: 57.3806 bits (137), Expect = 8.869e-8
Identity = 28/81 (34.57%), Postives = 40/81 (49.38%), Query Frame = 1
Query:  166 TQIGMEYVGHQNFTESGRICESWN--TINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDV 402
            T  G+ Y G  + T +G  C++W+  T +++ F  +  P      N CRNP G  NGPWC+       W+YC I  C  D 
Sbjct:  489 TGSGISYRGSVSKTVAGVTCQAWSASTPHLSSFTPQAHPDKGLDSNKCRNPDGDVNGPWCYTTDPNKKWDYCQIPECALDT 569          

HSP 3 Score: 52.373 bits (124), Expect = 3.187e-6
Identity = 27/77 (35.06%), Postives = 37/77 (48.05%), Query Frame = 1
Query:  166 TQIGMEYVGHQNFTESGRICESWNT--INMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            T  G  Y G  + TESG+ C+SW +   + +     N P      N+CRNP      PWC+    +  WEYCN+  C
Sbjct:  285 TGDGNTYRGTVSVTESGKTCQSWASQLPHKHSRTPDNYPCKGLDQNYCRNPDN-ERKPWCYTTDPETRWEYCNVESC 360          

HSP 4 Score: 51.9878 bits (123), Expect = 3.326e-6
Identity = 33/107 (30.84%), Postives = 51/107 (47.66%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWNT--INMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDV------YNCKDTDYDFEYSGKENLSNSGR 471
            G  Y G  + TESG  C+ W++   + + ++    P    + N+CRNP G    PWCF  S    WE+C++S C           NC   D +  Y G  +++ SG+
Sbjct:  198 GENYRGKISTTESGLTCQRWDSQKPHNHGYMPSVFPEKYLEENYCRNPDGEPK-PWCFTESPAKRWEFCSVSRCTSPPPTIVPQLNCTTGDGN-TYRGTVSVTESGK 302          

HSP 5 Score: 51.2174 bits (121), Expect = 5.683e-6
Identity = 25/74 (33.78%), Postives = 36/74 (48.65%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWNTI--NMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            G  Y G    T SG+ C++W ++  + ++   +N P    + N CRNP G    PWC+       WEYC I  C
Sbjct:  382 GSSYRGVMTETISGKKCQAWASMEPHSHVKTPQNFPTADLRRNLCRNPDG-DRAPWCYTTDPSVRWEYCRIERC 454          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Match: mst1 (macrophage stimulating 1 [Source:NCBI gene;Acc:103025427])

HSP 1 Score: 59.6918 bits (143), Expect = 1.543e-8
Identity = 33/97 (34.02%), Postives = 49/97 (50.52%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDV-YNCKDTDY----DFEYSGKE 450
            G +Y G  + T+SG+ C+ W +   +       P +  +LN+CRNP G   GPWC+    +  +E CNI  C  +V  NC   DY    D   +G+E
Sbjct:  116 GEDYRGKVSKTQSGKTCQQWWSKFPHDHRWTPSPTNGLELNYCRNPDGDRIGPWCYTTDPERRYESCNIPLCKDEVCINCNGEDYRGQVDHTVNGRE 212          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000976.1 (pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 gene:ENSPMAG00000000885.1 transcript:ENSPMAT00000000976.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 8.888e-24
Identity = 86/365 (23.56%), Postives = 145/365 (39.73%), Query Frame = 1
Query: 1921 IYLGIYLPPGHETRVT-SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGE----TRSISFAFGGLLSISCTEDKE--RVHLRFLDVIIVPIFDSRNSLISKHWLE-KKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKG-SEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG-DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMW 2985
            +  G+Y PP     +    +A     ++ +  H   + D K   + P       +  GE       ++ ++GGLL +   E     ++ +R       P F    + + +HW E ++   +PW  LA D  +  +PS + R L DP  +M +W  +     +L          E I  D Q   G+MH+GYPI  ++   + P+  NE       +   G WG LHE+GHN Q   + F   + E TNN+F +   E + G             +  +   +++  G     W       L  Y QL+  FGW+ + ++   Y++    P      +S+      W    S     NL P +  W
Sbjct:  526 VSTGLYAPPAQRVLLDLPSLALGRGIQIQLGCHTDQLYDSKTMKRHPEVTRSMPVVRGEMDRGAMEVASSWGGLLYLLVPEGVSLGKIRVRVRGAARAPYFKLGETSL-QHWQEFERHYPAPWSELACDSLILTVPSEAARGLADPERLMRLWDRMTGAIAYLAAEPHPSARPERIVVDEQISHGWMHAGYPI--MVHRASIPKLLNE-----QEMRAEGMWGPLHELGHNRQRPAWNFPPHTTEATNNLFAVYVHEEVLGVARARAHPDLRPAERERRLRDHVDAGCPLAAWTVF--TCLETYLQLQEAFGWDPFVRLFGDYQRAASTPSTMEAKMSE------WAERFSRCVGRNLAPFFSAW 874          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001728.1 (pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 gene:ENSPMAG00000001561.1 transcript:ENSPMAT00000001728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.917e-9
Identity = 28/83 (33.73%), Postives = 40/83 (48.19%), Query Frame = 1
Query:  148 IERCRFTQIGMEYVGHQNFTESGRICESW--NTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            ++ C +T  G  Y G Q  T SG  C++W   T +++ +     P    + N+CRNP    NGPWC        WEYC +  C
Sbjct:    8 VDHC-YTGSGTGYRGLQTLTASGHQCQTWASKTPHLHAYTPEGFPEAGLENNYCRNPDSDPNGPWCITQDPNVLWEYCALQRC 89          

HSP 2 Score: 57.3806 bits (137), Expect = 6.182e-9
Identity = 32/87 (36.78%), Postives = 42/87 (48.28%), Query Frame = 1
Query:  136 FFQDIERCRFTQIGMEYVGHQNFTESGRICESW--NTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            F QD   C F   G  Y G Q  T  G+ C++W   + + + FV  N       L +CRNP G   GPWC+   S   W+YC I+ C
Sbjct:  204 FGQD---CVFGSRG--YRGAQAVTSGGKTCQAWASQSPHRHQFVPANYTDADLSLGYCRNPDGDLAGPWCYTTDSATRWQYCGIAHC 285          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003778.1 (pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 gene:ENSPMAG00000003419.1 transcript:ENSPMAT00000003778.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 1.601e-7
Identity = 28/81 (34.57%), Postives = 41/81 (50.62%), Query Frame = 1
Query:  163 FTQIGMEYVGHQNFTESGRICESW--NTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRD 399
             T  G +Y+G+ +FT+SGR C+ W  N  +   F   + P      NFCRNP    +GPWC+        E C++  C +D
Sbjct:  108 MTGNGEQYIGNVSFTKSGRQCQLWTSNFPHQVRFKPVDHPEKQLVENFCRNPDASQDGPWCYTRDPLVPREPCSVPTCDKD 188          

HSP 2 Score: 51.6026 bits (122), Expect = 8.411e-7
Identity = 27/80 (33.75%), Postives = 35/80 (43.75%), Query Frame = 1
Query:  172 IGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNF----CRNPTGFSNGPWCFINSSKGTWEYCNISFCHRD 399
             G +Y G  N T SGR C++W+       V R  PL           CRNP G   G WC+      T +YC + +C  D
Sbjct:  216 AGEDYRGPVNVTRSGRHCQAWSA--QTPHVSRYSPLTHRAAGLEGAACRNPDGDEEGAWCYTTDPGLTIDYCALHYCDED 293          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Match: hgfb (hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GENE-041014-3])

HSP 1 Score: 50.8322 bits (120), Expect = 1.190e-6
Identity = 23/78 (29.49%), Postives = 38/78 (48.72%), Query Frame = 1
Query:  163 FTQIGMEYVGHQNFTESGRICESWNTINMN--IFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            ++  G  Y G    T  G  C++WN  + +   +  ++ P    + + CRNP G   GPWCF +     W+YC++  C
Sbjct:  316 YSGSGTAYRGGVATTRHGLQCQAWNATSPHKPWYTPKSHPGAGLEGHSCRNPDGDPWGPWCFTSDPHLPWDYCSVEAC 393          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO30193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1H4])

HSP 1 Score: 57.7658 bits (138), Expect = 1.778e-10
Identity = 29/79 (36.71%), Postives = 37/79 (46.84%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWNTINMNIFVIRNLPL-----HLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHR 396
            G +Y G  NFT  G  C+ WN    +       PL      L K N+CRNP G  + PWC+    K  W+YC I  C +
Sbjct:    2 GRDYRGTMNFTAKGVTCQPWNEQWPHQHTEMADPLVAAREGLGKHNYCRNPGGRKHRPWCYTTLEKTRWQYCEIRSCRK 80          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO28926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T536])

HSP 1 Score: 51.9878 bits (123), Expect = 1.694e-8
Identity = 27/75 (36.00%), Postives = 41/75 (54.67%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWNT--INMNIFVIRNLPLHLNKLNFCRNPTGFS-NGPWCFINSSKGTWEYCNISFC 390
            G+ Y G+ N T+SG  C+ W++   + +       P  +N  NFCRNP G   +GPWC+  +    WEYC++  C
Sbjct:    7 GVGYHGNINVTKSGISCQPWSSQCPHHHYHNSTQYPELINASNFCRNPGGMGPDGPWCYTTNKLVRWEYCDVPKC 81          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO43993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX97])

HSP 1 Score: 55.4546 bits (132), Expect = 8.722e-8
Identity = 28/76 (36.84%), Postives = 39/76 (51.32%), Query Frame = 1
Query:  163 FTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            +   G +Y+G  N T+ G  C SW +         N P++    NFCRNP G    PWC+++  K T+EYC I  C
Sbjct:  133 YNGTGEDYIGRLNVTKYGMPCLSWKS---------NDPVYKLSHNFCRNPRGQHEAPWCYVD--KNTYEYCVIPKC 197          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO48215 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKA9])

HSP 1 Score: 53.5286 bits (127), Expect = 4.632e-7
Identity = 25/78 (32.05%), Postives = 37/78 (47.44%), Query Frame = 1
Query:  163 FTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLH--LNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            F   G  Y G+ + TE G  C+ WN    +  ++     H      N+CRNP G    PWCF    +  ++YC+I+ C
Sbjct:  254 FNGTGEHYNGNISVTEKGFGCQRWNVTTPHFHLMSPATYHELRGGHNYCRNPGGKKQRPWCFTTDPRQRYDYCDIAKC 331          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Match: EDO39763 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S935])

HSP 1 Score: 48.521 bits (114), Expect = 5.633e-7
Identity = 26/75 (34.67%), Postives = 40/75 (53.33%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWNT--INMNIFVIRNLPLHLNKLNFCRNPTGFS-NGPWCFINSSKGTWEYCNISFC 390
            G+ Y G+ N T+SG  C+ W++   + +          +N  NFCRNP G   +GPWC+  +    WEYC++  C
Sbjct:   16 GVGYHGNINVTKSGISCQPWSSQCPHRHYHNSTQYTELINASNFCRNPGGMGPDGPWCYTTNMMVRWEYCDVPKC 90          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-210b2.3 (TRPM8 channel-associated factor homolog [Source:NCBI gene;Acc:101159605])

HSP 1 Score: 101.679 bits (252), Expect = 2.076e-21
Identity = 89/400 (22.25%), Postives = 183/400 (45.75%), Query Frame = 1
Query: 1855 NQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVT--SEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPI-FDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTF-KGSEEVTNNIFTLAAMESISG-NNSWSLKNYWIDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSF 3039
            NQR+      ++++      E +  G+YL PG +T ++  +++ +  + ++ I     D L+ +   + P    +F + S E   +   +GGL+ +      +   +  +  + VP  +       ++ W   +   SPW  L  D  +  +PS ++R L  P  +  +W+ + K    L  +      +E   AD Q   G+MH+GYPI     +V      NE  +  +++   G WG +HE+GHN Q   + F   + E T N++++   E + G + + +  N  ++ +  ++     +  + N+W+    +AL  Y QL+  FGW+ ++++   Y ++++ P        +  K+ L+    S    M+L   ++ W +P+    + KL+  PS+
Sbjct:  532 NQRI------NIDVKTAGEKEWLSTGLYLSPGMKTYISIPAQMVQKGW-QIQIGCQT-DQLNAEELKRPPRVHEQFAVTS-EMMQVWNLWGGLIYLVAPPQADVHGVEVIVQMAVPAPYYKSGVTTAEAWSLLRTAPSPWAELEFDNIILTVPSEAVRTLERPEELAQLWNKIMKAIADLAAKPEKFPRKERFVADVQISHGWMHAGYPIMGQKSAV------NE-LVNVDHMKSCGLWGPIHELGHNQQRGCWEFPPNTTECTCNLWSVYVHEEVLGIDRAKAHPNMSLENRKSRARNYVTQGRNLNSWEM--WVALETYMQLQDKFGWDAFKKVFAAYLQMSQFP------GDNPGKMNLYTETFSQTVGMDLTAFFKAWGWPIQASTEQKLSNLPSW 907          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000032410.1 (pep primary_assembly:ASM223467v1:23:16283833:16285417:1 gene:ENSORLG00000025600.1 transcript:ENSORLT00000032410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 1.442e-7
Identity = 34/92 (36.96%), Postives = 47/92 (51.09%), Query Frame = 1
Query:  121 QCKSSFFQDIERCRFTQIGMEYVGHQNFTESGRICESWNTI--NMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            +CKS F   +  C  T  G +Y G  + TESGR C+ W++   + + F  +       K N+CRNP      PWCF    K  WEYC+I+ C
Sbjct:    2 KCKSLFPPKV--C-MTCNGEDYRGKVDHTESGRECQRWDSPRPHRHQFQPKKFRDKDLKDNYCRNPDNRLR-PWCFTMDPKTPWEYCDIAVC 89          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:101167035])

HSP 1 Score: 54.299 bits (129), Expect = 6.332e-7
Identity = 27/74 (36.49%), Postives = 38/74 (51.35%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWN--TINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            G +Y G  + TESG+ C+ W+    + ++F  +  P      N+CRNP G  + PWCF       WEYC I  C
Sbjct:  202 GEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDDNYCRNPNG-RHRPWCFTTDPNTPWEYCTIKVC 274          

HSP 2 Score: 53.1434 bits (126), Expect = 1.537e-6
Identity = 26/76 (34.21%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  163 FTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            +  +G  Y G Q+ T S   C  W   + +    R + +   + N+CRNP G  +GPWC+ N+S  +W+YC+I  C
Sbjct:  377 YESLGENYRGQQSRTRSNLPCGPWREHSNS--GERGMLMVGLEGNYCRNPDGDKHGPWCYTNNSAISWDYCSIKPC 450          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: hgfb (hepatocyte growth factor [Source:NCBI gene;Acc:101167035])

HSP 1 Score: 54.299 bits (129), Expect = 7.325e-7
Identity = 27/74 (36.49%), Postives = 38/74 (51.35%), Query Frame = 1
Query:  175 GMEYVGHQNFTESGRICESWN--TINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            G +Y G  + TESG+ C+ W+    + ++F  +  P      N+CRNP G  + PWCF       WEYC I  C
Sbjct:  196 GEDYRGPMDHTESGKECQRWDLDEPHKHLFHPKRYPDKGLDDNYCRNPNG-RHRPWCFTTDPNTPWEYCTIKVC 268          

HSP 2 Score: 52.7582 bits (125), Expect = 1.857e-6
Identity = 26/76 (34.21%), Postives = 41/76 (53.95%), Query Frame = 1
Query:  163 FTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFC 390
            +  +G  Y G Q+ T S   C  W   + +    R + +   + N+CRNP G  +GPWC+ N+S  +W+YC+I  C
Sbjct:  371 YESLGENYRGQQSRTRSNLPCGPWREHSNS--GERGMLMVGLEGNYCRNPDGDKHGPWCYTNNSAISWDYCSIKPC 444          
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Match: plat (plasminogen activator, tissue type [Source:NCBI gene;Acc:100049466])

HSP 1 Score: 52.373 bits (124), Expect = 2.506e-6
Identity = 31/81 (38.27%), Postives = 39/81 (48.15%), Query Frame = 1
Query:  172 IGMEYVGHQNFTESGRICESWNTINM-----NIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFI-NSSKGTWEYCNISFCHR 396
            +G  Y G    T+SG  C  W+   +     N +    L L L+  NFCRNP G S GPWC      + TWE C+I  C R
Sbjct:  171 LGKSYRGTAAVTKSGSACLPWDAPAVRRKRNNAWKSNALDLGLSNHNFCRNPDGDS-GPWCHTYKKMQLTWELCDIPKCSR 250          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000070472.1 (SMESG000070472.1)

HSP 1 Score: 2088.54 bits (5410), Expect = 0.000e+0
Identity = 1029/1031 (99.81%), Postives = 1029/1031 (99.81%), Query Frame = 1
Query:  124 CKSSFFQDIERCRFTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNSGRFYPCGNYXXXXXXXXXXXXXXQNDNYRDLCSTELSQQEYFGKYNLLKEIQNFTKVIHLKKLIDYVTVIMNVRKDVLSQDILRKIFVMSTDYNYRCQKDIEQYEMCQIIKEFRVKSQLRLIFVCKNPLKTIFVVSQLPKTGYQLKLILGPIHRIRNQINPDIYHYSKQFSERKKSEIGGIPLLKHTGYFILLLENSSPYVVSENKEVMIAISKIGKGTIGFVGNENYLKSNYRNLLQDFFRLISDSKTVNIIEIDELSIANLHELVELNQTSNLLALWNPREDNNEIFSEDILALVYRGLKLVIGISPWLHDSGTRLLETSFLKSIFIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDYAIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHLTRANVPCLEMPLFHIKRFKRNLIKLMNFILLYPMGNIFVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGEKLVSRTPKKLKTFIGPLTYTSRIEGKSAIRHFKVF 3216
            CKSSFFQDIERCRFTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNSGRFYPCGNYLNLSNFK NKKKLFQNDNYRDLCSTELSQQEYFGKYNLLKEIQNFTKVIHLKKLIDYVTVIMNVRKDVLSQDILRKIFVMSTDYNYRCQKDIEQYEMCQIIKEFRVKSQLRLIFVCKNPLKTIFVVSQLPKTGYQLKLILGPIHRIRNQINPDIYHYSKQFSERKKSEIGGIPLLKHTGYFILLLENSSPYVVSENKEVMIAISKIGKGTIGFVGNENYLKSNYRNLLQDFFRLISDSKTVNIIEIDELSIANLHELVELNQTSNLLALWNPREDNNEIFSEDILALVYRGLKLVIGISPWLHDSGTRLLETSFLKSIFIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDYAIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHLTRANVPCLEMPLFHIKRFKRNLIKLMNFILLYPMGNIFVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRF DVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGEKLVSRTPKKLKTFIGPLTYTSRIEGKSAIRHFKVF
Sbjct:  211 CKSSFFQDIERCRFTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNSGRFYPCGNYLNLSNFKFNKKKLFQNDNYRDLCSTELSQQEYFGKYNLLKEIQNFTKVIHLKKLIDYVTVIMNVRKDVLSQDILRKIFVMSTDYNYRCQKDIEQYEMCQIIKEFRVKSQLRLIFVCKNPLKTIFVVSQLPKTGYQLKLILGPIHRIRNQINPDIYHYSKQFSERKKSEIGGIPLLKHTGYFILLLENSSPYVVSENKEVMIAISKIGKGTIGFVGNENYLKSNYRNLLQDFFRLISDSKTVNIIEIDELSIANLHELVELNQTSNLLALWNPREDNNEIFSEDILALVYRGLKLVIGISPWLHDSGTRLLETSFLKSIFIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDYAIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHLTRANVPCLEMPLFHIKRFKRNLIKLMNFILLYPMGNIFVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFSDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGEKLVSRTPKKLKTFIGPLTYTSRIEGKSAIRHFKVF 1241          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026355.1 (SMESG000026355.1)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 386/1083 (35.64%), Postives = 594/1083 (54.85%), Query Frame = 1
Query:   88 FIGWIIGLSCI-QCKSSFFQDIERCRFTQIGMEYVGHQNFTESGRICESWNTINMNIF----VIRNLPLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNSG---------RFYP-----------CGNYXXXXXXXXXXXXXXQNDNYRDLCST-----ELSQQEYFGKYNLLKEIQNFTKVIHLKKLIDYVTVIMNVRKDVLSQDILRKIFVMSTDYNYRCQKDIEQYEMCQIIKEFRVKSQLRLIFVCKNPLKTIFVVSQLPKTGYQLKLILGPIHRIRNQINPDIYHYSKQFSE----RKKSEIGGIPLLKHTGYFILLLENSSPYVVSENKEVMIAISKIGKGTIGFVGNENYLKSNYRNLLQDFFRLISDSKTVNIIEIDELSIANLHELVELNQTSNLLA---LWNPREDNNEIFSEDILALVYRGLKLVIGISPWLHDSGTRLLETSFLKSIFIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDYAIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHLTRANVPCLEMPLFHIKRFKRNLIKLMNFILLYPMGNIFVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKL-LKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQ--TVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGEKLVSRTPKKLKTFIGPLTYTSRIEGKSAIRHFKVF 3216
            ++ ++I L  + +  SS+F DIE C+ T  G E++G  + T++G+ C +W    +N      +I      L   N+CRNPT F NGPWC I+ +   WEYCNI  C +D   CKDT+   EY G  N + SG         R +P            GN     +        +  +N R+ C       + SQ EYFG Y+ LK I +   +I L  +   V   ++++ + L+ DIL K  + +TDYN +CQ D+++YE C I++         + + C  PL+ +  +S L KT Y +K   G +++I  + +     Y  + +E    + K+E+  I   +  G+F L   N+  Y  + + ++ + IS +GKG I F+  +  + S Y   L+D F  + + +   +     L+   L E++  N   + L    +WN   +  E     +L LV  GL+++IG+ PW + +  + +  S LK +F A G+WPSL    ++  TV       +PL   L+YA +    +  V+  IV  + ++P+  V  +   + ++  ++ L+  +  L +  +PC E+ L       ++L++  NFIL  P G   + PG+SFYPG  +    P+    + LN+ +  EV  LG+Y  P  +  V    +K+ FC + INYH FDV ++   YKWP T ++F +   +  + SF+FGGLLSISC ED ++V + F +V+ +P+FD RN    K W+ K+   SPW ++A+D  VF+L S ++RNL DP   ++++  + K EFHL+GR +    RE++SAD Q   GYMHSGYPIG+ I  V NP N  +YF    N+   G WG++HE+GHNLQ+ +FTF G  EVTNNIFTL A+ES++  +SWS  N W+ EKL +K  V++I NG F NWK N  LAL IYAQ ++ FGWEF+ Q+ R+Y       +L N+   +SD++KIQLWI  TS ++ MNL PLYE+WR+P+  K + +L+    FLP DFLT+M+ K  +EII K+GG K V RTP  +   IGPLT    IEG   I   ++ 
Sbjct:    3 YLCFLIALPLLSRLTSSYFTDIENCKITTHGREFIGRTSITKNGQQCITWKEEFINKLQAGKIINYDSKSLIGNNYCRNPTNFPNGPWCIIDENTLKWEYCNIKSCIKDRNWCKDTENGREYLGDVNYTKSGKDCNPWINQRTHPKDSFPEKNLNLVGNKCRNPDMSEGPWCYYSTENKREECDVPKCDKKFSQIEYFGGYDFLKLIPDQMTIISLDNIYQDVKATVSIKLESLNSDILNKTSLWATDYNPKCQTDLDEYEYCTIVESKSEDENYIISYSCLEPLRHLMFISPLKKTEYTIKY-SGKLYKINWKPSERFTEYENKVNEYLQKKNKNELK-IQSDQIPGHFFLFSNNAIAYATNADNQIPVTISTVGKGRIAFLAADGVVDSIYFPQLKDLFNDVYEKQ---VESPTYLTKEYLQEIISKNSHESALLEPFIWNAHNELGEELVGTLLQLVNSGLRIIIGVKPWAYVTYHKKILDSELKILFQAAGVWPSLIYADNNWKTVTKHSVYTMPLYQRLEYAKLNANTLQNVSGAIVDIISKIPVEKVLSEINFNLIRESIFDLYSNYLPLIKGLIPCWEVGL--TDESNKSLLRFFNFILASPFGKRIIVPGLSFYPGKFHSNDIPLKDIKMRLNLIYHKEVAQLGLYAIPRVDISVKITQSKSQFCRIFINYHHFDVSEKPEMYKWPKTYVEFSIERNKVETFSFSFGGLLSISCDEDNDKVEITFNNVVEIPLFDRRNKKDIKDWIHKQTLVSPWAVVASDTLVFVLSSNAIRNLADPNSFLELFDVMVKEEFHLIGRTIASSRREMVSADIQIGAGYMHSGYPIGTKIFWVTNPANEKDYFFHMYNLNIDGEWGLMHEVGHNLQESIFTFNGVGEVTNNIFTLVAIESMTNKSSWSPTNGWVPEKLYVKDLVDHINNGTFQNWKENDFLALAIYAQQRNSFGWEFFAQVFRRYN------VLKNELGNISDEDKIQLWIKTTSEISGMNLCPLYELWRWPISQKTENELSKLQMFLPDDFLTKMVEKRVDEIISKFGGAKSVLRTPLTIPEKIGPLTNRFAIEGAQIIEEIQIL 1072          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026283.1 (SMESG000026283.1)

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 370/1069 (34.61%), Postives = 586/1069 (54.82%), Query Frame = 1
Query:  130 SSFFQDIERCRFTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPLH---------LNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNSGRFYPCGNYXXXXXXXXXXXXXXQN--------------------------DN-YRDLCSTELSQQEYFGKYNLLKEIQNFTKVIHLKKLIDYVTVIMNVRKDVLSQDILRKIFVMSTDYNYRCQKDIEQYEMCQIIKEFRVKSQLRLIFVCKNPLKTIFVVSQLPKTGYQLKLILGPIHRIRNQINPDIYHYSKQFSERKK---SEIGGIPLLKHTGYFILLLENSSPYVVSENKEVMIAISKIGKGTIGFVGNENYLKSNYRNLLQDFFRLISDSKTVNIIEIDELSIANLHELVELNQTSNLLALWNPREDNNEIFSEDILALVYRGLKLVIGISPWLHDSGTRLLETSFLKSIFIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDYAIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHLTRANVPCLEMPLFHIKRFKRNLIKLMNFILLYPMGNIFVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWI-DEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGEKLVSRTPKKLKTFIGPLTYTSRIEGKSAIRHFKVF 3216
            +++F +I++C+ T  G EYVG+   T SG+ C  W      I ++R L L          ++  NFCRNP  +  GPWC  +     WE+C+I  C +D   CKDT    EY G  NL+ SG+     +  N     +  +   QN                          DN Y   C    SQ EYFG Y+ LK +++   VI LK ++  +T ++ +     S     +  + +T Y+ RCQKD  +YE C + K  ++K+Q+ LI+ C  P+K +  +S L KT Y+++  LG  + I+N ++ ++  Y ++  +  K   + I  +P   + G F++  +N+ PY ++ + +V+  IS+IGKG IG +  +  + ++Y    +D+ + I     +N + +    I  LH+         +  +WN   +  E F + ++ L+  GLK+V+G+ PW ++   + L++S L ++F A G+WPSLK I   +  V   +    PL++LL++A   +  +N V+  I + +   P   +  +    ++   +  L ++++H  ++ +PCL+  +   +R +RNLI   + +L+YP   + VAPG+SFYPG+I           + LN++F +E   LG+YLPPG       + +K+  C L +N+HLFD+  +  +YKWP +K    L   E ++ SF FGGLLSISC  D ++V + F  VI VP+FD R+S  +K+W   +   +PW +LA D  VF++   ++RNL  P  V++++  + K E+HL G  V    RELIS D Q   GYMH+GYPIG++IQ V NP  ++++     N+   GRWG+LHEIGHNLQD  FTF G+ +VTNNIFTL  +ES++G +SWS    W  D   +  FV Y+  G F+ WK+ P LALG+YAQL+S FGWE Y Q+ R+Y        ++ + + D EKIQ WI  TS   KMNL PLY+ WR+P+      +L  YP F P DFLT++++   ++II+KYGG  +V R P KL+  IGPL   + ++G+  I    + 
Sbjct:   26 ATYFTEIKKCKITSHGSEYVGNVEKTFSGKKCIKWT-----IELLRRLNLEEKHFLDLESVSPHNFCRNPNLYPKGPWCVTDEKALQWEHCDIPLCVKDNNWCKDTAEGQEYFGSLNLTESGKDCKLWSLQNKFPANAFPEMSLQNAENHCRSPDGYSKGPWCYVDDSNIKWDNCYVPQCEISFSQIEYFGGYDFLKTLKDHLNVIQLKNIVKTITFVVVIDLTKWSLYAQSRTTLWATGYDPRCQKDFNEYEFCGLSKSTKLKNQITLIYKCNKPMKNLIFISPLMKTEYKIEYRLGENYEIKNVLSLNLKEYQEKVDKYLKVHQTNIISMPSCSNFGSFLIFKDNAFPYAITSDNDVVFVISEIGKGRIGLIACDT-ITTDYVPF-KDYLKTIYGENQLNPVLLTGDIIKKLHDDSMKGIRMTMQLIWNAHYEIEESFVKKLVDLIKYGLKIVVGLKPWAYNYYRKNLKSSELVTLFKASGVWPSLKTINGDLKIVNRDNIAAFPLNHLLEFAKTNLINLNSVSLSIGNIVSISPFQIMGSRDEFAEITKNIQELIEIYSHHVKSFIPCLDKTV--TERTERNLIYFYSALLIYPFNGLMVAPGVSFYPGNIQSDNFRQLIVQMALNLKFKDETSQLGLYLPPGKIGTALFKNSKSQTCVLYLNFHLFDIYQKDEYYKWPVSKRSILLSINEMQTFSFPFGGLLSISCALDNDKVDMVFSGVIQVPVFDRRDSDNNKNWNVLQRSKAPWAVLAGDSFVFVVSINTVRNLAQPHKVLELFDLMVKEEYHLRGIAVQSKRRELISTDIQIEAGYMHAGYPIGTMIQHVTNPSYKSKFLFDVGNMMIEGRWGVLHEIGHNLQDSSFTFTGTVDVTNNIFTLVGVESLTGKSSWSQNEGWASDRSYINRFVTYLNEGKFDEWKNEPFLALGVYAQLRSNFGWELYYQVFRQY----NARAIFIKRMYDTEKIQQWILLTSIHAKMNLCPLYDFWRWPIDSNTNQELLKYPYFFPDDFLTKLVSNKVDKIIMKYGGSLVVKRQPAKLEEMIGPLKNKTSVDGERIIEKITIL 1081          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026377.1 (SMESG000026377.1)

HSP 1 Score: 658.677 bits (1698), Expect = 0.000e+0
Identity = 370/1061 (34.87%), Postives = 580/1061 (54.67%), Query Frame = 1
Query:  133 SFFQDIERCRFTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNL----PLHLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNSGR--------------------FYPCGNYXXXXXXXXXXXXXXQNDNYRDLCST-----ELSQQEYFGKYNLLKEIQNFTKVIHLKKLIDYVTVIMNVRKDVLSQDILRKIFVMSTDYNYRCQKDIEQYEMCQIIKEFRVKSQLRLIFVCKNPLKTIFVVSQLPKTGYQLKLILGPIHRIRNQINPDIYHYSKQFSERKKSEIGG---IPLLKHTGYFILLLENSSPYVVSENKEVMIAISKIGKGTIGFVGNENYLKSNYRNLLQDFFRLISDSKTVNIIEIDELSIANLHELVELNQTSNLLA---LWNPREDNNEIFSEDILALVYRGLKLVIGISPWLHDSGTRLLETSFLKSIFIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDYAIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHLTRANVPCLEMPLFHIKRFKRNLIKLMNFILLYPMGNIFVAPGISFYPGSINQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKL-LKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKL-NKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGEKLVSRTPKKLKTFIGPLTYTSRIEGKSAIRH 3204
            S+F +IE C+ T  G EYVG+ N +++GR C SW    +N  ++ +        + + N+CRNPT F NGPWC ++ S   WE+C+I  C ++   CKDTD   EY G  N + +G+                    F   GN     +  +     + +D  R+ C       + SQ EYFG Y+ LK I +    I L  +   VTV +    + L+ DILRK  + +TDYN +CQ D+++YE C I++         + + C  P+K +  +  + K+ Y +K  LG  +      +     Y  + +E  + +I     +P   + G+F LL +N  PY +S   +V + IS IGKG I F+  E  +   +   LQD F+ + +    N      L+      L++ N+    +    +WN  +         +L L+  GL+++IG+ PW +         S LK +F   G+WPS     D   TV  F  N +P  Y L+YA   +  +  ++  I + L E+P   +  ++  + LK  +  L+  +    +  +PC +  +   K   ++LIKL N+IL+   G   +APG+SFYPG+       + +F + LN+++ +EV  LG+Y+ PG    V    + +  C + IN+HLF+ ++++  YKWP TK +F +      + ++ FGGLLSISC  + ++V + F++V+ VP+FD R+   +K W++++   SPW ++++D  VF+L S ++RNL DP   M ++  + K EFHL GR+++  +RE+IS D Q   GYMH+GYPIG+ I  V NP N+ +YF    NI   G WG++HE+GHNLQ+ +FTF G+ EV NNIFTL A+ES++  +SWS  + W+  K+ +K  V+Y+ NG F  WK    +AL IYAQL++ FGWEFY Q+ R+Y +L N++      ++SD+EKIQLWI  TS ++ MNL PLYE+W++P+  K + +L+    FLP DFLT+MI K  +EII K+GG   V RTP  +   IGPL +   IEG   I+ 
Sbjct:   19 SYFTEIENCKITTHGREYVGYTNVSKNGRPCLSWKKEYLNDIIMDDSIYFDTTSIIETNYCRNPTNFPNGPWCIVDESILEWEHCHIRSCIKERNWCKDTDKGTEYLGDLNFTKTGKICKPWIIQSNYSENSFPEKSFQLVGNKCRNPDMSAGPWCFYSDDYKREECEVPRCDEKFSQIEYFGGYDFLKTISSLITTITLTDICQTVTVTVTFNLESLNSDILRKTSLWATDYNPKCQTDLDEYEYCTIVESKNTSKSYIISYSCFRPMKYLIFICPIDKSEYTIKY-LGTFYNFNLSPSKQFDDYEIKMNEYFQKKIKQDVIVPSDSNHGHFYLLNDNVIPYALSVKNKVTVTISSIGKGRISFLATEKLVNPEFYPELQDLFQEVYEKPVENP---KLLTKKYFKALIDENKLQTAMFEHFIWNAHDTLGRDLVFILLQLIKSGLQIIIGVKPWAYYYYQAQFLDSELKVLFETAGIWPSKDSDSDVWRTVTKFSTNTMPFYYRLEYAKKNLMSLKNLSKSIGNFLAEVPFHKIMSKRTFELLKSSIVDLYSNYLPYIKHLIPCSKGSI--TKESDQDLIKLFNYILISFFGRTLIAPGLSFYPGTFQSSDILLENFQMQLNLKYKDEVSQLGLYVVPGKHVSVQITESNSQSCRIFINFHLFNTINKEKLYKWPITKTEFIIKRNILETFAYPFGGLLSISCDANNDKVKITFINVVKVPVFDRRDKKDTKDWIQQQSVVSPWAVVSSDTLVFVLSSNAIRNLADPETFMRMYDSMVKEEFHLKGRSISTSYREIISTDIQITAGYMHAGYPIGTQIFWVTNPYNKKDYFFDKYNIEIDGEWGLMHELGHNLQEPIFTFNGAGEVNNNIFTLVAIESMTNMSSWSPNDGWVSTKVKIKDLVKYLNNGTFEEWKKTYYVALSIYAQLRNSFGWEFYSQVFRRYNELKNEI-----GSISDNEKIQLWIKTTSEISGMNLCPLYELWKWPISQKTEKELSKLQMFLPDDFLTKMIEKRVDEIISKFGGIDSVFRTPLTIPEKIGPLKHKFSIEGTKVIQE 1068          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000026300.1 (SMESG000026300.1)

HSP 1 Score: 655.21 bits (1689), Expect = 0.000e+0
Identity = 376/1075 (34.98%), Postives = 580/1075 (53.95%), Query Frame = 1
Query:  118 IQCKSSFFQDIERCRFTQIGMEYVGHQNFTESGRICESWNTINMNIFVIRNLPL----HLNKLNFCRNPTGFSNGPWCFINSSKGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNSGRFYPC----------------------GNYXXXXXXXXXXX---XXXQNDNYRDL----CSTELSQQEYFGKYNLLKEIQNFTKVIHLKKLIDYVTVIMNVRKDVLSQDILRKIFVMSTDYNYRCQKDIEQYEMCQIIKEFRVKSQLRLIFVCKNPLKTIFVVSQLPKTGYQLKLILGPIHRIRNQINPDIYHYSK---QFSERKKSEIGGIPLLKHTGYFILLLENSSPYVVSENKEVMIAISKIGKGTIGFVGNENYLKSNYRNLLQDFFRLI--SDSKTVNIIEIDELSIANLHELVELN--QTSNLLALWNPREDNNEIFSEDILALVYRGLKLVIGISPWLHDSGTRLLETSFLKSIFIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDYAIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHLTRANVPCLEMPLFHIKRFKRNLIKLM--NFILLYPMGNIFVAPGISFYPGSIN-QRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFCELSINYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDKERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILPSISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGYMHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDILFTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNGDFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVSDDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDFLTEMINKTANEIIIKYGGEKLVSRTPKKLKTFIGPLTYTSRIEGKSAIRHFKV 3213
            +   S +F +I++C+ T  G EY+G  + T++G+IC+ W+  N+  F ++ L       +   NFCRNP    +GPWC ++     WE+C+I  C +D   CKD++   EY G  N + SG+  PC                      GN     + K++        ++DN+ +     C  +LSQ EYFG Y+  K +++   VI LK +   +   + + K + + D+ RK  + +TDYN  CQ D+ +YE C+  ++     ++ +++ C  PLK +  +  L  + Y+ +  +G  + I  + N     Y K   Q    K  +   IP+  + GYF LL +N  PY V  +  V   IS++GKG IGF+G   YL+ + +  ++DF   +   D  +  ++  + L + N     E N  +TS    +WN         ++ +L LV  GLK++I ++PW + S    L    L SIF+  G+WPS  +  D I  +     +  PL +L +YA   I     V+  I + +   P   +      +K+K  +  L  +++ L  + +PCL+ PL    R K +  K+   N +LL+ +     APG+SFYPG +    VKP+    + L+MEF  EVI LG+YLPPG    V    A ++ C+L IN+HLFDV +   W KWP  K   ++   + +  SF+FGGLLS+SC +  ++VH+     I +P++D R   I+KHW +      PW I+++D  VFI+P +++RNL  P  V++++  +   EF+L G+++    RE++S+D Q   GYM +GYPIG L+ +V NP ++ E+      I  +GRWG+LHEIGHNLQ+ +FTF G+ EVT NIFTL  +E+ +G +SWS    W     + S + YIK+G F++WK +P LAL  YAQLKS FGWEFY Q+ R+Y  LNK        ++D EKIQLWI ETSN  +MNL P Y+ W++P+    K  L+  P F P DFLT+M+ +  +EII KYGG  L+ R P  +   IGPL +   I GKS I  F +
Sbjct:    5 LTASSKYFAEIQKCKITTHGSEYIGSVDRTKTGKICQKWSEENIKKFKLQFLDYPDRESIVTHNFCRNPNQVPDGPWCIVDRENSKWEHCDIPSCIKDRNWCKDSELGGEYFGNINFTKSGK--PCRVWSDKDTFDGKSFPEKNLKDVGNKCRNPDGKTSGPWCFVSSEDDNWENCNIPNCDEDLSQIEYFGGYDFQKAVEDQKTVIPLKMVYSSIKFKVFLNKTIWTPDVQRKTSLWATDYNPSCQTDLNEYEFCKSTEQSVNDERVEIVYRCLRPLKYLIFIFPLESSLYKTEHHVGKTYEINEKPNLQFVKYEKKLLQHISSKNRKNLTIPVCDNPGYFYLLNDNVIPYAVMSDSRVFAMISEVGKGRIGFMGCNTYLEESAQAEIKDFLNSVYGDDFTSPKVLTKELLDLLN----SERNNIETSLPTVIWNAHNSLGFSTTKVLLDLVKDGLKIIILMTPWAYPSLNSSLSQIELSSIFLEAGIWPSRDISSDPISVLGRISVHTFPLIHLFNYAKTSISSSMKVSKSITTIILNTPFDSLMSNVQMEKIKEALHSLILIYSPLINSLIPCLKKPL----RSKNDKFKIFFFNILLLHDLYGNVSAPGVSFYPGKVYVDEVKPVK-VKIKLSMEFEKEVIPLGLYLPPGKTVSVNITQAVSSCCQLYINHHLFDVSENSLWKKWPIIKKSLQIEKFKIKQFSFSFGGLLSLSCEKSDKKVHVVVNGAIPIPMYDRRGGSINKHWKQSYFTNVPWAIISSDYVVFIVPFVAIRNLAYPPSVLELYDAMVAEEFYLKGKSIENSTREIVSSDVQIVAGYMIAGYPIGVLMYAVTNPASKVEFLFNLEYIKSNGRWGILHEIGHNLQESIFTFSGTNEVTTNIFTLVGIETFTGQDSWSANMSWFP---MSSVISYIKSGSFSDWKIDPFLALCTYAQLKSQFGWEFYSQLFRRYDLLNKKL----GELTDSEKIQLWITETSNRVRMNLCPFYDWWKWPIEDTTKESLSKLPIFFPDDFLTKMLPEKVDEIIEKYGGSSLMKRQPLNILQVIGPLKHKRSIRGKSVIDDFMI 1061          
The following BLAST results are available for this feature:
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TCAF21.076e-2824.93TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF21.291e-2824.93TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF21.291e-2824.93TRPM8 channel associated factor 2 [Source:HGNC Sym... [more]
TCAF2C1.919e-2824.93TRPM8 channel associated factor 2C [Source:HGNC Sy... [more]
TCAF13.182e-2524.87TRPM8 channel associated factor 1 [Source:HGNC Sym... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cam-11.207e-830.16Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-11.240e-830.16Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
cam-11.461e-830.16Tyrosine-protein kinase receptor cam-1 [Source:Un... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.33.213e-2826.60si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
si:ch211-210b2.21.567e-2726.35si:ch211-210b2.2 [Source:ZFIN;Acc:ZDB-GENE-131118-... [more]
si:ch211-210b2.42.005e-2726.35si:ch211-210b2.4 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
zgc:1621932.015e-2324.69zgc:162193 [Source:NCBI gene;Acc:323315][more]
zgc:1621932.015e-2324.69zgc:162193 [Source:NCBI gene;Acc:323315][more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045101.13.651e-2827.89TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045039.11.447e-2327.48TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045059.12.203e-2327.86TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000045084.13.747e-2327.48TRPM8 channel-associated factor 2 [Source:NCBI gen... [more]
ENSXETT00000002244.13.114e-2023.94TRPM8 channel-associated factor homolog [Source:NC... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tcaf33.441e-3227.23TRPM8 channel-associated factor 3 [Source:MGI Symb... [more]
Tcaf22.586e-2927.59TRPM8 channel-associated factor 2 [Source:MGI Symb... [more]
Tcaf13.201e-2426.20TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf13.201e-2426.20TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
Tcaf13.201e-2426.20TRPM8 channel-associated factor 1 [Source:MGI Symb... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6QR59|TCAF3_MOUSE2.407e-3127.23TRPM8 channel-associated factor 3 OS=Mus musculus ... [more]
sp|Q6P6V7|TCAF3_RAT1.894e-3027.20TRPM8 channel-associated factor 3 OS=Rattus norveg... [more]
sp|Q921K8|TCAF2_MOUSE1.809e-2827.59TRPM8 channel-associated factor 2 OS=Mus musculus ... [more]
sp|A6NFQ2|TCAF2_HUMAN5.168e-2824.93TRPM8 channel-associated factor 2 OS=Homo sapiens ... [more]
sp|A6QLU7|TCAF2_BOVIN1.267e-2524.49TRPM8 channel-associated factor 2 OS=Bos taurus OX... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3I0H41.677e-5625.59TRPM8 channel-associated factor 2-like OS=Lingula ... [more]
A0A2E5X6P14.537e-5631.49Peptidase M60 domain-containing protein OS=Plancto... [more]
V3ZHF73.775e-5528.29Peptidase M60 domain-containing protein OS=Lottia ... [more]
R7UHN95.220e-5429.72Peptidase M60 domain-containing protein OS=Capitel... [more]
A0A1S3KG342.902e-5325.27TRPM8 channel-associated factor 2 OS=Lingula ungui... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.31.158e-1924.64si:ch211-210b2.3 [Source:ZFIN;Acc:ZDB-GENE-131122-... [more]
ENSAMXT00000051129.13.162e-1726.17pep primary_assembly:Astyanax_mexicanus-2.0:1:5658... [more]
ENSAMXT00000018419.27.405e-1032.29plasminogen [Source:NCBI gene;Acc:103036400][more]
ENSAMXT00000018418.28.708e-1032.29plasminogen [Source:NCBI gene;Acc:103036400][more]
mst11.543e-834.02macrophage stimulating 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000976.18.888e-2423.56pep scaffold:Pmarinus_7.0:GL479898:35358:38300:-1 ... [more]
ENSPMAT00000001728.11.917e-933.73pep scaffold:Pmarinus_7.0:GL477419:32233:56220:-1 ... [more]
ENSPMAT00000003778.11.601e-734.57pep scaffold:Pmarinus_7.0:GL482904:4425:14035:-1 g... [more]
hgfb1.190e-629.49hepatocyte growth factor b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO301931.778e-1036.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289261.694e-836.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439938.722e-836.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482154.632e-732.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397635.633e-734.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-210b2.32.076e-2122.25TRPM8 channel-associated factor homolog [Source:NC... [more]
ENSORLT00000032410.11.442e-736.96pep primary_assembly:ASM223467v1:23:16283833:16285... [more]
hgfb6.332e-736.49hepatocyte growth factor [Source:NCBI gene;Acc:101... [more]
hgfb7.325e-736.49hepatocyte growth factor [Source:NCBI gene;Acc:101... [more]
plat2.506e-638.27plasminogen activator, tissue type [Source:NCBI ge... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070472.10.000e+099.81SMESG000070472.1[more]
SMESG000026355.10.000e+035.64SMESG000026355.1[more]
SMESG000026283.10.000e+034.61SMESG000026283.1[more]
SMESG000026377.10.000e+034.87SMESG000026377.1[more]
SMESG000026300.10.000e+034.98SMESG000026300.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026439 ID=SMED30026439|Name=Peptidase M60 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3264bp
CATAGATATTTTCCAGACTTATATTTTTGACAAACGAATTGTCAAATTTG
GAACATGTTTAAAGGCAAATTTGGAAATATTGCACATTTCATAGGATGGA
TTATTGGACTCTCGTGCATTCAGTGCAAATCCAGTTTCTTTCAAGATATC
GAGCGTTGCCGATTTACTCAAATTGGTATGGAGTACGTAGGACACCAAAA
CTTTACGGAAAGCGGAAGGATTTGTGAATCATGGAATACAATTAATATGA
ATATATTTGTTATACGAAATTTACCTTTGCACCTGAATAAATTAAACTTT
TGTCGAAATCCAACTGGATTTTCCAATGGTCCTTGGTGTTTTATCAATTC
CTCAAAGGGTACTTGGGAATACTGTAATATTTCATTTTGTCATCGAGATG
TCTATAATTGTAAAGATACGGATTATGACTTCGAATATTCAGGCAAGGAA
AATTTATCAAATTCTGGAAGATTTTATCCATGTGGAAATTATTTGAATTT
ATCAAACTTTAAATCCAACAAAAAAAAATTATTTCAAAATGATAATTATC
GTGACTTGTGCTCGACAGAGTTAAGCCAACAAGAATACTTTGGAAAATAC
AATCTTTTAAAGGAAATTCAAAATTTTACAAAAGTTATTCATTTGAAAAA
ACTTATAGATTATGTAACGGTAATTATGAATGTTAGAAAAGATGTATTGA
GTCAAGATATTTTGCGAAAAATCTTTGTAATGTCTACGGATTATAATTAT
CGATGTCAGAAAGACATAGAACAATATGAAATGTGCCAAATAATAAAAGA
ATTTCGAGTTAAATCCCAATTAAGGCTGATTTTTGTTTGCAAGAATCCAT
TAAAAACTATTTTTGTCGTGTCCCAACTACCAAAAACTGGATATCAATTG
AAACTTATTTTGGGTCCGATCCATCGGATCAGAAACCAGATAAATCCAGA
TATTTATCACTATTCAAAACAATTCAGTGAACGAAAAAAGTCCGAAATTG
GTGGAATTCCTTTATTAAAACACACTGGATATTTTATTCTTCTCCTTGAA
AATTCTTCCCCTTATGTCGTTTCTGAGAACAAGGAAGTAATGATAGCAAT
ATCCAAAATTGGAAAGGGAACAATAGGCTTTGTAGGCAACGAAAATTATT
TAAAATCTAACTATCGAAATCTTCTCCAAGACTTTTTCCGTCTGATTTCG
GATTCTAAAACGGTAAACATCATTGAAATTGATGAGTTGTCAATTGCAAA
TTTGCATGAATTGGTAGAATTGAATCAAACTTCGAATCTTCTGGCTCTCT
GGAATCCTCGGGAAGATAATAATGAAATATTCTCCGAGGATATTTTAGCG
TTGGTCTATAGAGGCCTGAAGTTAGTAATTGGTATTAGTCCTTGGTTACA
TGATTCGGGAACAAGATTACTAGAGACAAGTTTTTTAAAATCTATTTTCA
TTGCAGGCGGCCTATGGCCGTCTTTGAAACTTATTAAGGATAGCATCATG
ACAGTAAAGCATTTTGATTATAATTTATTACCTTTGAGTTATTTATTGGA
TTATGCAATTGTTGGAATAAAAGAAATGAATTTAGTCGCAGATATGATAG
TAAGTAAACTTCAAGAACTTCCTCTGACTGATGTCGCTTTTCAACAGATC
CAAGATAAACTGAAAATAAAGGTTTGGAGGTTATTTAAGGTTTTTAATCA
CTTGACTCGAGCCAATGTTCCTTGCTTAGAAATGCCTCTCTTCCATATTA
AAAGATTTAAAAGAAATTTAATTAAATTAATGAATTTTATTCTTCTTTAT
CCAATGGGAAACATCTTTGTCGCTCCGGGAATTTCATTTTATCCTGGGAG
TATAAATCAAAGAGTCAAACCAATAAGTTCTTTTGATGTAAATTTGAACA
TGGAATTTTCGAATGAAGTCATTTATTTGGGAATTTATCTTCCGCCTGGT
CATGAAACAAGGGTAACCTCTGAGATAGCAAAAGCTAACTTTTGTGAGCT
GTCCATAAATTACCATCTTTTTGATGTTTTGGATCAAAAGAATTGGTATA
AATGGCCGAATACTAAGATAAAGTTCAAACTTTATTCGGGGGAGACTAGA
AGCATATCATTTGCATTTGGAGGATTATTGTCAATATCCTGTACAGAAGA
CAAGGAAAGAGTACATTTGAGGTTTTTAGACGTTATAATTGTTCCGATAT
TTGATAGTCGAAATTCGTTAATATCAAAACATTGGTTAGAAAAAAAAGAT
GAAGGCAGTCCTTGGGTAATTTTAGCGAATGATGTTGCTGTTTTTATTTT
GCCGTCGATTTCATTAAGAAACCTTAATGACCCTTTTCCAGTAATGGATA
TTTGGAGTTTTCTTTTTAAACATGAGTTTCATTTAGTGGGAAGAAACGTA
ACTCAATATCATCGAGAACTGATATCGGCCGATTTTCAAACCTATGGGGG
ATATATGCACAGTGGGTACCCAATTGGGTCTTTGATTCAATCAGTAGCTA
ATCCTAGAAATAGGAATGAATATTTTCTAGCGTCAAACAACATTTGTGAG
CATGGAAGATGGGGTATGTTACATGAAATTGGACACAATTTACAAGACAT
TTTGTTTACCTTTAAAGGTTCAGAAGAAGTGACCAATAATATTTTTACCT
TAGCCGCAATGGAATCTATTAGTGGAAATAACAGTTGGTCTTTAAAAAAC
TATTGGATAGATGAGAAACTTTTGAAATCCTTTGTGGAATATATTAAAAA
TGGAGATTTCAATAATTGGAAAAGTAATCCTTCACTTGCACTTGGAATAT
ATGCTCAGTTAAAAAGCTGTTTTGGTTGGGAGTTTTATCGTCAGATTTTA
AGAAAATATAAAAAACTGAATAAAATGCCACTTCTCTATAATCAAACGGT
TAGTGATGATGAAAAAATTCAACTCTGGATTTGGGAGACTTCAAATCTAA
CCAAAATGAATTTGTATCCTTTGTATGAAATGTGGCGGTTTCCGGTCTAT
CCAAAGTTGAAAGTTAAATTGAATATCTACCCATCGTTTCTTCCATTGGA
TTTTCTTACTGAAATGATTAACAAAACGGCAAACGAAATAATCATAAAAT
ACGGTGGTGAAAAATTGGTTTCTCGGACACCGAAAAAGCTTAAAACCTTT
ATTGGACCCTTGACATATACTTCTCGTATTGAAGGAAAATCGGCTATCAG
ACATTTTAAAGTATTTTAAATATAATTTACTTTATCGTTGAAAATTACTT
TTCTTATCTTCGTG
back to top

protein sequence of SMED30026439-orf-1

>SMED30026439-orf-1 ID=SMED30026439-orf-1|Name=SMED30026439-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1055bp
MFKGKFGNIAHFIGWIIGLSCIQCKSSFFQDIERCRFTQIGMEYVGHQNF
TESGRICESWNTINMNIFVIRNLPLHLNKLNFCRNPTGFSNGPWCFINSS
KGTWEYCNISFCHRDVYNCKDTDYDFEYSGKENLSNSGRFYPCGNYLNLS
NFKSNKKKLFQNDNYRDLCSTELSQQEYFGKYNLLKEIQNFTKVIHLKKL
IDYVTVIMNVRKDVLSQDILRKIFVMSTDYNYRCQKDIEQYEMCQIIKEF
RVKSQLRLIFVCKNPLKTIFVVSQLPKTGYQLKLILGPIHRIRNQINPDI
YHYSKQFSERKKSEIGGIPLLKHTGYFILLLENSSPYVVSENKEVMIAIS
KIGKGTIGFVGNENYLKSNYRNLLQDFFRLISDSKTVNIIEIDELSIANL
HELVELNQTSNLLALWNPREDNNEIFSEDILALVYRGLKLVIGISPWLHD
SGTRLLETSFLKSIFIAGGLWPSLKLIKDSIMTVKHFDYNLLPLSYLLDY
AIVGIKEMNLVADMIVSKLQELPLTDVAFQQIQDKLKIKVWRLFKVFNHL
TRANVPCLEMPLFHIKRFKRNLIKLMNFILLYPMGNIFVAPGISFYPGSI
NQRVKPISSFDVNLNMEFSNEVIYLGIYLPPGHETRVTSEIAKANFCELS
INYHLFDVLDQKNWYKWPNTKIKFKLYSGETRSISFAFGGLLSISCTEDK
ERVHLRFLDVIIVPIFDSRNSLISKHWLEKKDEGSPWVILANDVAVFILP
SISLRNLNDPFPVMDIWSFLFKHEFHLVGRNVTQYHRELISADFQTYGGY
MHSGYPIGSLIQSVANPRNRNEYFLASNNICEHGRWGMLHEIGHNLQDIL
FTFKGSEEVTNNIFTLAAMESISGNNSWSLKNYWIDEKLLKSFVEYIKNG
DFNNWKSNPSLALGIYAQLKSCFGWEFYRQILRKYKKLNKMPLLYNQTVS
DDEKIQLWIWETSNLTKMNLYPLYEMWRFPVYPKLKVKLNIYPSFLPLDF
LTEMINKTANEIIIKYGGEKLVSRTPKKLKTFIGPLTYTSRIEGKSAIRH
FKVF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000106ciliated epithelial cell
PLANA:0000240body wall musculature
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR038178Kringle_sf
IPR042279Pep_M60_3
IPR035423M60-like_N
IPR000001Kringle
IPR031161Peptidase_M60_dom
IPR018056Kringle_CS
IPR013806Kringle-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000001KringleSMARTSM00130KR_2coord: 33..114
e-value: 6.1E-9
score: 44.4
IPR000001KringlePFAMPF00051Kringlecoord: 38..112
e-value: 1.2E-14
score: 54.4
IPR000001KringlePROSITEPS50070KRINGLE_2coord: 41..112
score: 15.307
IPR031161Peptidase family M60 domainSMARTSM01276M60_like_2coord: 620..924
e-value: 1.7E-30
score: 117.3
IPR031161Peptidase family M60 domainPFAMPF13402Peptidase_M60coord: 734..977
e-value: 3.5E-31
score: 108.7
IPR031161Peptidase family M60 domainPROSITEPS51723PEPTIDASE_M60coord: 620..924
score: 48.495
IPR038178Kringle superfamilyGENE3DG3DSA:2.40.20.10coord: 15..114
e-value: 6.8E-19
score: 70.5
IPR042279Peptidase M60, enhancin-like domain 3GENE3DG3DSA:1.10.390.30coord: 847..1001
e-value: 1.1E-21
score: 79.4
IPR035423M60-like domain, N-terminalPFAMPF17291M60-like_Ncoord: 626..702
e-value: 9.3E-6
score: 25.5
NoneNo IPR availablePANTHERPTHR15730EXPERIMENTAL AUTOIMMUNE PROSTATITIS ANTIGEN 2-RELATEDcoord: 611..985
NoneNo IPR availablePANTHERPTHR15730:SF5SI:CH211-210B2.2-RELATEDcoord: 611..985
NoneNo IPR availablePROSITEPS51257PROKAR_LIPOPROTEINcoord: 1..21
score: 6.0
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.477
IPR018056Kringle, conserved sitePROSITEPS00021KRINGLE_1coord: 82..95
IPR013806Kringle-like foldSUPERFAMILYSSF57440Kringle-likecoord: 36..118