Negative elongation factor B

Overview
NameNegative elongation factor B
Smed IDSMED30026434
Length (bp)2194
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Negative elongation factor B (SMED30026434) t-SNE clustered cells

Violin plots show distribution of expression levels for Negative elongation factor B (SMED30026434) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Negative elongation factor B (SMED30026434) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Negative elongation factor B (SMED30026434) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Negative elongation factor B vs. Ensembl Human
Match: NELFB (negative elongation factor complex member B [Source:HGNC Symbol;Acc:HGNC:24324])

HSP 1 Score: 80.8777 bits (198), Expect = 3.628e-15
Identity = 68/313 (21.73%), Postives = 136/313 (43.45%), Query Frame = 1
Query:  142 EDIKSLQESIFTN--IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            E +K++++    N  ++P    A+   DL G  R     S+ +   DK+   +   + +   +++ K    L++     +  P +QP++M VM  +  V E  L  ++  KELY    + V R +W ++     +E+  L        +KQY ++ E A+          +S+    +      + K R+  +   ++  M+G +  +Y+ +++ L+  F+  +             TLR +++ SLHD     +   D  H     L++CIR+  +D+  A EL   +    K +  +  DL  I  DP+ +
Sbjct:   73 EPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPL--------LKQYILEKESAL----------FSTELSVLHNFFSPSPKTRRQGEVVQRLTRMVGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDVGEICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 359          
BLAST of Negative elongation factor B vs. Ensembl Human
Match: NELFB (negative elongation factor complex member B [Source:HGNC Symbol;Acc:HGNC:24324])

HSP 1 Score: 80.8777 bits (198), Expect = 4.062e-15
Identity = 68/313 (21.73%), Postives = 136/313 (43.45%), Query Frame = 1
Query:  142 EDIKSLQESIFTN--IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            E +K++++    N  ++P    A+   DL G  R     S+ +   DK+   +   + +   +++ K    L++     +  P +QP++M VM  +  V E  L  ++  KELY    + V R +W ++     +E+  L        +KQY ++ E A+          +S+    +      + K R+  +   ++  M+G +  +Y+ +++ L+  F+  +             TLR +++ SLHD     +   D  H     L++CIR+  +D+  A EL   +    K +  +  DL  I  DP+ +
Sbjct:   73 EPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPL--------LKQYILEKESAL----------FSTELSVLHNFFSPSPKTRRQGEVVQRLTRMVGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDVGEICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 359          
BLAST of Negative elongation factor B vs. Ensembl Fly
Match: NELF-B (gene:FBgn0027553 transcript:FBtr0071077)

HSP 1 Score: 61.6178 bits (148), Expect = 2.049e-9
Identity = 63/298 (21.14%), Postives = 127/298 (42.62%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            ++P     + L DL G+ R     S+     DK+   I    +K   ++ +KL   L+KS    +    ++P++M ++    ++ + +L  +++ +ELY  T   V R +W ++     +E+  L+S Y+    K++ +     +N L                       K R+  +   K+ +MIG S  +Y+ +++ L+  F+  +             TLR +++ +LHD     +   D  H     L++CIR+  +D   + EL   +    + +  +  DL     DPY +
Sbjct:   50 LLPSLRPMLPLLDLHGVRRLDFHTSLMEELRDKLIAHINEMGQKEPRERDKKLKELLVKS-FPVVRVKSLRPVVMAILRNTQHIDDKYLKILVRDRELYADTDTEVKRQIWRDNQSLFGDEVSPLLSQYIRE--KEHILFDHTNLNNL-----------------FFHPTPKVRRQGEVVQKLANMIGTSVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMALHDLEVQEIISIDPCHKFTWCLDACIREKNVDIKRSRELQGFLDNIKRGQEQVLGDLSMTLCDPYAI 319          
BLAST of Negative elongation factor B vs. Ensembl Zebrafish
Match: nelfb (negative elongation factor complex member B [Source:ZFIN;Acc:ZDB-GENE-040426-765])

HSP 1 Score: 83.9593 bits (206), Expect = 2.889e-16
Identity = 72/297 (24.24%), Postives = 131/297 (44.11%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYV 1059
            ++P    A+   DL G  R     S+ +   DK+   +   +E  ++ +  KL   L KS    +  P +QP++M V+  +  V E  L +++  KELY+   + V R +W ++     +E+  L        +KQY ++ E A+          +S+    +      + K R+  +  LK+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ 
Sbjct:   40 LLPTLQSALPFLDLHGTPRLEFHQSVFDELRDKLMERVATIAEGKEEDRYVKLEELLEKS-FPLVKMPSIQPVVMQVLKHLPKVPEKKLKQVMADKELYKVCAVEVKRQIWQDNQALFGDEVSPL--------LKQYIVEKEAAL----------FSNDLSILHNFFSPSPKTRRQGEVVLKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICSVDPCHKFSWCLDACIREKFVDAKRARELQGFLDGVKKGQEQVLGDLSMILCDPFA 309          
BLAST of Negative elongation factor B vs. Ensembl Zebrafish
Match: nelfb (negative elongation factor complex member B [Source:ZFIN;Acc:ZDB-GENE-040426-765])

HSP 1 Score: 83.5741 bits (205), Expect = 2.929e-16
Identity = 72/297 (24.24%), Postives = 131/297 (44.11%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYV 1059
            ++P    A+   DL G  R     S+ +   DK+   +   +E  ++ +  KL   L KS    +  P +QP++M V+  +  V E  L +++  KELY+   + V R +W ++     +E+  L        +KQY ++ E A+          +S+    +      + K R+  +  LK+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ 
Sbjct:   40 LLPTLQSALPFLDLHGTPRLEFHQSVFDELRDKLMERVATIAEGKEEDRYVKLEELLEKS-FPLVKMPSIQPVVMQVLKHLPKVPEKKLKQVMADKELYKVCAVEVKRQIWQDNQALFGDEVSPL--------LKQYIVEKEAAL----------FSNDLSILHNFFSPSPKTRRQGEVVLKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICSVDPCHKFSWCLDACIREKFVDAKRARELQGFLDGVKKGQEQVLGDLSMILCDPFA 309          
BLAST of Negative elongation factor B vs. Ensembl Zebrafish
Match: nelfb (negative elongation factor complex member B [Source:ZFIN;Acc:ZDB-GENE-040426-765])

HSP 1 Score: 83.5741 bits (205), Expect = 3.187e-16
Identity = 72/297 (24.24%), Postives = 131/297 (44.11%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYV 1059
            ++P    A+   DL G  R     S+ +   DK+   +   +E  ++ +  KL   L KS    +  P +QP++M V+  +  V E  L +++  KELY+   + V R +W ++     +E+  L        +KQY ++ E A+          +S+    +      + K R+  +  LK+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ 
Sbjct:   40 LLPTLQSALPFLDLHGTPRLEFHQSVFDELRDKLMERVATIAEGKEEDRYVKLEELLEKS-FPLVKMPSIQPVVMQVLKHLPKVPEKKLKQVMADKELYKVCAVEVKRQIWQDNQALFGDEVSPL--------LKQYIVEKEAAL----------FSNDLSILHNFFSPSPKTRRQGEVVLKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICSVDPCHKFSWCLDACIREKFVDAKRARELQGFLDGVKKGQEQVLGDLSMILCDPFA 309          
BLAST of Negative elongation factor B vs. Ensembl Xenopus
Match: ccdc122 (coiled-coil domain containing 122 [Source:Xenbase;Acc:XB-GENE-989470])

HSP 1 Score: 74.3294 bits (181), Expect = 3.048e-13
Identity = 54/234 (23.08%), Postives = 101/234 (43.16%), Query Frame = 1
Query:  373 IHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            +  P +QP++M VM  +  V E  L  ++  K+LY+   + V R +W ++     +E+  L+  Y+                  + + N + SS    +      + K R+  +   K+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ +
Sbjct:  104 VKMPSIQPVVMCVMKHLPKVPEKKLKLVMADKDLYKACAVEVKRQIWQDNQALFGDEVSPLLKQYI------------------LEKENVLLSSDLSVLHNFFSQSPKTRRQGEVVQKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICTVDPCHKFTWCLDACIREKFVDAKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 311          
BLAST of Negative elongation factor B vs. Ensembl Xenopus
Match: ccdc122 (coiled-coil domain containing 122 [Source:Xenbase;Acc:XB-GENE-989470])

HSP 1 Score: 73.9442 bits (180), Expect = 3.736e-13
Identity = 54/234 (23.08%), Postives = 101/234 (43.16%), Query Frame = 1
Query:  373 IHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            +  P +QP++M VM  +  V E  L  ++  K+LY+   + V R +W ++     +E+  L+  Y+                  + + N + SS    +      + K R+  +   K+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ +
Sbjct:  104 VKMPSIQPVVMCVMKHLPKVPEKKLKLVMADKDLYKACAVEVKRQIWQDNQALFGDEVSPLLKQYI------------------LEKENVLLSSDLSVLHNFFSQSPKTRRQGEVVQKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICTVDPCHKFTWCLDACIREKFVDAKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 311          
BLAST of Negative elongation factor B vs. Ensembl Xenopus
Match: ccdc122 (coiled-coil domain containing 122 [Source:Xenbase;Acc:XB-GENE-989470])

HSP 1 Score: 73.9442 bits (180), Expect = 4.146e-13
Identity = 54/234 (23.08%), Postives = 101/234 (43.16%), Query Frame = 1
Query:  373 IHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            +  P +QP++M VM  +  V E  L  ++  K+LY+   + V R +W ++     +E+  L+  Y+                  + + N + SS    +      + K R+  +   K+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ +
Sbjct:  104 VKMPSIQPVVMCVMKHLPKVPEKKLKLVMADKDLYKACAVEVKRQIWQDNQALFGDEVSPLLKQYI------------------LEKENVLLSSDLSVLHNFFSQSPKTRRQGEVVQKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICTVDPCHKFTWCLDACIREKFVDAKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 311          
BLAST of Negative elongation factor B vs. Ensembl Xenopus
Match: ccdc122 (coiled-coil domain containing 122 [Source:Xenbase;Acc:XB-GENE-989470])

HSP 1 Score: 73.9442 bits (180), Expect = 4.251e-13
Identity = 54/234 (23.08%), Postives = 101/234 (43.16%), Query Frame = 1
Query:  373 IHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            +  P +QP++M VM  +  V E  L  ++  K+LY+   + V R +W ++     +E+  L+  Y+                  + + N + SS    +      + K R+  +   K+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ +
Sbjct:  104 VKMPSIQPVVMCVMKHLPKVPEKKLKLVMADKDLYKACAVEVKRQIWQDNQALFGDEVSPLLKQYI------------------LEKENVLLSSDLSVLHNFFSQSPKTRRQGEVVQKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICTVDPCHKFTWCLDACIREKFVDAKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 311          
BLAST of Negative elongation factor B vs. Ensembl Xenopus
Match: ccdc122 (coiled-coil domain containing 122 [Source:Xenbase;Acc:XB-GENE-989470])

HSP 1 Score: 73.559 bits (179), Expect = 4.481e-13
Identity = 54/234 (23.08%), Postives = 101/234 (43.16%), Query Frame = 1
Query:  373 IHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            +  P +QP++M VM  +  V E  L  ++  K+LY+   + V R +W ++     +E+  L+  Y+                  + + N + SS    +      + K R+  +   K+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ +
Sbjct:  104 VKMPSIQPVVMCVMKHLPKVPEKKLKLVMADKDLYKACAVEVKRQIWQDNQALFGDEVSPLLKQYI------------------LEKENVLLSSDLSVLHNFFSQSPKTRRQGEVVQKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICTVDPCHKFTWCLDACIREKFVDAKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 311          
BLAST of Negative elongation factor B vs. Ensembl Mouse
Match: Nelfb (negative elongation factor complex member B [Source:MGI Symbol;Acc:MGI:1931035])

HSP 1 Score: 83.1889 bits (204), Expect = 5.678e-16
Identity = 67/298 (22.48%), Postives = 129/298 (43.29%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            ++P    A+   DL G  R     S+ +   DK+   +   + +   +++ K    L++     +  P +QP++M VM  +  V E  L  ++  KELY    + V R +W ++     +E+  L        +KQY ++ E A+          +S+    +      + K R+  +   K+  M+G +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D+  A EL   +    K +  +  DL  I  DP+ +
Sbjct:   91 LLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPL--------LKQYILEKESAL----------FSTELSVLHNFFSPSPKTRRQGEVVQKLTQMVGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDVSDICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 362          
BLAST of Negative elongation factor B vs. UniProt/SwissProt
Match: sp|Q8C4Y3|NELFB_MOUSE (Negative elongation factor B OS=Mus musculus OX=10090 GN=Nelfb PE=1 SV=2)

HSP 1 Score: 82.4185 bits (202), Expect = 5.190e-15
Identity = 67/298 (22.48%), Postives = 129/298 (43.29%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            ++P    A+   DL G  R     S+ +   DK+   +   + +   +++ K    L++     +  P +QP++M VM  +  V E  L  ++  KELY    + V R +W ++     +E+  L        +KQY ++ E A+          +S+    +      + K R+  +   K+  M+G +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D+  A EL   +    K +  +  DL  I  DP+ +
Sbjct:   40 LLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPL--------LKQYILEKESAL----------FSTELSVLHNFFSPSPKTRRQGEVVQKLTQMVGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDVSDICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 311          
BLAST of Negative elongation factor B vs. UniProt/SwissProt
Match: sp|Q8WX92|NELFB_HUMAN (Negative elongation factor B OS=Homo sapiens OX=9606 GN=NELFB PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.363e-14
Identity = 68/313 (21.73%), Postives = 136/313 (43.45%), Query Frame = 1
Query:  142 EDIKSLQESIFTN--IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            E +K++++    N  ++P    A+   DL G  R     S+ +   DK+   +   + +   +++ K    L++     +  P +QP++M VM  +  V E  L  ++  KELY    + V R +W ++     +E+  L        +KQY ++ E A+          +S+    +      + K R+  +   ++  M+G +  +Y+ +++ L+  F+  +             TLR +++ SLHD     +   D  H     L++CIR+  +D+  A EL   +    K +  +  DL  I  DP+ +
Sbjct:   25 EPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRDKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRACAVEVKRQIWQDNQALFGDEVSPL--------LKQYILEKESAL----------FSTELSVLHNFFSPSPKTRRQGEVVQRLTRMVGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDVGEICTVDPCHKFTWCLDACIRERFVDSKRARELQGFLDGVKKGQEQVLGDLSMILCDPFAI 311          
BLAST of Negative elongation factor B vs. UniProt/SwissProt
Match: sp|Q9Y113|NELFB_DROME (Negative elongation factor B OS=Drosophila melanogaster OX=7227 GN=NELF-B PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.054e-8
Identity = 63/298 (21.14%), Postives = 127/298 (42.62%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            ++P     + L DL G+ R     S+     DK+   I    +K   ++ +KL   L+KS    +    ++P++M ++    ++ + +L  +++ +ELY  T   V R +W ++     +E+  L+S Y+    K++ +     +N L                       K R+  +   K+ +MIG S  +Y+ +++ L+  F+  +             TLR +++ +LHD     +   D  H     L++CIR+  +D   + EL   +    + +  +  DL     DPY +
Sbjct:   50 LLPSLRPMLPLLDLHGVRRLDFHTSLMEELRDKLIAHINEMGQKEPRERDKKLKELLVKS-FPVVRVKSLRPVVMAILRNTQHIDDKYLKILVRDRELYADTDTEVKRQIWRDNQSLFGDEVSPLLSQYIRE--KEHILFDHTNLNNL-----------------FFHPTPKVRRQGEVVQKLANMIGTSVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMALHDLEVQEIISIDPCHKFTWCLDACIREKNVDIKRSRELQGFLDNIKRGQEQVLGDLSMTLCDPYAI 319          
BLAST of Negative elongation factor B vs. TrEMBL
Match: A0A4S2M0I8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003581 PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 3.996e-43
Identity = 112/380 (29.47%), Postives = 195/380 (51.32%), Query Frame = 1
Query:   85 FSEMFEAVEKLFSHREITEEDIKSLQESIFTNIIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVE----------GQLKKE-PSISLNP-----------------------------------------------ISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQMKERHHLSKDLEFICTD 1050
            F  M +A+E LF+   IT+ED+++ Q+  +  ++P F++A+ L D+ G+ R+++  SIN+  +D IK  +E K E  D +K QKLW KL+K+G  YIHHP M+ LIM V+GKM  +KE H+  I+ ++ LY+  P+ VLRH+W+ HP+K  EE+D +I         ++     +A+   +S      +SS+ D+ PL+    K+R+ D   +++V+MIGD + +Y+  +  L+D+ V           G + +E P+  + P                                               +ST+RFD++ SL++    RL   D +H  +  L++C+R+  ID  HA  L   +  +   +K ++   ++
Sbjct:   13 FPVMKKAIEDLFTKPTITKEDVEAFQDRYWEQLVPNFSQALKLLDIHGVPRHNILWSINDRLLDAIKAGVEAKCEDPDQRKCQKLWQKLIKTGMVYIHHPYMRALIMQVLGKMNAIKERHVNMIVDNQYLYDDAPLPVLRHIWVAHPQKFQEELDKVIV--------RFQNSWSDALLDALSMGITSTASSTADLLPLLYWPPKRRRRDTAIIRMVEMIGDGQTLYDKTVTFLRDQCVRLEQAASNLALGSVNREAPAEPITPPPKRRRRVDSTESTSEKVRQTETPTSGVVPFTPPAFLPNQPAVVSTVLSTIRFDLLMSLNEAKIDRLCVPDRIHQFVWCLDACVRNRRIDQRHASGLAYHLTVQRQRAKKVDAAASE 384          
BLAST of Negative elongation factor B vs. TrEMBL
Match: H2KPE6 (Negative elongation factor B OS=Clonorchis sinensis OX=79923 GN=NELFB PE=4 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 5.050e-43
Identity = 110/377 (29.18%), Postives = 194/377 (51.46%), Query Frame = 1
Query:   94 MFEAVEKLFSHREITEEDIKSLQESIFTNIIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVE----------GQLKKE------------------------------------------------PSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQMKERHHLSKDLEFICTD 1050
            M +A+E LF+   IT+ED+++ Q+  +  ++P F++A+ L D+ G+ R+++  SIN+  +D IK  +E K E  D +K QKLW KL+K+G  YIHHP M+ LIM V+GKM  +KE H+  I+ ++ LY+  P+ VLRH+W+ HP K  EE+D +I+        ++     +A+   +S      +SS+ D+ PL+    K+R+ D   +++V+MIGD + +Y+  +  L+D+ V           G + +E                                                P++    +ST+RFD++ SL++    RL   D +H  +  L++C+R+  ID  HA  L   +  +   +K ++ + ++
Sbjct:    1 MKKAIEDLFTKPTITKEDVEAFQDRYWEQLVPNFSQALKLLDIHGVPRHNILWSINDRLLDAIKAGVEAKCEDPDQRKCQKLWQKLIKTGMVYIHHPYMRALIMQVLGKMNAIKERHVNMIVDNQYLYDDAPLPVLRHIWVAHPHKFQEELDKVIA--------KFQNSWSDALLDALSMGITSTASSTADLLPLLYWPPKRRRRDTAIIRMVEMIGDGQTLYDKTVTFLRDQCVRLEQAASNLALGSINREASAEPITPPTKRRRRLDSNESSAEKVRQTETPTSGVVPFTPPAFLPNQPAVVSTVLSTIRFDLLMSLNEAKIDRLCVPDRIHQFVWCLDACVRNRRIDQRHASGLAYHLTVQRQRAKKMDAVASE 369          
BLAST of Negative elongation factor B vs. TrEMBL
Match: A0A4S2M0I9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003581 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 6.784e-43
Identity = 112/380 (29.47%), Postives = 195/380 (51.32%), Query Frame = 1
Query:   85 FSEMFEAVEKLFSHREITEEDIKSLQESIFTNIIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVE----------GQLKKE-PSISLNP-----------------------------------------------ISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQMKERHHLSKDLEFICTD 1050
            F  M +A+E LF+   IT+ED+++ Q+  +  ++P F++A+ L D+ G+ R+++  SIN+  +D IK  +E K E  D +K QKLW KL+K+G  YIHHP M+ LIM V+GKM  +KE H+  I+ ++ LY+  P+ VLRH+W+ HP+K  EE+D +I         ++     +A+   +S      +SS+ D+ PL+    K+R+ D   +++V+MIGD + +Y+  +  L+D+ V           G + +E P+  + P                                               +ST+RFD++ SL++    RL   D +H  +  L++C+R+  ID  HA  L   +  +   +K ++   ++
Sbjct:   13 FPVMKKAIEDLFTKPTITKEDVEAFQDRYWEQLVPNFSQALKLLDIHGVPRHNILWSINDRLLDAIKAGVEAKCEDPDQRKCQKLWQKLIKTGMVYIHHPYMRALIMQVLGKMNAIKERHVNMIVDNQYLYDDAPLPVLRHIWVAHPQKFQEELDKVI--------VRFQNSWSDALLDALSMGITSTASSTADLLPLLYWPPKRRRRDTAIIRMVEMIGDGQTLYDKTVTFLRDQCVRLEQAASNLALGSVNREAPAEPITPPPKRRRRVDSTESTSEKVRQTETPTSGVVPFTPPAFLPNQPAVVSTVLSTIRFDLLMSLNEAKIDRLCVPDRIHQFVWCLDACVRNRRIDQRHASGLAYHLTVQRQRAKKVDAAASE 384          
BLAST of Negative elongation factor B vs. TrEMBL
Match: A0A3S5C8B2 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS35345 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 1.973e-41
Identity = 112/359 (31.20%), Postives = 182/359 (50.70%), Query Frame = 1
Query:   94 MFEAVEKLFSHREITEEDIKSLQESIFTNIIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQD------------------------------------KFVEGQLK------KEPSISLNP-----------------ISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELC 993
            M +A+E LF+   I+ EDI+  QE  +  ++P F++A+ L D+  I R+++  +IN+  ++ IKN+IE KS+  D K Q+     +  +G  YIHHP M+ LIM V+GKM ++K+ H+  I+ SK LY+  P+ VLRH+W  HP+K  EE D ++ +Y +N M+        AI           +S+S D+ P+I    ++R+ D   ++IV+MIGD +V+YE  + IL++                                    + VE  L+       +PS  L P                 +STLRFD++ SL++    +L   D +H  +  +++CIR   ID  HA E+ 
Sbjct:    1 MKKAIEDLFTQDHISGEDIEVFQEKYWEQMVPNFSQALKLLDIHSINRHNVLWNINDRLLETIKNKIESKSDDKDKKVQRLWQRLIK-TGMVYIHHPYMRSLIMQVLGKMHSIKDRHVYLIVDSKYLYDDAPLPVLRHIWSAHPQKFREEFDKVLVSYQNNWMESMLDSLYAAITS--------STSASADLLPMIYWPPRRRRKDPSVVRIVEMIGDKQVLYEKAVTILREECINLETALAEQAVGAPGVTQISSLCLSNSQNPARKRKVEQALEVDETYLGKPSFILQPFTSPALLPNQQAIASSALSTLRFDLLMSLNEAKNVQLCVPDAIHRFVWCMDACIRTRRIDRRHASEMA 350          
BLAST of Negative elongation factor B vs. TrEMBL
Match: A0A4E0S0C7 (Negative elongation factor B OS=Fasciola hepatica OX=6192 GN=D915_005764 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 2.819e-40
Identity = 94/236 (39.83%), Postives = 152/236 (64.41%), Query Frame = 1
Query:   85 FSEMFEAVEKLFSHREITEEDIKSLQESIFTNIIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDK 792
            F  M +A+E LF+   IT+EDI+S Q+  +  ++P F++A+ L D+ G++R+S+  SIN+  +D IK  ++ K+E  D +K QKLW KL+K+G  YIHHP M+PLIM V+GK  ++KE H+  I+ +  LY   P+ VLRH+W+ HP K  EE+  +I+ + +N        C+  ++ L S      +SS+ D+ PL+    ++R+ D   ++IV+MIGD +V+YE I+ IL+D+
Sbjct:   13 FPVMKKAIESLFTKPCITKEDIESFQDRYWEQLVPNFSQALKLLDIHGVSRHSILWSINDRLLDAIKVNVDAKAEDPDQRKCQKLWQKLIKTGMVYIHHPYMRPLIMQVLGKTNSIKERHVNLIVDNPYLYGDAPLPVLRHIWVAHPHKFQEELQRVITRFQNN-------WCDALLDAL-SMAISSTASSTADLVPLLYWPPRRRRRDSAVVRIVEMIGDGQVLYEKIVNILRDE 240          
BLAST of Negative elongation factor B vs. Ensembl Cavefish
Match: nelfb (negative elongation factor complex member B [Source:NCBI gene;Acc:103024451])

HSP 1 Score: 85.8853 bits (211), Expect = 4.515e-17
Identity = 75/297 (25.25%), Postives = 131/297 (44.11%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYV 1059
            ++P    A+   DL G  R     S+ +   DK+   + V +E  D+ +  KL   L KS    +  P +QP++M VM  +  V E  L +++  KELY+   + V R +W ++     +E+  L        +KQY ++ E A+          +SS    +      + K R+  +   K+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ 
Sbjct:   40 LLPTLQSALPFLDLHGTPRLEFHQSVFDELRDKLMERVAVIAEGKDEDRYTKLEELLEKS-FPLVKMPSIQPVVMQVMKHLPKVPEKKLKQVMADKELYKVCAVEVKRQIWQDNQALFGDEVSPL--------LKQYIVEKEAAL----------FSSDLSILHNFFSPSPKTRRQGEVVQKLTQMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICSVDPCHKFTWCLDACIREKFVDAKRARELQGFLDGVKKGQEQVLGDLSMILCDPFA 309          
BLAST of Negative elongation factor B vs. Ensembl Sea Lamprey
Match: nelfb (negative elongation factor complex member B [Source:ZFIN;Acc:ZDB-GENE-040426-765])

HSP 1 Score: 79.337 bits (194), Expect = 1.103e-15
Identity = 71/315 (22.54%), Postives = 134/315 (42.54%), Query Frame = 1
Query:  142 EDIKSLQESIFTN--IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEA-INKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNP-ISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYVL 1062
            + +K++++    N  ++P    A+   DL  I R     S+ +   DK+   + V + +     +     +L++     +  P +QP++M ++  +  V E +L ++     LY      V R +W E+     +E   L         KQY  + E A +   +S  +  YSSS            K R+  Q   K+  MIG +  +Y+ +++ L+  F+  +         NP   TLR +++ +LHD   + +   D  H     L++CIR+  +D   A EL   +    + +  +  DL  I  DP+ +
Sbjct:   26 DPLKAIEQFQLENGVLLPSLQSALPFLDLHAIPRLDFHQSVFDELRDKLLERVAVIATEGPPLSRNTKLEELLEKSFALVRMPSVQPVVMCLLKHIPKVPERYLKQVTSDPALYAACATEVKRQIWQENQALFGDEASPLF--------KQYLAERETALLGPELSAVHTFYSSSP-----------KARRHGQVVQKLTGMIGRNVKLYDMVLQFLRTLFLRTR---------NPHYCTLRAELLMALHDLEATDICSVDPCHKFTWCLDACIRERFVDVKRARELQGFLDGIKRGQEQVLGDLSMILCDPFAI 312          
BLAST of Negative elongation factor B vs. Ensembl Nematostella
Match: EDO30397 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0W2])

HSP 1 Score: 75.0998 bits (183), Expect = 5.075e-14
Identity = 72/349 (20.63%), Postives = 146/349 (41.83%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITR----NSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPI--STLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHA------IELCKQMKERHHLSKDLEFICTDPYVLYXXXXXXXXXXXXXXXGKKKLPRQISKLTFLSSLLSYGLTDFE 1191
            ++P    A+   DL G+ R    +S+   +  + ++K+K+    K E++ +                +IH   ++P+++ VM  +  + +  L  I    +LYE  PI V R +W +H     + +  L++ Y+                   ++   ++S+ + +      V +K R+       +  MIG S  +Y  +++ L+  F+            N +   TLR +++ ++HD     + D D  H     L++CIR+  I+          +E+ K  +ER  +  D+  I  DP+ +  T    +   +        LPR    +TFL  LL+ G++ ++
Sbjct:   39 LLPSLQSALPFLDLHGVRRLDFHSSVMEHLRESVLEKVKDLSTQKLEEILE------------QSFPFIHVKELRPVVVAVMKHLPKINDECLEHIANDAKLYEDCPIEVKRQIWSKHHHLFGDAVGPLLNQYIE------------------AKYTLLHSTEAHNSHSFFSVPSKTRRQHAIVQGLAKMIGKSLSLYNLVLQFLRTLFLRA----------NEVHYCTLRSELLMAVHDLEVKDIKDVDPCHKFTWCLDACIREKSIEGKRVRELQGFLEMAKNGEER--VLGDIAMILCDPFAI-NTIAKSIIKLLHRLANTDTLPRTSEDITFLLRLLNLGVSAWD 344          
BLAST of Negative elongation factor B vs. Ensembl Medaka
Match: nelfb (negative elongation factor complex member B [Source:NCBI gene;Acc:101159935])

HSP 1 Score: 84.7297 bits (208), Expect = 1.084e-16
Identity = 73/297 (24.58%), Postives = 131/297 (44.11%), Query Frame = 1
Query:  181 IIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQM----KERHHLSKDLEFICTDPYV 1059
            ++P    A+   DL G  R     S+ +   DK+   + V ++  ++ +  KL   L KS    +  P +QP++M V+  +  V E  L  ++  KELY+   + V R +W ++     +E+  L        +KQY ++ E A+          +SS    +      + K R+  +  LK+  MIG +  +Y+ +++ L+  F+  +             TLR +++ SLHD   S +   D  H     L++CIR+  +D   A EL   +    K +  +  DL  I  DP+ 
Sbjct:   40 LLPTLQSALPFLDLHGTPRLEFHQSVFDELRDKLMERVAVIADGKEEDRYGKLEELLEKS-FPLVKMPSIQPVVMQVLKHLPKVPEKKLKLVMADKELYKVCAVEVKRQIWQDNQALFGDEVSPL--------LKQYIVEKEAAL----------FSSDLSILHNFFSPSPKTRRQGEVVLKLTHMIGKNVKLYDMVLQFLRTLFLRTRNVH--------YCTLRAELLMSLHDLDISEICSVDPCHKFTWCLDACIREKFVDGKRARELQGFLDGVKKGQEQVLGDLSMILCDPFA 309          
BLAST of Negative elongation factor B vs. Planmine SMEST
Match: SMESG000043328.1 (SMESG000043328.1)

HSP 1 Score: 1327 bits (3433), Expect = 0.000e+0
Identity = 688/692 (99.42%), Postives = 688/692 (99.42%), Query Frame = 1
Query:   70 MDSSQFSEMFEAVEKLFSHREITEEDIKSLQESIFTNIIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEXXXXXXXXXXXXXXXXSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQMKERHHLSKDLEFICTDPYVLYXXXXXXXXXXXXXXXGKKKLPRQISKLTFLSSLLSYGLTDFESDGSIDRTHSSLKSPSFSAKKRPSFSFENDSNSSWTKDEIIETLMLNVLPNVQHTHISVKREHVCNQKNKVNASVLKRSASEVTSTPTKHATVPTQYLGNPLGRLIIQYHCIIALQRKEFFXXXXXXTTISTNRRSDHRPTVDWRPELLQDLVFAICSLQNTNEKLMNDFLNLLRPVIPMSSIMFQLLYLVTVAAIKDPSEIEKLIETFQKHPNVDVDSTVLPTGKSLRELVDLILKGNPKDSQLVQMTPLGNRFMMPTPSYSMAPGTPLPMRTPFHSQSSIETIRYSMTPQPFSPESGPSTPTAMSAPRFGPINKPY 2145
            MDSSQFSEMFEAVEKLFSHREITEEDIKSLQESIFTNIIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEKLDDKKQQKLWLKLMKSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQMKERHHLSKDLEFICTDPYVLYTTALTILTLAIETAIGKKKLPRQISKLTFLSSLLSYGLTDFESDGSIDRTHSSLKSPSFSAKKRPSFSFENDSNSSWTKDEIIETLMLNVLPNVQHTHISVKREHVCNQKNKVNASVLKRSASEVTSTPTKHATVPTQYLGNPLGRLIIQYHCIIALQRKEFFLLKLLLTTISTNRRSDHRPTVDWRPELLQDLVFAICSLQNTNEKLMNDFLNLLRPVIPMSSIMFQLLYLVTVAAIKDP EIEKLIETFQKHPNVDVDSTVLPTGKSLRELVDLILKGNPKDSQLVQMTPLGNRFMMPTPSYSMAPGTPLPMRTPFHSQSSIET RYSMTPQP  PESGPSTPTAMSAPRFGPINKPY
Sbjct:    1 MDSSQFSEMFEAVEKLFSHREITEEDIKSLQESIFTNIIPQFNEAIILTDLLGITRNSLFNSINNAFIDKIKNEIEVKSEKLDDKKQQKLWLKLMKSGHKYIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLEHPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDVTPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKEPSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCIDNAHAIELCKQMKERHHLSKDLEFICTDPYVLYTTALTILTLAIETAIGKKKLPRQISKLTFLSSLLSYGLTDFESDGSIDRTHSSLKSPSFSAKKRPSFSFENDSNSSWTKDEIIETLMLNVLPNVQHTHISVKREHVCNQKNKVNASVLKRSASEVTSTPTKHATVPTQYLGNPLGRLIIQYHCIIALQRKEFFLLKLLLTTISTNRRSDHRPTVDWRPELLQDLVFAICSLQNTNEKLMNDFLNLLRPVIPMSSIMFQLLYLVTVAAIKDPLEIEKLIETFQKHPNVDVDSTVLPTGKSLRELVDLILKGNPKDSQLVQMTPLGNRFMMPTPSYSMAPGTPLPMRTPFHSQSSIETPRYSMTPQPVFPESGPSTPTAMSAPRFGPINKPY 692          
BLAST of Negative elongation factor B vs. Planmine SMEST
Match: SMESG000043340.1 (SMESG000043340.1)

HSP 1 Score: 305.834 bits (782), Expect = 1.904e-100
Identity = 150/152 (98.68%), Postives = 151/152 (99.34%), Query Frame = 1
Query: 1690 MNDFLNLLRPVIPMSSIMFQLLYLVTVAAIKDPSEIEKLIETFQKHPNVDVDSTVLPTGKSLRELVDLILKGNPKDSQLVQMTPLGNRFMMPTPSYSMAPGTPLPMRTPFHSQSSIETIRYSMTPQPFSPESGPSTPTAMSAPRFGPINKPY 2145
            MNDFL+LLRPVIPMSSIMFQLLYLVTVAAIKDPSEIEKLIETFQKHPNVDVDSTVLPTGKSLRELVDLILKGNPKDSQLVQMTPLGNRFMMPTPSYSMAPGTPLPMRTPFHSQSSIET RYSMTPQPFSPESGPSTPTAMSAPRFGPINKPY
Sbjct:    1 MNDFLSLLRPVIPMSSIMFQLLYLVTVAAIKDPSEIEKLIETFQKHPNVDVDSTVLPTGKSLRELVDLILKGNPKDSQLVQMTPLGNRFMMPTPSYSMAPGTPLPMRTPFHSQSSIETPRYSMTPQPFSPESGPSTPTAMSAPRFGPINKPY 152          
The following BLAST results are available for this feature:
BLAST of Negative elongation factor B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NELFB3.628e-1521.73negative elongation factor complex member B [Sourc... [more]
NELFB4.062e-1521.73negative elongation factor complex member B [Sourc... [more]
back to top
BLAST of Negative elongation factor B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Negative elongation factor B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NELF-B2.049e-921.14gene:FBgn0027553 transcript:FBtr0071077[more]
back to top
BLAST of Negative elongation factor B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nelfb2.889e-1624.24negative elongation factor complex member B [Sourc... [more]
nelfb2.929e-1624.24negative elongation factor complex member B [Sourc... [more]
nelfb3.187e-1624.24negative elongation factor complex member B [Sourc... [more]
back to top
BLAST of Negative elongation factor B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc1223.048e-1323.08coiled-coil domain containing 122 [Source:Xenbase;... [more]
ccdc1223.736e-1323.08coiled-coil domain containing 122 [Source:Xenbase;... [more]
ccdc1224.146e-1323.08coiled-coil domain containing 122 [Source:Xenbase;... [more]
ccdc1224.251e-1323.08coiled-coil domain containing 122 [Source:Xenbase;... [more]
ccdc1224.481e-1323.08coiled-coil domain containing 122 [Source:Xenbase;... [more]
back to top
BLAST of Negative elongation factor B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nelfb5.678e-1622.48negative elongation factor complex member B [Sourc... [more]
back to top
BLAST of Negative elongation factor B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q8C4Y3|NELFB_MOUSE5.190e-1522.48Negative elongation factor B OS=Mus musculus OX=10... [more]
sp|Q8WX92|NELFB_HUMAN2.363e-1421.73Negative elongation factor B OS=Homo sapiens OX=96... [more]
sp|Q9Y113|NELFB_DROME2.054e-821.14Negative elongation factor B OS=Drosophila melanog... [more]
back to top
BLAST of Negative elongation factor B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M0I83.996e-4329.47Uncharacterized protein OS=Opisthorchis felineus O... [more]
H2KPE65.050e-4329.18Negative elongation factor B OS=Clonorchis sinensi... [more]
A0A4S2M0I96.784e-4329.47Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3S5C8B21.973e-4131.20Uncharacterized protein OS=Protopolystoma xenopodi... [more]
A0A4E0S0C72.819e-4039.83Negative elongation factor B OS=Fasciola hepatica ... [more]
back to top
BLAST of Negative elongation factor B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nelfb4.515e-1725.25negative elongation factor complex member B [Sourc... [more]
back to top
BLAST of Negative elongation factor B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nelfb1.103e-1522.54negative elongation factor complex member B [Sourc... [more]
back to top
BLAST of Negative elongation factor B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Negative elongation factor B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO303975.075e-1420.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Negative elongation factor B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nelfb1.084e-1624.58negative elongation factor complex member B [Sourc... [more]
back to top
BLAST of Negative elongation factor B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000043328.10.000e+099.42SMESG000043328.1[more]
SMESG000043340.11.904e-10098.68SMESG000043340.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026434 ID=SMED30026434|Name=Negative elongation factor B|organism=Schmidtea mediterranea sexual|type=transcript|length=2194bp
CAAAGATTTAAAACTGAATTAAAATTATTTATTTAAATTTAAATAAACAT
CTAGTCACCGTTACTTCAGATGGATAGTTCTCAATTTTCTGAAATGTTTG
AAGCGGTAGAGAAATTATTTTCTCATCGAGAAATTACTGAAGAAGACATT
AAATCATTACAAGAAAGTATATTTACAAACATAATTCCTCAGTTTAATGA
AGCAATTATCTTGACCGATCTTCTTGGAATAACAAGAAATAGTTTATTTA
ACTCTATTAATAATGCATTTATTGATAAAATCAAAAATGAAATCGAAGTA
AAAAGCGAAAAATTAGACGATAAAAAGCAACAAAAATTGTGGTTAAAATT
AATGAAATCAGGTCATAAATATATTCATCATCCTGTTATGCAGCCTTTAA
TTATGCATGTTATGGGTAAAATGACAAATGTTAAGGAATCTCATTTGACT
GAGATATTGAAATCAAAAGAACTCTATGAAAAAACTCCAATTAATGTGTT
GCGTCATGTCTGGCTAGAACATCCAGAAAAACTAAATGAAGAAATCGATC
ATTTAATAAGCGCATATGTTTCGAATTCAATGAAACAATATCATATTCAA
TGCGAAGAAGCTATTAATAAACTCGTATCTCAACGTAACAAAGTCTACAG
TTCATCATCAATGGATGTTACGCCTCTAATCCAAGTCAATGCAAAAAAAC
GAAAGCTAGATCAGTATTGCTTGAAAATAGTCGACATGATTGGCGACAGT
AAAGTAATATATGAAAATATCATGAAAATACTCCAGGACAAATTTGTTGA
AGGACAACTGAAAAAGGAACCATCGATATCTCTCAACCCGATTAGTACGC
TGCGATTTGATGTCGTGACAAGCTTGCATGATAAGCATTTCAGTCGATTA
TTCGACACAGACGATTTGCACATGTTAATATTGCACCTGAATTCATGCAT
CCGTGACCATTGCATCGATAATGCTCACGCCATTGAACTGTGCAAGCAAA
TGAAGGAACGCCATCACCTTTCCAAAGATTTAGAATTTATTTGTACCGAT
CCGTATGTCCTGTACACAACTGCACTCACAATTCTCACACTGGCAATCGA
AACGGCGATAGGCAAGAAAAAACTGCCAAGACAAATCAGCAAATTGACAT
TTTTGTCATCCCTTCTGAGTTACGGCCTTACCGATTTTGAATCAGACGGC
AGCATCGATCGCACGCATTCCTCGCTAAAATCGCCATCTTTCTCTGCGAA
AAAACGTCCTAGTTTCAGTTTCGAAAACGATTCCAATAGCAGTTGGACAA
AAGATGAAATCATAGAAACGCTGATGCTGAATGTGCTGCCGAATGTCCAG
CACACCCATATCAGCGTCAAACGGGAACATGTGTGCAACCAAAAGAACAA
AGTCAATGCATCGGTGTTGAAGCGGTCCGCATCGGAGGTGACATCAACTC
CGACAAAGCACGCTACCGTTCCTACTCAGTATCTTGGCAATCCGCTTGGA
CGATTGATTATCCAGTATCACTGCATCATCGCGTTACAGAGAAAGGAATT
CTTCCTATTGAAGTTGCTATTGACAACTATTTCCACCAATCGCAGGTCTG
ATCATCGGCCGACAGTTGATTGGAGGCCAGAGCTTTTACAGGATCTCGTG
TTTGCCATTTGCAGCCTTCAAAACACCAATGAAAAACTGATGAATGATTT
CCTGAACTTATTGCGTCCAGTGATTCCCATGTCATCGATAATGTTTCAGC
TTCTCTACCTTGTCACTGTGGCTGCTATTAAAGACCCGTCGGAAATAGAA
AAACTAATTGAAACCTTCCAAAAGCATCCTAATGTAGATGTCGATTCTAC
TGTTCTTCCCACGGGGAAATCTCTGAGAGAACTGGTCGACTTAATTCTTA
AAGGGAATCCTAAGGACTCGCAATTGGTTCAAATGACTCCGCTAGGAAAT
CGATTTATGATGCCTACCCCGTCGTATTCTATGGCTCCCGGAACCCCGTT
ACCGATGAGGACGCCTTTTCATTCTCAATCTTCAATTGAAACCATTCGAT
ATTCCATGACACCTCAGCCGTTTTCCCCGGAATCTGGTCCCAGTACACCA
ACAGCCATGTCGGCACCGAGATTCGGACCAATCAATAAACCCTATTAACT
GATTTTATAAATAAATCTTGTCAATTTTGTCTTTTGATTTATTA
back to top

protein sequence of SMED30026434-orf-1

>SMED30026434-orf-1 ID=SMED30026434-orf-1|Name=SMED30026434-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=693bp
MDSSQFSEMFEAVEKLFSHREITEEDIKSLQESIFTNIIPQFNEAIILTD
LLGITRNSLFNSINNAFIDKIKNEIEVKSEKLDDKKQQKLWLKLMKSGHK
YIHHPVMQPLIMHVMGKMTNVKESHLTEILKSKELYEKTPINVLRHVWLE
HPEKLNEEIDHLISAYVSNSMKQYHIQCEEAINKLVSQRNKVYSSSSMDV
TPLIQVNAKKRKLDQYCLKIVDMIGDSKVIYENIMKILQDKFVEGQLKKE
PSISLNPISTLRFDVVTSLHDKHFSRLFDTDDLHMLILHLNSCIRDHCID
NAHAIELCKQMKERHHLSKDLEFICTDPYVLYTTALTILTLAIETAIGKK
KLPRQISKLTFLSSLLSYGLTDFESDGSIDRTHSSLKSPSFSAKKRPSFS
FENDSNSSWTKDEIIETLMLNVLPNVQHTHISVKREHVCNQKNKVNASVL
KRSASEVTSTPTKHATVPTQYLGNPLGRLIIQYHCIIALQRKEFFLLKLL
LTTISTNRRSDHRPTVDWRPELLQDLVFAICSLQNTNEKLMNDFLNLLRP
VIPMSSIMFQLLYLVTVAAIKDPSEIEKLIETFQKHPNVDVDSTVLPTGK
SLRELVDLILKGNPKDSQLVQMTPLGNRFMMPTPSYSMAPGTPLPMRTPF
HSQSSIETIRYSMTPQPFSPESGPSTPTAMSAPRFGPINKPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR010405COBRA1
Vocabulary: biological process
TermDefinition
GO:0045892negative regulation of transcription, DNA-templated
GO:0006414translational elongation
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0003746translation elongation factor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 68..88
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 667..692
IPR010405Cofactor of BRCA1PFAMPF06209COBRA1coord: 106..371
e-value: 1.7E-22
score: 80.0
IPR010405Cofactor of BRCA1PANTHERPTHR13503NEGATIVE ELONGATION FACTOR COMPLEX MEMBER Bcoord: 12..534