Leucine carboxyl methyltransferase 2

Overview
NameLeucine carboxyl methyltransferase 2
Smed IDSMED30026423
Length (bp)2417
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine carboxyl methyltransferase 2 (SMED30026423) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine carboxyl methyltransferase 2 (SMED30026423) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine carboxyl methyltransferase 2 (SMED30026423) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine carboxyl methyltransferase 2 (SMED30026423) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026423

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30026423h1SMcG0016341 SmedASXL_009154SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026423h1SMcG0016341 SmedASXL_009155SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30026423h1SMcG0016341 dd_Smed_v4_3702_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Human
Match: LCMT2 (leucine carboxyl methyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:17558])

HSP 1 Score: 259.225 bits (661), Expect = 4.502e-75
Identity = 223/773 (28.85%), Postives = 349/773 (45.15%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAI---QIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSP---EHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRPGPILIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTGNRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRHIEPARSQLLA--------NSLCGSMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXXXXXCSGSVVSIG-TDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGV-SHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            +Q TND+S LSK S+   GY  D F   ++   +RRAPLI+RGYY+RA+A+ H +  F+E      A    QI SLGAGFD+ +FRL   G+L      E+D+ DVA+RKA  + +  +L   L+ P     P S      +   +++Y ++G+D+ +L  ++  + A+G+    PTL L+E V+TY+  + +A+L+ + A+ F    FV+YEQ+ P D+FG+FM  HF+QL S L G++ +   E Q  R L AGW +  + DM EFY+  + +EE+ R+E++E FDE+EEW LKC HY +L A RG         L+            A  S                    + ++    + + P  K  G  + ++  D+I            L + G+G+      HCR++   +L    +     E   SQ+ +          L  +MTR+S +  ++ GGR SP+ P      LQLH+    +    +                                   A  + D     WRH        ++ YL +YGGRS     LSD +       +W              G V     + S C+        G          S   L P       CG    W  +       PR+SHT+H++            +  VGG+  H +   GVT+I++    +S    +  +DT      +M+HNH S    + +Q+ ++GGGGNCFSFGT  N +  ++DLS++
Sbjct:   13 VQNTNDSSALSKRSLAARGYVQDPFAALLVPGAARRAPLIHRGYYVRARAVRHCVRAFLEQIGAPQAALRAQILSLGAGFDSLYFRLKTAGRLARAAVWEVDFPDVARRKAERIGETPELC-ALTGPFERGEPASA-----LCFESADYCILGLDLRQLQRVEEALGAAGLDAASPTLLLAEAVLTYLEPESAAALIAWAAQRFPNALFVVYEQMRPQDAFGQFMLQHFRQLNSPLHGLERFPDVEAQRRRFLQAGWTACGAVDMNEFYHCFLPAEERRRVENIEPFDEFEEWHLKCAHYFILAASRGDTL---SHTLVFPSSEAFPRVNPASPSGV------------------FPASVVSSEGQVPNLKRYGHASVFLSPDVI------------LSAGGFGEQ--EGRHCRVSQFHLLSRDCDS----EWKGSQIGSCGTGVQWDGRLYHTMTRLSESRVLVLGGRLSPVSPA--LGVLQLHFFKSEDNNTEDLKVTITK----------------------------AGRKDDSTLCCWRHSTTEVSCQNQEYLFVYGGRSVVEPVLSDWHFLHVGTMAW--------VRIPVEGEVPEARHSHSACTWQGGALIAGGLGASEEPLNSVLFLRPIS-----CGF--LWESVDIQPPITPRYSHTAHVL---------NGKLLLVGGIWIHSSSFPGVTVINLTTGLSS----EYQIDTTYVPWPLMLHNHTSILLPEEQQLLLLGGGGNCFSFGTYFNPHTVTLDLSSL 682          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Human
Match: LCMT1 (leucine carboxyl methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:17557])

HSP 1 Score: 166.777 bits (421), Expect = 3.852e-45
Identity = 105/310 (33.87%), Postives = 174/310 (56.13%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLP-FMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYI-----VINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYE--EWLLKCNHYMVLVACRG 1015
            ++GT +++ L K   +  GY++D ++  F+     R+AP INRGY+ R   +  ++  F+   +     QI +LGAG DT+F+RL  +  L +  + E+D+  +  RK        K    LSSP   + LH ++ +     ++++  Y +IG D+  L  L+  ++   ++  LPTL ++ECV+ Y++ ++SA+LLK+ A SF    F+ YEQ+   D FG+ M  + ++    L G++T K+ E Q ERLL  GW++A++ DM E  YN +   E SRIE LE  DE E  E L++  HY +  A +G
Sbjct:   26 VRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTEC--HCQIVNLGAGMDTTFWRLKDEDLLPS-KYFEVDFPMIVTRKL----HSIKCKPPLSSP--ILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMEL-YNRLPRAEVSRIESLEFLDEMELLEQLMR--HYCLCWATKG 323          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Human
Match: LCMT1 (leucine carboxyl methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:17557])

HSP 1 Score: 105.531 bits (262), Expect = 2.139e-24
Identity = 59/139 (42.45%), Postives = 86/139 (61.87%), Query Frame = 2
Query:  605 SYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYE--EWLLKCNHYMVLVACRG 1015
            S  LPTL ++ECV+ Y++ ++SA+LLK+ A SF    F+ YEQ+   D FG+ M  + ++    L G++T K+ E Q ERLL  GW++A++ DM E  YN +   E SRIE LE  DE E  E L++  HY +  A +G
Sbjct:  133 SIKLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLSNGWETASAVDMMEL-YNRLPRAEVSRIESLEFLDEMELLEQLMR--HYCLCWATKG 268          

HSP 2 Score: 60.4622 bits (145), Expect = 3.051e-9
Identity = 34/108 (31.48%), Postives = 61/108 (56.48%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLP-FMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRK 430
            ++GT +++ L K   +  GY++D ++  F+     R+AP INRGY+ R   +  ++  F+   +     QI +LGAG DT+F+RL  +  L +  + E+D+  +  RK
Sbjct:   26 VRGTCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTEC--HCQIVNLGAGMDTTFWRLKDEDLLPS-KYFEVDFPMIVTRK 130          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Human
Match: LCMT1 (leucine carboxyl methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:17557])

HSP 1 Score: 80.1073 bits (196), Expect = 7.709e-17
Identity = 47/153 (30.72%), Postives = 84/153 (54.90%), Query Frame = 2
Query:  392 FIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYI-----VINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQ 835
            + E+D+  +  RK        K    LSSP   + LH ++ +     ++++  Y +IG D+  L  L+  ++   ++  LPTL ++ECV+ Y++ ++SA+LLK+ A SF    F+ YEQ+   D FG+ M  + ++    L G++T K+ E Q
Sbjct:    8 YFEVDFPMIVTRKL----HSIKCKPPLSSP--ILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQ 154          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Human
Match: LCMT1 (leucine carboxyl methyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:17557])

HSP 1 Score: 66.6254 bits (161), Expect = 6.940e-13
Identity = 30/75 (40.00%), Postives = 49/75 (65.33%), Query Frame = 2
Query:  614 LPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQM 838
            LPTL ++ECV+ Y++ ++SA+LLK+ A SF    F+ YEQ+   D FG+ M  + ++    L G++T K+ E Q+
Sbjct:    2 LPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNMGDRFGQIMIENLRRRQCDLAGVETCKSLESQV 76          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Celegans
Match: lcmt-1 (Leucine carboxyl methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:P46554])

HSP 1 Score: 155.606 bits (392), Expect = 1.543e-41
Identity = 106/316 (33.54%), Postives = 160/316 (50.63%), Query Frame = 2
Query:   92 ISNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFS-----RRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQG-KLDNCTFIELDYFDVAQRK-----AVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVA 1006
            +S+   +Q TND++   K    + GY+ DEF+       S     RR P I+ GY+ R  AIE  +  F+  N+     Q+ SLG GFDT F+RL   G KL    ++E+D+  V  +K       +      L K   S +  VS H D    ++A NY LIG D+ + + LD  +    +S+D+PT+F++ECV+ Y+S   S +LLK I   F +  FV YEQ    D+F + M  +    G  L G++  ++ E Q ER  +AG+      DM + + N +  +E SRI  +E+ DE E       HY V+ A
Sbjct:   25 VSDDYSVQRTNDDATQCKYFATQKGYWKDEFISRFANSSSNVSEARRFPEISMGYWARTAAIEKYVRDFL--NEFDGNAQVVSLGCGFDTLFWRLVSSGAKL--VKYVEVDFSSVTSKKIRHILKPIGPNSVDLKKSFES-DAVVSHHAD----LHAGNYHLIGADLRQANELDQKLATCQLSHDIPTIFIAECVLVYMSADSSTALLKQIVSQFKQPAFVNYEQFRTSDAFTKVMEQNLGDRGIQLHGLEMCESAEKQEERFRNAGFKEVKVMDMNQIFNNFLDQKEVSRIREIEMLDEMELLQQLFAHYCVVSA 331          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Celegans
Match: lcmt-1 (Leucine carboxyl methyltransferase 1 [Source:UniProtKB/Swiss-Prot;Acc:P46554])

HSP 1 Score: 155.606 bits (392), Expect = 1.543e-41
Identity = 106/316 (33.54%), Postives = 160/316 (50.63%), Query Frame = 2
Query:   92 ISNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFS-----RRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQG-KLDNCTFIELDYFDVAQRK-----AVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVA 1006
            +S+   +Q TND++   K    + GY+ DEF+       S     RR P I+ GY+ R  AIE  +  F+  N+     Q+ SLG GFDT F+RL   G KL    ++E+D+  V  +K       +      L K   S +  VS H D    ++A NY LIG D+ + + LD  +    +S+D+PT+F++ECV+ Y+S   S +LLK I   F +  FV YEQ    D+F + M  +    G  L G++  ++ E Q ER  +AG+      DM + + N +  +E SRI  +E+ DE E       HY V+ A
Sbjct:   25 VSDDYSVQRTNDDATQCKYFATQKGYWKDEFISRFANSSSNVSEARRFPEISMGYWARTAAIEKYVRDFL--NEFDGNAQVVSLGCGFDTLFWRLVSSGAKL--VKYVEVDFSSVTSKKIRHILKPIGPNSVDLKKSFES-DAVVSHHAD----LHAGNYHLIGADLRQANELDQKLATCQLSHDIPTIFIAECVLVYMSADSSTALLKQIVSQFKQPAFVNYEQFRTSDAFTKVMEQNLGDRGIQLHGLEMCESAEKQEERFRNAGFKEVKVMDMNQIFNNFLDQKEVSRIREIEMLDEMELLQQLFAHYCVVSA 331          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Fly
Match: CG3793 (gene:FBgn0028507 transcript:FBtr0080761)

HSP 1 Score: 190.66 bits (483), Expect = 5.791e-54
Identity = 107/303 (35.31%), Postives = 172/303 (56.77%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQG-KLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRG 1015
            +  TND++   K   ++ GY+ D+++ + +    R+AP INRGY+ R K +E  +  F++  K     QI +LG GFDT +FRL     ++ N  FIELD+  V  RK   +++   L   +   +  V L   +   ++  +Y L+G+D+  LD +D+ ++ + V Y LPT+FL+ECV+ YI  +   +LLK+IA+ F    FV YEQ+  +D FG  M ++ +  G SL G+++  + + Q  R   +GW  A +WDM + Y +I S+ E+ RIE LE+ DE E  L    HY ++VA  G
Sbjct:   23 VIATNDDASDCKRCAVRLGYWKDDYIGYFVRNQERKAPEINRGYFARVKGVEMCVEKFLK--KTSGNCQIINLGCGFDTLYFRLRDTAHQVKN--FIELDFPTVTARKCYTIKRNKALLARIHDEDGEVRLSPTD---LHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKWIAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWDMVQVYESI-SAAERQRIERLEMLDEGELLLQLFQHYCLVVAWLG 317          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Fly
Match: CG3793 (gene:FBgn0028507 transcript:FBtr0305560)

HSP 1 Score: 190.66 bits (483), Expect = 6.385e-54
Identity = 107/303 (35.31%), Postives = 172/303 (56.77%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQG-KLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRG 1015
            +  TND++   K   ++ GY+ D+++ + +    R+AP INRGY+ R K +E  +  F++  K     QI +LG GFDT +FRL     ++ N  FIELD+  V  RK   +++   L   +   +  V L   +   ++  +Y L+G+D+  LD +D+ ++ + V Y LPT+FL+ECV+ YI  +   +LLK+IA+ F    FV YEQ+  +D FG  M ++ +  G SL G+++  + + Q  R   +GW  A +WDM + Y +I S+ E+ RIE LE+ DE E  L    HY ++VA  G
Sbjct:   23 VIATNDDASDCKRCAVRLGYWKDDYIGYFVRNQERKAPEINRGYFARVKGVEMCVEKFLK--KTSGNCQIINLGCGFDTLYFRLRDTAHQVKN--FIELDFPTVTARKCYTIKRNKALLARIHDEDGEVRLSPTD---LHGPSYHLMGVDLRNLDEVDSKLQQAEVDYSLPTIFLAECVLVYIEAQNCRNLLKWIAQKFQAAVFVNYEQVNMNDRFGDVMLNNLRGRGCSLAGVESCLSLDTQRNRFKDSGWTGARAWDMVQVYESI-SAAERQRIERLEMLDEGELLLQLFQHYCLVVAWLG 317          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Zebrafish
Match: lcmt2 (leucine carboxyl methyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-110714-2])

HSP 1 Score: 278.1 bits (710), Expect = 2.302e-82
Identity = 136/305 (44.59%), Postives = 199/305 (65.25%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKD-NYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            +QGTND+S++SK S    GYF+D+FL   + K SRRAPLINRGYY+R KA++H +  F+   K     QI SLGAGFD+ FFRL  +G L   T  E+D+ +VA+RKA L+   + L   L  P+    L+K  N + I++ +Y LIG D+ K   ++A + A+G+ +D PTL LSE V+TY+ T+ S +++ + A+   ++ FV+YEQI+PDD FGR M SHF +L S +  +Q Y     Q +R +  GW+     DM +FY++++  +E+ RIE+LE FDE+EEW  KC+HY +L A +GSV
Sbjct:   15 VQGTNDSSVVSKVSAAAQGYFHDDFLKHFVCKMSRRAPLINRGYYVRWKAVDHCVKQFLHATKSCSRRQILSLGAGFDSLFFRLRAEGALGGVTVFEVDFPEVARRKAALINSNACLKDLL--PDWETVLNKQTNAVFISSGHYNLIGADVRKEQEVEASLSAAGLQWDNPTLILSEVVLTYMETQWSDAVIGWAARLLPQSMFVMYEQIHPDDPFGRVMQSHFLKLNSKIHSLQQYPDNVAQTQRFIQEGWEKCHCLDMNQFYFDLLPEDERQRIENLEPFDEFEEWHQKCSHYFILTASKGSV 317          

HSP 2 Score: 77.0258 bits (188), Expect = 4.717e-14
Identity = 78/337 (23.15%), Postives = 129/337 (38.28%), Query Frame = 2
Query: 1415 SLCGSMTRISGNCFIIFGGRSSPLKPN--------DLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXXXXXCSGSVVSIGTD-----SFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSC-GVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAF-SSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            SL  ++T + G   ++FGGRSSPL P+        DLA  +QL +                                              V     P  RWRH +     +DK +L ++GGRS     L D +        W ++            +VV  G +     S C         G              L P+ + + W  +      +       PR+SH++H++            +  VGGV  +     GV+++++    N+  C+++ +DT S    +M+H+  S     +  ++ ++GGGGNCFSFGT LN +  ++DL  I
Sbjct:  409 SLYQTLTSVPGGGVVLFGGRSSPLSPSGSVVLVTADLADEVQLSFTNI-------------------------------------------VCTGTGPKPRWRHTSTLICYNDKTFLFVFGGRSEKDPILGDAHFLCLEDKHWTEI------------TVVGAGPEARHSHSACPYGGGLVIFGGLGEGGKPLGDALYLRPTSSGFCWEMKDLHPPPV-------PRYSHSAHVINEK---------LVVVGGVWLQADGVPGVSIVNL----NTGSCVEIQLDTLSVPWPLMLHSFCSELLDCEGSELVLIGGGGNCFSFGTHLNLHPVTVDLKPI 670          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Zebrafish
Match: lcmt2 (leucine carboxyl methyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-110714-2])

HSP 1 Score: 257.299 bits (656), Expect = 1.186e-74
Identity = 128/292 (43.84%), Postives = 189/292 (64.73%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKD-NYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKC 982
            +QGTND+S++SK S    GYF+D+FL   + K SRRAPLINRGYY+R KAI+H +  F+   K     QI SLGAGFD+ FFRL  +G L   T  E+D+ +VA+RKA L+   + L   L  P+    L+K  N + I++ +Y LIG+D+ K   ++A + A+G+ +D PTL LSE V+TY+ T+ S +++ + A+   ++ F++YEQI PDD FGR M SHF +L S +  +Q Y     Q +R +  GW+     DM +FY++++S +E+ RIE+LE FDE+E+   KC
Sbjct:   15 VQGTNDSSVVSKVSAAAQGYFHDDFLKHFVCKMSRRAPLINRGYYVRWKAIDHCVKQFLHATKSCSRRQILSLGAGFDSLFFRLRAEGALGGVTVFEVDFPEVARRKAALINSNACLKDLL--PDWETVLNKQTNAVFISSGHYNLIGVDVRKEQEVEASLSAAGLQWDNPTLILSEVVLTYMETQWSDAVIGWAARLLPQSMFMMYEQIRPDDPFGRVMQSHFLKLNSKIHSLQQYPDTVAQTQRFIQEGWEKCHCMDMNQFYFDLLSEDERERIENLEPFDEFEKQQQKC 304          

HSP 2 Score: 78.5666 bits (192), Expect = 1.843e-14
Identity = 78/336 (23.21%), Postives = 130/336 (38.69%), Query Frame = 2
Query: 1415 SLCGSMTRISGNCFIIFGGRSSPLKPN--------DLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXXXXXCSGSVVSIGTD-----SFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAF-SSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            SL  ++T + G   ++FGGRSSPL+P+        DLA  +QL +                                              V     P  RWRH +     +DK +L ++GGRS     L D +        W ++            +VV  G +     S C         G              L P+ + + W  +      +       PR+SH++H++      N   V +  V   +   P  GV+++++    N+  C+++ +DT S    +M+H+  S     +  ++ ++GGGGNCFSFGT LN +  ++DL  I
Sbjct:  403 SLYQTLTSVPGGGVVLFGGRSSPLRPSGSVVLVTADLADEVQLSFTNI-------------------------------------------VCTGTGPKPRWRHTSTLICYNDKTFLFVFGGRSEKDPILGDAHFLCLEDKHWTEI------------TVVGAGPEARHSHSACPYGGGLVIFGGLGEGGKPLGDALYLRPTSSGFCWEMKDLHPPPV-------PRYSHSAHVI------NEKLVVVGGVWLQADGVP--GVSIVNL----NTGSCVEIQLDTLSVPWPLMLHSFCSELLDCEGSELVLIGGGGNCFSFGTHLNLHPVTVDLKPI 664          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Zebrafish
Match: lcmt1 (leucine carboxyl methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040912-75])

HSP 1 Score: 155.606 bits (392), Expect = 1.648e-41
Identity = 95/305 (31.15%), Postives = 167/305 (54.75%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKF-SRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            ++ T D++ + K      GY+ D ++ + + +   R+AP INRGYY R K +  +L  F++  K     Q+ +LGAG DT+F+RL  +  +    F E+D+  +  RK   ++ +  L K L       SL  D +  +++  Y +IG D+  +  L+  ++   ++ +LPTLFLSECV+ Y+S ++S+ L+ +IA++F    F+ YEQ+  +D FG  M  + ++   +L G+   ++ + Q ER L +GW+S  + DM    Y+++  E+ +RIE LE  DE E       HY +  A +  +
Sbjct:   17 VRATCDDASICKRFATSKGYWTDLYVQYFVRQIGERKAPEINRGYYGRVKGMNLLLDDFLK--KTQCDCQVVNLGAGLDTTFWRLKDENIMPK-KFFEVDFPMIVARKIHNIKTKPPLSKPLIETHSTDSLLLDGH-SLDSDRYCIIGADLRDIPTLEDKLKKFQINPELPTLFLSECVLVYMSPEQSSRLVHWIAETFPTAMFINYEQVNMNDRFGHIMIENLQRRQCNLAGVDLCQSLDSQKERFLSSGWESVNALDMMTV-YSMLPQEDVARIERLEFLDEKELLQQLLQHYCICWAVKDKL 316          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Zebrafish
Match: lcmt1 (leucine carboxyl methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040912-75])

HSP 1 Score: 154.451 bits (389), Expect = 5.028e-41
Identity = 94/305 (30.82%), Postives = 167/305 (54.75%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKF-SRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            ++ T D++ + K      GY+ D ++ + + +   R+AP INRGYY R K +  +L  F++  K     Q+ +LGAG DT+F+RL  +  +    F E+D+  +  RK   ++ +  L K L       SL  D +  +++  Y +IG D+  +  L+  ++   ++ +LPTLFLSECV+ Y+S ++S+ L+ +IA++F    F+ YEQ+  +D FG  M  + ++   +L G+   ++ + Q +R L +GW+S  + DM    Y+++  E+ +RIE LE  DE E       HY +  A +  +
Sbjct:   17 VRATCDDASICKRFATSKGYWTDLYVQYFVRQIGERKAPEINRGYYGRVKGMNLLLDDFLK--KTQCDCQVVNLGAGLDTTFWRLKDENIMPK-KFFEVDFPMIVARKIHNIKTKPPLSKPLIETHSTDSLLLDGH-SLDSDRYCIIGADLRDIPTLEDKLKKFQINPELPTLFLSECVLVYMSPEQSSRLVHWIAETFPTAMFINYEQVNMNDRFGHIMIENLQRRQCNLAGVDLCQSLDSQKDRFLSSGWESVNALDMMTV-YSMLPQEDVARIERLEFLDEKELLQQLLQHYCICWAVKDKL 316          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Zebrafish
Match: lcmt2 (leucine carboxyl methyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-110714-2])

HSP 1 Score: 124.79 bits (312), Expect = 1.199e-32
Identity = 59/117 (50.43%), Postives = 79/117 (67.52%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKL 460
            +QGTND+S++SK S    GYF+D+FL   + K SRRAPLINRGYY+R KA++H +  F+   K     QI SLGAGFD+ FFRL  +G L   T  E+D+ +VA+RKA L+   + L
Sbjct:   15 VQGTNDSSVVSKVSAAAQGYFHDDFLKHFVCKMSRRAPLINRGYYVRWKAVDHCVKQFLHATKSCSRRQILSLGAGFDSLFFRLRAEGALGGVTVFEVDFPEVARRKAALINSNACL 131          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Xenopus
Match: slco1b3 (solute carrier organic anion transporter family member 1B3 [Source:Xenbase;Acc:XB-GENE-5943217])

HSP 1 Score: 233.417 bits (594), Expect = 1.477e-67
Identity = 125/309 (40.45%), Postives = 184/309 (59.55%), Query Frame = 2
Query:  107 RIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRP 1033
            R+Q TND S LSK S    GYF DE+    + +  RR+PLI+RGY +R++A+ H +  FI + +  D  Q+ SLG GFD+ FFRL  Q +   C + E+D+  V +RK +L++Q   L   L S    V+   +  +V+ +  YKL+G+D+T++  LDA +  +G+S+D PTL L E  + Y+   +S +L+ + A+ F ++ FVLYEQ  P D FGR M SHF  L S L  +  +   + Q +R LH GW +  + DM EF  + V   E  RI +LE FDE+EE  LKC+HY +LVA +G +   P
Sbjct:    6 RVQSTNDCSTLSKVSAASLGYFEDEYQKNFVNRNCRRSPLIHRGYCVRSQAVTHCINEFIRDTQSCDHRQVVSLGCGFDSLFFRLRMQSESPLCVW-EVDFPSVVKRKCLLIEQSGDLRDLLGSY---VTPDDNGPLVLLSQGYKLLGVDLTEVSSLDAALNLAGLSWDCPTLVLGEVALCYMDPARSTALIGWAAERFRDSRFVLYEQSCPSDPFGRVMTSHFASLNSPLLSLSEFPHIQDQEQRFLHKGWKTCRALDMNEFCASCVPLPEVQRIHNLEPFDEFEELHLKCSHYFILVASQGFLAEHP 310          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Xenopus
Match: slco1b3 (solute carrier organic anion transporter family member 1B3 [Source:Xenbase;Acc:XB-GENE-5943217])

HSP 1 Score: 233.417 bits (594), Expect = 1.477e-67
Identity = 125/309 (40.45%), Postives = 184/309 (59.55%), Query Frame = 2
Query:  107 RIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRP 1033
            R+Q TND S LSK S    GYF DE+    + +  RR+PLI+RGY +R++A+ H +  FI + +  D  Q+ SLG GFD+ FFRL  Q +   C + E+D+  V +RK +L++Q   L   L S    V+   +  +V+ +  YKL+G+D+T++  LDA +  +G+S+D PTL L E  + Y+   +S +L+ + A+ F ++ FVLYEQ  P D FGR M SHF  L S L  +  +   + Q +R LH GW +  + DM EF  + V   E  RI +LE FDE+EE  LKC+HY +LVA +G +   P
Sbjct:    6 RVQSTNDCSTLSKVSAASLGYFEDEYQKNFVNRNCRRSPLIHRGYCVRSQAVTHCINEFIRDTQSCDHRQVVSLGCGFDSLFFRLRMQSESPLCVW-EVDFPSVVKRKCLLIEQSGDLRDLLGSY---VTPDDNGPLVLLSQGYKLLGVDLTEVSSLDAALNLAGLSWDCPTLVLGEVALCYMDPARSTALIGWAAERFRDSRFVLYEQSCPSDPFGRVMTSHFASLNSPLLSLSEFPHIQDQEQRFLHKGWKTCRALDMNEFCASCVPLPEVQRIHNLEPFDEFEELHLKCSHYFILVASQGFLAEHP 310          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Xenopus
Match: slco1b3 (solute carrier organic anion transporter family member 1B3 [Source:Xenbase;Acc:XB-GENE-5943217])

HSP 1 Score: 234.187 bits (596), Expect = 2.297e-65
Identity = 124/308 (40.26%), Postives = 184/308 (59.74%), Query Frame = 2
Query:   92 ISNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRG 1015
            +S  +++Q TND S LSK S    GYF DE+    + +  RR+PLI+RGY +R++A+ H +  FI + +  D  Q+ SLG GFD+ FFRL  Q +   C + E+D+  V +RK +L++Q   L   L S   P     +  +V+ +  YKL+G+D+T++  LDA +  +G+S+D PTL L E  + Y+   +S +L+ + A+ F ++ FVLYEQ  P D FGR M SHF  L S L  +  +   + Q +R LH GW +  + DM EF  + V   E  RI +LE FDE+EE  LKC+HY +LVA +G
Sbjct:  304 LSVSLQVQSTNDCSTLSKVSAASLGYFEDEYQKNFVNRNCRRSPLIHRGYCVRSQAVTHCINEFIRDTQSCDHRQVVSLGCGFDSLFFRLRMQSESPLCVW-EVDFPSVVKRKCLLIEQSGDLRDLLGSYVTP---DDNGPLVLLSQGYKLLGVDLTEVSSLDAALNLAGLSWDCPTLVLGEVALCYMDPARSTALIGWAAERFRDSRFVLYEQSCPSDPFGRVMTSHFASLNSPLLSLSEFPHIQDQEQRFLHKGWKTCRALDMNEFCASCVPLPEVQRIHNLEPFDEFEELHLKCSHYFILVASQG 607          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Xenopus
Match: lcmt1 (leucine carboxyl methyltransferase 1 [Source:NCBI gene;Acc:548787])

HSP 1 Score: 158.688 bits (400), Expect = 2.407e-42
Identity = 95/305 (31.15%), Postives = 167/305 (54.75%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKF-SRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            ++GT D++ + K   +  GY+ D ++ + + +   R+AP INRGYY R + +  +L  F+   +     QI +LGAG DT+F+RL  +  L    + E+D+  +  RK   ++ +  L K +       SL  D +  ++++ Y +IG D+     ++  ++   +   LPTL ++ECV+ Y++ ++SASLL++   +F+   F+ YEQ+   D FG+ M  + ++   +L G+   ++ E Q ERLL  GW+SA +W+M + Y N+   E+  RIE LE  DE E       HY +  A + S+
Sbjct:   18 VRGTCDDASICKRFAVSAGYWKDPYIQYFVRQAKERKAPEINRGYYARVQGVHLLLKAFLRKTEC--NCQIINLGAGLDTTFWRLKDENLLPK-KYFEVDFPAIVARKLYNIKSKPPLSKPIMETHSGESLLLDAH-SLDSARYSIIGADLRNPKDMEEKLKKMSLDPQLPTLLVTECVLVYMTPEQSASLLQWATNTFTTAMFINYEQVNMMDRFGQIMVENLQRRQCNLAGVDACQSLESQTERLLSTGWESADAWNMMKVYSNL-PQEDVMRIEKLEFLDEKELLEQLLLHYCISWATKDSL 317          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Xenopus
Match: lcmt1 (leucine carboxyl methyltransferase 1 [Source:NCBI gene;Acc:548787])

HSP 1 Score: 158.303 bits (399), Expect = 3.388e-42
Identity = 95/305 (31.15%), Postives = 167/305 (54.75%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKF-SRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            ++GT D++ + K   +  GY+ D ++ + + +   R+AP INRGYY R + +  +L  F+   +     QI +LGAG DT+F+RL  +  L    + E+D+  +  RK   ++ +  L K +       SL  D +  ++++ Y +IG D+     ++  ++   +   LPTL ++ECV+ Y++ ++SASLL++   +F+   F+ YEQ+   D FG+ M  + ++   +L G+   ++ E Q ERLL  GW+SA +W+M + Y N+   E+  RIE LE  DE E       HY +  A + S+
Sbjct:   18 VRGTCDDASICKRFAVSAGYWKDPYIQYFVRQAKERKAPEINRGYYARVQGVHLLLKAFLRKTEC--NCQIINLGAGLDTTFWRLKDENLLPK-KYFEVDFPAIVARKLYNIKSKPPLSKPIMETHSGESLLLDAH-SLDSARYSIIGADLRNPKDMEEKLKKMSLDPQLPTLLVTECVLVYMTPEQSASLLQWATNTFTTAMFINYEQVNMMDRFGQIMVENLQRRQCNLAGVDACQSLESQTERLLSTGWESADAWNMMKVYSNL-PQEDVMRIEKLEFLDEKELLEQLLLHYCISWATKDSL 317          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Mouse
Match: Lcmt2 (leucine carboxyl methyltransferase 2 [Source:MGI Symbol;Acc:MGI:1353659])

HSP 1 Score: 238.81 bits (608), Expect = 8.086e-68
Identity = 114/308 (37.01%), Postives = 186/308 (60.39%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDA---IQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKD-NYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            +Q TND+S LSK S+  +GY  D F   ++    RR PLI+RGYY+RA+A+ H +  F+E    + +    QI SLG+G D+ +FRL   G L      E+D+ DV++ KA  +++  +L     +   P  +    + +   +++Y+++G D+ +L  L   +  +G+    PTL L+E V+TY+    + +L+ + A+ F +  FV+YEQ+ P D+FG+ M  HF++L S L G++ +   + Q +R L AGW + ++ D+ EFY  ++S+EE+ R+E LE FDEYEEW LKC+HY +L A RG +
Sbjct:   13 VQSTNDSSSLSKRSLAAHGYVRDPFAALLVPGPVRRTPLIHRGYYVRARAVRHCVRAFLELTSALPSRTRAQILSLGSGSDSLYFRLKAAGLLARAAVWEVDFPDVSRLKAERIEETPEL----RAQTGPFKIGDSASSLCFESADYRILGADLRELQRLGEALDGAGLDATSPTLLLAEAVLTYLEPSSATALIAWAAQRFPDALFVIYEQMQPGDAFGQIMLQHFQRLHSPLHGLELFPVVKAQRQRFLQAGWTACSALDLNEFYRRLLSAEERQRVETLEPFDEYEEWHLKCSHYFILAASRGDI 316          

HSP 2 Score: 75.8702 bits (185), Expect = 1.312e-13
Identity = 88/321 (27.41%), Postives = 129/321 (40.19%), Query Frame = 2
Query: 1427 SMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXXXXXCSGSVVSIGTDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVP--SGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGV-SHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            +MTR+S    ++ GGR SP+ P   A +L L+ + D  +   N     A                             A+ E    S  WRH     +  ++ YL +YGGRS     LSD         +W ++  Q         S     + S CS        G          S   L P  SG +W           I    S  PR+SHT+H+             +  VGGV  H +   GVT+I +    +S    +  +DT S    +M+HNH SA   + +Q+ ++GGGGNCFSFGT  N +  ++DLS++
Sbjct:  421 TMTRLSDTRVLVLGGRLSPVSPASGALQLDLYKSKDNCSEGQNVTVTKA-----------------------------ALEEGSVLSC-WRHSTTEVYYQNQRYLFVYGGRSVAEPVLSDCRFLHVETMAWVRIPVQ-------GASPEGRHSHSACSWQGGALIAGGLGASEELLSSVLFLKPVSSGFLWE---------SIDIQPSITPRYSHTAHVF---------NGKLLLVGGVWIHSSSVPGVTVICLTTGLSS----EYQIDTASVPWPLMLHNHSSALLPEEQQLLLIGGGGNCFSFGTYFNPHTVALDLSSL 682          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Mouse
Match: Lcmt1 (leucine carboxyl methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1353593])

HSP 1 Score: 175.637 bits (444), Expect = 2.049e-48
Identity = 100/305 (32.79%), Postives = 179/305 (58.69%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKF-SRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYE--EWLLKCNHYMVLVACRG 1015
            ++GT +++ L K   +  GY++D ++  ++ +   R+AP INRGY+ R   +  ++  F+   +     QI +LGAG DT+F++L  +G L N  + E+D+  +  RK + ++ +  L++ +       +L  D+++ +++  Y +IG D+  L  L+  ++   ++  LPTL ++ECV+ Y++ ++SA+LLK+ A SF    F+ YEQ+  DD FG+ M  + ++    L G++T K+ E Q ERLL  GW++A++ +M E Y  +  + E +RIE LE  DE E  E L++  HY +  A RG
Sbjct:   24 VRGTCEDASLCKRFAVSIGYWHDPYIEHLVRQSKERKAPEINRGYFARVHGVSQLIKAFLRKTEC--HCQILNLGAGMDTTFWKLKDEGLLPN-KYFEVDFPMIVTRKLLTIKSKPLLFRPIMELHPEDTLQMDSHM-LDSKRYAIIGADLRDLSELEEKLKKCNMNTQLPTLLITECVLVYMTPEQSANLLKWAASSFETAMFINYEQVNMDDRFGQIMIENLRRRSCDLAGVETCKSLESQKERLLLNGWETASAVNMMELYSGLPRA-EVNRIESLEFLDEMELLEQLMR--HYCLCWATRG 321          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Mouse
Match: Lcmt1 (leucine carboxyl methyltransferase 1 [Source:MGI Symbol;Acc:MGI:1353593])

HSP 1 Score: 174.866 bits (442), Expect = 4.382e-48
Identity = 100/305 (32.79%), Postives = 178/305 (58.36%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKF-SRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYE--EWLLKCNHYMVLVACRG 1015
            ++GT +++ L K   +  GY++D ++  ++ +   R+AP INRGY+ R   +  ++  F+   +     QI +LGAG DT+F++L  +G L N  + E+D+  +  RK + ++ +  L++ +       +L   N++ +++  Y +IG D+  L  L+  ++   ++  LPTL ++ECV+ Y++ ++SA+LLK+ A SF    F+ YEQ+  DD FG+ M  + ++    L G++T K+ E Q ERLL  GW++A++ +M E Y  +  + E +RIE LE  DE E  E L++  HY +  A RG
Sbjct:   24 VRGTCEDASLCKRFAVSIGYWHDPYIEHLVRQSKERKAPEINRGYFARVHGVSQLIKAFLRKTEC--HCQILNLGAGMDTTFWKLKDEGLLPN-KYFEVDFPMIVTRKLLTIKSKPLLFRPIMELHPEDTLQMGNHM-LDSKRYAIIGADLRDLSELEEKLKKCNMNTQLPTLLITECVLVYMTPEQSANLLKWAASSFETAMFINYEQVNMDDRFGQIMIENLRRRSCDLAGVETCKSLESQKERLLLNGWETASAVNMMELYSGLPRA-EVNRIESLEFLDEMELLEQLMR--HYCLCWATRG 321          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Mouse
Match: Lcmt2 (leucine carboxyl methyltransferase 2 [Source:MGI Symbol;Acc:MGI:1353659])

HSP 1 Score: 106.686 bits (265), Expect = 6.956e-24
Identity = 44/96 (45.83%), Postives = 66/96 (68.75%), Query Frame = 2
Query:  734 IYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            + P D+FG+ M  HF++L S L G++ +   + Q +R L AGW + ++ D+ EFY  ++S+EE+ R+E LE FDEYEEW LKC+HY +L A RG +
Sbjct:    1 MQPGDAFGQIMLQHFQRLHSPLHGLELFPVVKAQRQRFLQAGWTACSALDLNEFYRRLLSAEERQRVETLEPFDEYEEWHLKCSHYFILAASRGDI 96          
BLAST of Leucine carboxyl methyltransferase 2 vs. UniProt/SwissProt
Match: sp|O60294|TYW4_HUMAN (tRNA wybutosine-synthesizing protein 4 OS=Homo sapiens OX=9606 GN=LCMT2 PE=1 SV=3)

HSP 1 Score: 259.225 bits (661), Expect = 2.162e-74
Identity = 223/773 (28.85%), Postives = 349/773 (45.15%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAI---QIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSP---EHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRPGPILIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTGNRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRHIEPARSQLLA--------NSLCGSMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXXXXXCSGSVVSIG-TDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGV-SHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            +Q TND+S LSK S+   GY  D F   ++   +RRAPLI+RGYY+RA+A+ H +  F+E      A    QI SLGAGFD+ +FRL   G+L      E+D+ DVA+RKA  + +  +L   L+ P     P S      +   +++Y ++G+D+ +L  ++  + A+G+    PTL L+E V+TY+  + +A+L+ + A+ F    FV+YEQ+ P D+FG+FM  HF+QL S L G++ +   E Q  R L AGW +  + DM EFY+  + +EE+ R+E++E FDE+EEW LKC HY +L A RG         L+            A  S                    + ++    + + P  K  G  + ++  D+I            L + G+G+      HCR++   +L    +     E   SQ+ +          L  +MTR+S +  ++ GGR SP+ P      LQLH+    +    +                                   A  + D     WRH        ++ YL +YGGRS     LSD +       +W              G V     + S C+        G          S   L P       CG    W  +       PR+SHT+H++            +  VGG+  H +   GVT+I++    +S    +  +DT      +M+HNH S    + +Q+ ++GGGGNCFSFGT  N +  ++DLS++
Sbjct:   13 VQNTNDSSALSKRSLAARGYVQDPFAALLVPGAARRAPLIHRGYYVRARAVRHCVRAFLEQIGAPQAALRAQILSLGAGFDSLYFRLKTAGRLARAAVWEVDFPDVARRKAERIGETPELC-ALTGPFERGEPASA-----LCFESADYCILGLDLRQLQRVEEALGAAGLDAASPTLLLAEAVLTYLEPESAAALIAWAAQRFPNALFVVYEQMRPQDAFGQFMLQHFRQLNSPLHGLERFPDVEAQRRRFLQAGWTACGAVDMNEFYHCFLPAEERRRVENIEPFDEFEEWHLKCAHYFILAASRGDTL---SHTLVFPSSEAFPRVNPASPSGV------------------FPASVVSSEGQVPNLKRYGHASVFLSPDVI------------LSAGGFGEQ--EGRHCRVSQFHLLSRDCDS----EWKGSQIGSCGTGVQWDGRLYHTMTRLSESRVLVLGGRLSPVSPA--LGVLQLHFFKSEDNNTEDLKVTITK----------------------------AGRKDDSTLCCWRHSTTEVSCQNQEYLFVYGGRSVVEPVLSDWHFLHVGTMAW--------VRIPVEGEVPEARHSHSACTWQGGALIAGGLGASEEPLNSVLFLRPIS-----CGF--LWESVDIQPPITPRYSHTAHVL---------NGKLLLVGGIWIHSSSFPGVTVINLTTGLSS----EYQIDTTYVPWPLMLHNHTSILLPEEQQLLLLGGGGNCFSFGTYFNPHTVTLDLSSL 682          
BLAST of Leucine carboxyl methyltransferase 2 vs. UniProt/SwissProt
Match: sp|Q5XIA3|TYW4_RAT (tRNA wybutosine-synthesizing protein 4 OS=Rattus norvegicus OX=10116 GN=Lcmt2 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 9.719e-69
Identity = 114/307 (37.13%), Postives = 189/307 (61.56%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDA---IQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            +Q TND+S LSK S+   GY +D F P ++    RR PLI+RGYY+RA+A+ H +  F++    + +    QI SLG+G D+ +FRL   G L      E+D+ DV++ KA  +++  +L  C  +    +     + +   +S+Y+++G D+ +L  L   + ++G+    PTL L+E V+TY+   ++A+L+ ++A+ F    FV+YEQ+ P D+FG+ M  HF++L S L G++ +   E Q +R L AGW + ++ D+ EFY  ++ ++E+ R+E LE FDE+EEW LKC+HY +L A RG +
Sbjct:   13 VQSTNDSSSLSKRSLAAQGYVSDAFAPLLVPGIVRRTPLIHRGYYVRARAVRHCVRAFLDLTGAIRSPTRAQILSLGSGSDSLYFRLKAAGLLTRTAVWEVDFPDVSRLKAKRIEETPEL--CAQTGPFKIG-DSASTLCFESSDYRILGADLRELQRLGEALDSAGLDATSPTLILAEAVLTYLEPSRAAALIAWVAQRFPNALFVIYEQMKPGDAFGQIMLQHFRRLNSPLHGLELFPDVEAQRQRFLQAGWTTCSALDLNEFYRRLIPADERRRVETLEPFDEFEEWHLKCSHYFILAASRGDI 316          

HSP 2 Score: 75.0998 bits (183), Expect = 1.424e-12
Identity = 87/321 (27.10%), Postives = 127/321 (39.56%), Query Frame = 2
Query: 1427 SMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXXXXXCSGSVVSIGTDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVP--SGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGV-SHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            +MTR+S    ++ GGR SP+ P   A +L ++ + D                                  Q       A+ E    S  WRH     +  ++ YL +YGGRS     LSD         +W ++  Q         S     + S CS        G          S   L P  SG +W           I    S  PR+SHT+H+             +  VGGV  H +   GVT+IS+    +S    +  +DT S    +M+HNH SA   + +Q+ ++GGGGNCFSFGT  N +   +DLS++
Sbjct:  421 TMTRLSDTRVLVLGGRLSPVNPASGALQLDIYKSEDNCPEG-----------------------------QNVVVTKAALEEGSMLSC-WRHSTTEVYYQNQRYLFVYGGRSVTDPVLSDCRFLHVETMAWVRIPVQ-------GSSPEGRHSHSACSWQGGALIAGGLGASEEPLSSVFFLRPVSSGFLWE---------SIHIQPSITPRYSHTAHVF---------NGKLLLVGGVWIHSSSVPGVTVISLTTGLSS----EYQIDTASVPWPLMLHNHSSALLPEEQQLLLIGGGGNCFSFGTYFNPHTVGLDLSSL 682          
BLAST of Leucine carboxyl methyltransferase 2 vs. UniProt/SwissProt
Match: sp|Q8BYR1|TYW4_MOUSE (tRNA wybutosine-synthesizing protein 4 OS=Mus musculus OX=10090 GN=Lcmt2 PE=2 SV=4)

HSP 1 Score: 238.81 bits (608), Expect = 5.656e-67
Identity = 114/308 (37.01%), Postives = 186/308 (60.39%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDA---IQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKD-NYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            +Q TND+S LSK S+  +GY  D F   ++    RR PLI+RGYY+RA+A+ H +  F+E    + +    QI SLG+G D+ +FRL   G L      E+D+ DV++ KA  +++  +L     +   P  +    + +   +++Y+++G D+ +L  L   +  +G+    PTL L+E V+TY+    + +L+ + A+ F +  FV+YEQ+ P D+FG+ M  HF++L S L G++ +   + Q +R L AGW + ++ D+ EFY  ++S+EE+ R+E LE FDEYEEW LKC+HY +L A RG +
Sbjct:   13 VQSTNDSSSLSKRSLAAHGYVRDPFAALLVPGPVRRTPLIHRGYYVRARAVRHCVRAFLELTSALPSRTRAQILSLGSGSDSLYFRLKAAGLLARAAVWEVDFPDVSRLKAERIEETPEL----RAQTGPFKIGDSASSLCFESADYRILGADLRELQRLGEALDGAGLDATSPTLLLAEAVLTYLEPSSATALIAWAAQRFPDALFVIYEQMQPGDAFGQIMLQHFQRLHSPLHGLELFPVVKAQRQRFLQAGWTACSALDLNEFYRRLLSAEERQRVETLEPFDEYEEWHLKCSHYFILAASRGDI 316          

HSP 2 Score: 75.8702 bits (185), Expect = 9.178e-13
Identity = 88/321 (27.41%), Postives = 129/321 (40.19%), Query Frame = 2
Query: 1427 SMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXXXXXCSGSVVSIGTDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVP--SGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGV-SHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            +MTR+S    ++ GGR SP+ P   A +L L+ + D  +   N     A                             A+ E    S  WRH     +  ++ YL +YGGRS     LSD         +W ++  Q         S     + S CS        G          S   L P  SG +W           I    S  PR+SHT+H+             +  VGGV  H +   GVT+I +    +S    +  +DT S    +M+HNH SA   + +Q+ ++GGGGNCFSFGT  N +  ++DLS++
Sbjct:  421 TMTRLSDTRVLVLGGRLSPVSPASGALQLDLYKSKDNCSEGQNVTVTKA-----------------------------ALEEGSVLSC-WRHSTTEVYYQNQRYLFVYGGRSVAEPVLSDCRFLHVETMAWVRIPVQ-------GASPEGRHSHSACSWQGGALIAGGLGASEELLSSVLFLKPVSSGFLWE---------SIDIQPSITPRYSHTAHVF---------NGKLLLVGGVWIHSSSVPGVTVICLTTGLSS----EYQIDTASVPWPLMLHNHSSALLPEEQQLLLIGGGGNCFSFGTYFNPHTVALDLSSL 682          
BLAST of Leucine carboxyl methyltransferase 2 vs. UniProt/SwissProt
Match: sp|Q8VY08|LCMT1_ARATH (Leucine carboxyl methyltransferase 1 homolog OS=Arabidopsis thaliana OX=3702 GN=LCMT1 PE=1 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 6.383e-57
Identity = 110/309 (35.60%), Postives = 175/309 (56.63%), Query Frame = 2
Query:   95 SNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            SN   +Q TND++  SK S +K GY  D+++   + +  RR+P+INRGY+ R  A   ++  F+ +       QI SLGAGFDT++F+L  +G   N  ++ELD+ +V  +KA ++Q  S+L   L +     S+  D   V+ + +YKL+ +D+  +  L   I  + +   LPT  ++ECV+ Y+    S +++ + +K+FS   F LYEQI+PDD+FG  M  + +  G +L  I    T   +    L  GW  A +WDM + Y + V ++EK RIE LE+FDE+EEW +   HY V  A   ++
Sbjct:    6 SNRAAVQATNDDASASKLSCVKKGYMKDDYVHLFVKRPVRRSPIINRGYFSRWAAFRKLMSQFLLSGTSSKK-QILSLGAGFDTTYFQLLDEGNGPNL-YVELDFKEVTSKKAAVIQNSSQLRDKLGAN---ASISIDEGQVL-SDHYKLLPVDLRDIPKLRDVISFADMDLSLPTFIIAECVLIYLDPDSSRAIVNWSSKTFSTAVFFLYEQIHPDDAFGHQMIRNLESRGCALLSIDASPTLLAKERLFLDNGWQRAVAWDMLKVYGSFVDTQEKRRIERLELFDEFEEWHMMQEHYCVTYAVNDAM 308          
BLAST of Leucine carboxyl methyltransferase 2 vs. UniProt/SwissProt
Match: sp|Q6P4Z6|LCMT1_RAT (Leucine carboxyl methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Lcmt1 PE=2 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 2.245e-46
Identity = 99/305 (32.46%), Postives = 179/305 (58.69%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKF-SRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYE--EWLLKCNHYMVLVACRG 1015
            ++GT +++ L K   +  G+++D ++  ++ +   R+AP INRGY+ R   +  ++  F+   +     QI +LGAG DT+F++L  +G L N  + E+D+  +  RK   ++ +  L++ +       +L  D+++ +++  Y +IG D+  L  L+  ++   ++  LPTL ++ECV+ Y++ ++SA+LLK+ A+SF    F+ YEQ+  DD FG+ M  + ++    L G++T K+ E Q ERLL  GW++A++ +M E Y  +  + E +RIE LE  DE E  E L++  HY +  A RG
Sbjct:   24 VRGTCEDASLCKRFAVSIGHWHDPYIEHLVRQSKERKAPEINRGYFARVHGVSQLIKAFLRKTEC--RCQILNLGAGMDTTFWKLKDEGLLPN-KYFEVDFPMIVTRKLHTIKNKPLLFRPIMELHPEDTLQIDSHM-LDSKRYAIIGADLRDLSELEEKLKKCNMNTQLPTLLITECVLVYMTPEQSANLLKWAARSFETAMFINYEQVNMDDRFGQIMIENLRRRQCDLAGVETCKSLESQKERLLLNGWETASAVNMMELYSGLPRA-EVNRIESLEFLDEMELLEQLMR--HYCLCWATRG 321          
BLAST of Leucine carboxyl methyltransferase 2 vs. TrEMBL
Match: H2ZX29 (Leucine carboxyl methyltransferase 2 OS=Latimeria chalumnae OX=7897 GN=LCMT2 PE=4 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 1.474e-109
Identity = 247/781 (31.63%), Postives = 377/781 (48.27%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFI-ENNKHMDA---IQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRPGPILIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTGNRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRH----IEPARSQLLANSLCGSMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEA----DKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIF---DFS-----LNSWXXXXXXXXXXXXCSGSVVSIGTDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQ--QWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGV-SHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNID 2383
            +QGTND+SI+SKCSM+K  YF D+FL + + K SRRAPLINRGYYIRAKA++H    F+ +   H      IQI SLGAGFD+S+FRL   G L N    E+D+ DV  RKA L+  E +L + + S    +   +   + ++ ++Y+L+G+D+++L+ LD  +  +G++   PTL LSE V+TY+   +S++++++ ++ F+   FV+YEQI P D FG+ M  HFKQL S+L  +  Y  +E Q +R L  GW+ +T  DM EFY+  +  EE+ R+E LE FDE+EEW LKC+HY +L A +G +                             +             + + S        E   K  G++ +  ++ LI  N        ++ + G+G+   +  H RL  L +   +  +  H    +E    QL    +  SMT IS +  +I GGR SPL P+     L+    +D +                                   CS  ++V E        S RWRH A      D+ YL IYGG S     L+D Y     DFS     +  +           L +G+VV  G         P+                   +P G+I+          W E+ ++ S +PR+SHT+HIV            +  VGGV  H     GVT+I +     + +C+D  ++T      +M+HNH S    + KQ++++GGGGNCFSFGT LN++   + L+++D
Sbjct:   11 VQGTNDSSIVSKCSMVKLDYFKDDFLKYFVKKSSRRAPLINRGYYIRAKAVDHCFKQFLMQTGGHPQIGIFIQILSLGAGFDSSYFRLKAGGLLKNVIMYEVDFPDVVSRKAALITNEKELAELVGSAGE-IRPAESGIVCLSGTDYRLLGVDLSELEKLDEGLIGAGLNLTCPTLILSEVVLTYMDNARSSAVIQWASEHFASAVFVIYEQIRPADPFGQVMQKHFKQLNSTLHALVEYPDREAQKKRFLDLGWEESTCVDMNEFYFGFIPKEERKRLETLEPFDEFEEWHLKCSHYFILTAFKGEL--------------------------KICSMLNAPTGSLLTKSVPFSSKTISASPCEVDSKVSGLRRYGHRSCLIKSN-------VVITTGGFGEQ--AGQHGRLKDLQLSVKSGAIWEHGPVTVEDTE-QLWDARIFHSMTPISDDQCVIVGGRLSPLNPSTNILCLKCRQKSDFD----------------------------------SCSVNVSVQEVCVDMKSLSPRWRHSATGMKYKDQSYLFIYGGCSPTDKVLNDWYFLNLEDFSRTEILVEGFVPEGRHSHSACLWNGAVVIAG------GLGPEE------------------MPLGSIYLLIPTTTGFTWQEVEASPSVIPRYSHTAHIVDDK---------LLLVGGVLIHSDTIPGVTVIDL----KTGQCVDYQINTAHLEWPLMLHNHSSVLMEEEKQLFVIGGGGNCFSFGTHLNQHPVLLSLASVD 683          
BLAST of Leucine carboxyl methyltransferase 2 vs. TrEMBL
Match: H2ZX30 (Leucine carboxyl methyltransferase 2 OS=Latimeria chalumnae OX=7897 GN=LCMT2 PE=4 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 1.665e-109
Identity = 245/784 (31.25%), Postives = 375/784 (47.83%), Query Frame = 2
Query:   86 KEISNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRPGPILIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTGNRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRH----IEPARSQLLANSLCGSMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEA----DKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIF---DFS-----LNSWXXXXXXXXXXXXCSGSVVSIGTDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQ--QWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGV-SHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            K +     +QGTND+SI+SKCSM+K  YF D+FL + + K SRRAPLINRGYYIRAKA++H    F+         QI SLGAGFD+S+FRL   G L N    E+D+ DV  RKA L+  E +L + + S    +   +   + ++ ++Y+L+G+D+++L+ LD  +  +G++   PTL LSE V+TY+   +S++++++ ++ F+   FV+YEQI P D FG+ M  HFKQL S+L  +  Y  +E Q +R L  GW+ +T  DM EFY+  +  EE+ R+E LE FDE+EEW LKC+HY +L A +G +                             +             + + S        E   K  G++ +  ++ LI  N        ++ + G+G+   +  H RL  L +   +  +  H    +E    QL    +  SMT IS +  +I GGR SPL P+     L+    +D +                                   CS  ++V E        S RWRH A      D+ YL IYGG S     L+D Y     DFS     +  +           L +G+VV  G         P+                   +P G+I+          W E+ ++ S +PR+SHT+HIV            +  VGGV  H     GVT+I +     + +C+D  ++T      +M+HNH S    + KQ++++GGGGNCFSFGT LN++   + L+++
Sbjct:   13 KRVGKDSAVQGTNDSSIVSKCSMVKLDYFKDDFLKYFVKKSSRRAPLINRGYYIRAKAVDHCFKQFLMQTGGHPQRQILSLGAGFDSSYFRLKAGGLLKNVIMYEVDFPDVVSRKAALITNEKELAELVGSAGE-IRPAESGIVCLSGTDYRLLGVDLSELEKLDEGLIGAGLNLTCPTLILSEVVLTYMDNARSSAVIQWASEHFASAVFVIYEQIRPADPFGQVMQKHFKQLNSTLHALVEYPDREAQKKRFLDLGWEESTCVDMNEFYFGFIPKEERKRLETLEPFDEFEEWHLKCSHYFILTAFKGEL--------------------------KICSMLNAPTGSLLTKSVPFSSKTISASPCEVDSKVSGLRRYGHRSCLIKSN-------VVITTGGFGEQ--AGQHGRLKDLQLSVKSGAIWEHGPVTVEDTE-QLWDARIFHSMTPISDDQCVIVGGRLSPLNPSTNILCLKCRQKSDFD----------------------------------SCSVNVSVQEVCVDMKSLSPRWRHSATGMKYKDQSYLFIYGGCSPTDKVLNDWYFLNLEDFSRTEILVEGFVPEGRHSHSACLWNGAVVIAG------GLGPEE------------------MPLGSIYLLIPTTTGFTWQEVEASPSVIPRYSHTAHIVDDK---------LLLVGGVLIHSDTIPGVTVIDL----KTGQCVDYQINTAHLEWPLMLHNHSSVLMEEEKQLFVIGGGGNCFSFGTHLNQHPVLLSLASV 688          
BLAST of Leucine carboxyl methyltransferase 2 vs. TrEMBL
Match: A0A401PCW1 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0008734 PE=4 SV=1)

HSP 1 Score: 311.612 bits (797), Expect = 3.208e-91
Identity = 242/780 (31.03%), Postives = 363/780 (46.54%), Query Frame = 2
Query:   86 KEISNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINR-----GYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEH--PVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVC---WRPGPILIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIQYHSANQQQQTEEPQF-KFGGIKTHYVKADLIAGNGTGNRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMR---HIEPARSQLLANSLCGSMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXXXXXCSGSVVSIGTDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSCG-VTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            K+    + +QGTND+SI+SKCSM+  GYFND FL   + K +RRAPLINR       Y+        L   I  +     +QI SLGAGFD+ +FRL   G+L N    E+D+ +V QRKA L++ + +  + +   +   P  + +   + +++ +YKL+G+D+T++  LD  +  +G++   PTL LSE V+TY+  + S++++ + A  F    FV+YEQI PDD FG+ M  HF QL S+L  +  +  KE Q +R L+ GW+     DM EFY   +  +EK RIE LE FDEYEEW LKC+HY++L A +G +      P P                              ++  LN ++   +  + +TE P   +F    +H     ++   G G+R          GQ      H RL  +S++     V +     +     LL   +  SMT +     IIFGGR+SPLKP  + + L L+                       D +       G ++ + ECS        D P  RWRH A         YL IYGGRS     L+D +  +    SW  +            +  S  + S CS        G          S   L P+     W G    W  I +  SF+PR+SHT+HI+            +  +GGV+ ++ S   VTLI +     + +  D  +D+   +  +M+HNH S    + +Q+ ++GGGGNCFSFGT LN     + L  I
Sbjct:   22 KQTGKDVAVQGTNDSSIVSKCSMVNLGYFNDVFLKGFVNKTTRRAPLINRIILVLNIYVLTANENSPLKCNIAASYAFSFLQILSLGAGFDSLYFRLKASGELKNVVVYEVDFPNVVQRKATLIKNKQEFVELIGCIDEIRPTQMGR---LYLSSMDYKLLGMDLTEIVELDHLLMQTGLNPACPTLILSEVVLTYMKGESSSAVIHWAADRFPSAIFVVYEQIRPDDPFGQVMQRHFTQLNSTLYALTQFPGKEAQRKRFLNEGWEECHCIDMNEFYVGFIPEQEKQRIELLEPFDEYEEWHLKCSHYLILSASKGFLTCLFLHPPP-------------------------DFHFKKIDTLNPLRITVSLCETETENPLLRRFAHCSSHIAPNIILISGGFGSRD---------GQ------HGRLKDVSLMFKNGPVWKCSSFGDQGSIHLLTERMFHSMTALCDKRCIIFGGRTSPLKP--VTSLLCLN----------------------CDMSDGAISSIGLSVKEIECS-------GDVPLPRWRHSATEVIYKGLKYLFIYGGRSPRELVLNDWHFLNLEDYSWADIPVN-------GPTPESRHSHSACSWKGGVLIAGGLGAARIPLASIFHLRPT-----WSGF--IWDRIETVSSFIPRYSHTAHIIGDK---------LLLLGGVTIQSDSIPEVTLIDL----KTGQSFDQCIDSNLVTWPLMLHNHSSVLVKE-RQVLVIGGGGNCFSFGTHLNHQPILLKLPEI 699          
BLAST of Leucine carboxyl methyltransferase 2 vs. TrEMBL
Match: A0A2G8JUX9 (Putative tRNA wybutosine-synthesizing protein 4 OS=Stichopus japonicus OX=307972 GN=BSL78_23597 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 2.599e-84
Identity = 180/475 (37.89%), Postives = 262/475 (55.16%), Query Frame = 2
Query:   98 NVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSP----EHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRPGPILIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTGNRR---QYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRHIEPAR-SQLLANSLCGSMTRISGN--CFIIFGGRSSPLKP 1492
            N   +QGTND+SI+SKC++   GYF+D++L   + + +RRAPLINRGYY+RAKAI+  L  F+++ +   A QI SLGAGFD++FFRL     L    F E+D+ +VA RKA ++Q    L   L  P    ++PV + KD  ++I++S+Y+L+GI++  L  L   +  SG   + PTL LSECV+TY+  ++S +L++F A +FS   F+ YEQIYP DSFGR M +HFK+LGS L+ I+ Y T     ER L  GW SA   DM EFY   +  EE+ RI+ LE FDE+EEW LKCNHY+++ AC+GS                              A   D  R    +   Y    Q  Q  E Q      + ++      +G G  + R     +L   G+G       H RL+ +  +++ T     +EP   S ++   +  ++T ++ N    +IFGGR+SP KP
Sbjct:    9 NETAVQGTNDSSIVSKCAITMQGYFHDDYLRHFVARQTRRAPLINRGYYVRAKAIDGALRHFLKSFQ-GQANQIVSLGAGFDSAFFRLESARLLSETCFYEIDFAEVACRKAAIIQSNDILCALLKEPVFHHKNPV-VQKDGGVIISSSSYQLLGINLNDLSSLHRFLLHSGCDLNKPTLLLSECVLTYMEVQRSDALIEFCANTFSNAAFICYEQIYPSDSFGRVMMNHFKKLGSPLQAIRMYSTPSDHQERYLRLGWTSAKVIDMNEFYL-CLHEEERDRIKKLEPFDEFEEWHLKCNHYILVTACKGSC---------------------------ITAFQDDIHRSNSGSFRMYQQKPQLDQLLEAQLPDSITEANF------SGFGHSSERISSTTVLVHGGFGDK--GGRHQRLSEMVAMNIHTGNSFTVEPEEGSDVIGPRMFHTITALNHNKSSLLIFGGRTSPTKP 445          
BLAST of Leucine carboxyl methyltransferase 2 vs. TrEMBL
Match: A0A2G8JEX5 (Putative tRNA wybutosine-synthesizing protein 4 OS=Stichopus japonicus OX=307972 GN=BSL78_28880 PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 8.648e-84
Identity = 176/472 (37.29%), Postives = 258/472 (54.66%), Query Frame = 2
Query:   98 NVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSP----EHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRPGPILIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTGNRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRHIEPAR-SQLLANSLCGSMTRISGN--CFIIFGGRSSPLKP 1492
            N   +QGTND+SI+SKC++   GYF+D++L   + + +RRAPLINRGYY+RAKAI+  L  F+++ +   A QI SLGAGFD++FFRL     L    F E+D+ +VA RKA ++Q    L   L  P    ++PV + KD  ++I++S+Y+L+GI++  L  L   +  SG   + PTL LSECV+TY+  ++S +L++F A +FS   F+ YEQIYP DSFGR M +HFK+LGS L+ I+ Y T     ER L  GW SA   DM EFY   +  +E+ RI+ LE FDE+EEW LKCNHY+++ AC+GS                     A           +  +      L Q   A       E  F   G  +  + +  +  +G            G+G       H RL+ L  +++ T     +EP   S ++   +  ++T ++ N    +IFGGR+SP KP
Sbjct:    9 NETAVQGTNDSSIVSKCAISMQGYFHDDYLRHFVARQTRRAPLINRGYYVRAKAIDGALRHFLKSFQ-GQANQIVSLGAGFDSAFFRLESARLLSETCFYEIDFAEVANRKAAIIQSNDILCALLKEPVFHHKNPV-VQKDGGVIISSSSYRLLGINLNDLSSLHRFLLHSGCDLNKPTLLLSECVLTYMEVQRSDALIEFCASTFSNVAFICYEQIYPSDSFGRVMMNHFKKLGSPLQAIRMYSTPSDHQERYLRLGWTSAKVIDMNEFYL-CLGEDERDRIKKLEPFDEFEEWHLKCNHYILVTACKGSC------------------ITAFQDDIHRSNSGSFRMYQQKPRLDQLLEAQLPDSITEANFSGFGHSSERISSTTVLVHG------------GFGDK--GGRHQRLSELVAMNVHTGNSFTVEPEEGSDVIGPRMFHTITALNHNKSSLLIFGGRTSPTKP 445          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Cavefish
Match: lcmt2 (leucine carboxyl methyltransferase 2 [Source:NCBI gene;Acc:103040183])

HSP 1 Score: 275.018 bits (702), Expect = 4.092e-81
Identity = 128/304 (42.11%), Postives = 196/304 (64.47%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            +QGTND+S++SK S    GYF D+ L   + K SRRAPLINRGYY+R +A++H +  F+   ++    QI SLGAGFD+ +FRLH +G L+     E+D+ DV +RKA L++   +L   L    H   L     + ++++ YKL+G+D+     ++  +R +G+ +D PTL LSE V+TY+ TK S +++ + A+S S+  FV+YEQI PDD FGR M +HF +L S +  +  Y     Q +R L  GW+  T  DM +FY++++S +E+ R+E++E FDE+EEW  KC+HY +L A +GS+
Sbjct:   24 VQGTNDSSVVSKVSAAAQGYFQDDLLQHFVCKVSRRAPLINRGYYVRWQAVDHCVKGFLRVTENCAGRQILSLGAGFDSLYFRLHAEGALERVVVFEVDFPDVTRRKAALIKGNDRLKDALPDWNH---LEPTGPVCVSSAQYKLLGVDVRTEREVEEGLRVAGLQWDRPTLVLSEVVLTYMETKWSDAVIGWAARSLSQALFVMYEQIRPDDPFGRVMQNHFLKLNSKIHALCQYPDTSAQTKRFLQQGWEKCTCLDMNQFYFSLLSQDEQERVENMEPFDEFEEWHQKCSHYFILSASKGSL 324          

HSP 2 Score: 77.7962 bits (190), Expect = 2.641e-14
Identity = 77/339 (22.71%), Postives = 129/339 (38.05%), Query Frame = 2
Query: 1427 SMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXX--------XXXXCS--GSVVSIGT---------DSFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSC-GVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAF-SSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            ++T + G   ++ GGR+SPL P D   ++  H +   ++                                     ++   +A KP  RWRH A       K YL ++GGR+     L D +        W                    C+  G VV  G          D    NDSP                      +G +W+         ++    + +PR+SH++H++  +         +  VGGV  +     GV +I++   +N    I++ +DT S    +M+H+  S    SD  ++ ++GGGGNCFSFGT LN +  ++DL  +
Sbjct:  419 TLTSVPGWGAVVTGGRTSPLNPIDSVLKVTHHLSDQPDSRTVLL----------------------------SVEKMVCTGQAPKP--RWRHTATLLNHKGKNYLFVFGGRTEKEPVLGDAHFLCLEDQHWTDARVPLEGCFPEPRHSHSACAYRGGVVIFGGLGRGGVPLGDVMWLNDSP----------------------TGFVWK---------KVQLRPALVPRYSHSAHVIGEN---------LVVVGGVWLQADGVPGVAVINLTTGSN----IEVTIDTSSVPWPLMLHSFCSELLDSDRTEVVLIGGGGNCFSFGTHLNIHPVTLDLRPV 683          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Cavefish
Match: lcmt2 (leucine carboxyl methyltransferase 2 [Source:NCBI gene;Acc:103040183])

HSP 1 Score: 275.018 bits (702), Expect = 4.149e-81
Identity = 128/304 (42.11%), Postives = 196/304 (64.47%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            +QGTND+S++SK S    GYF D+ L   + K SRRAPLINRGYY+R +A++H +  F+   ++    QI SLGAGFD+ +FRLH +G L+     E+D+ DV +RKA L++   +L   L    H   L     + ++++ YKL+G+D+     ++  +R +G+ +D PTL LSE V+TY+ TK S +++ + A+S S+  FV+YEQI PDD FGR M +HF +L S +  +  Y     Q +R L  GW+  T  DM +FY++++S +E+ R+E++E FDE+EEW  KC+HY +L A +GS+
Sbjct:   28 VQGTNDSSVVSKVSAAAQGYFQDDLLQHFVCKVSRRAPLINRGYYVRWQAVDHCVKGFLRVTENCAGRQILSLGAGFDSLYFRLHAEGALERVVVFEVDFPDVTRRKAALIKGNDRLKDALPDWNH---LEPTGPVCVSSAQYKLLGVDVRTEREVEEGLRVAGLQWDRPTLVLSEVVLTYMETKWSDAVIGWAARSLSQALFVMYEQIRPDDPFGRVMQNHFLKLNSKIHALCQYPDTSAQTKRFLQQGWEKCTCLDMNQFYFSLLSQDEQERVENMEPFDEFEEWHQKCSHYFILSASKGSL 328          

HSP 2 Score: 77.7962 bits (190), Expect = 2.499e-14
Identity = 77/339 (22.71%), Postives = 129/339 (38.05%), Query Frame = 2
Query: 1427 SMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXX--------XXXXCS--GSVVSIGT---------DSFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSC-GVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAF-SSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNI 2380
            ++T + G   ++ GGR+SPL P D   ++  H +   ++                                     ++   +A KP  RWRH A       K YL ++GGR+     L D +        W                    C+  G VV  G          D    NDSP                      +G +W+         ++    + +PR+SH++H++  +         +  VGGV  +     GV +I++   +N    I++ +DT S    +M+H+  S    SD  ++ ++GGGGNCFSFGT LN +  ++DL  +
Sbjct:  423 TLTSVPGWGAVVTGGRTSPLNPIDSVLKVTHHLSDQPDSRTVLL----------------------------SVEKMVCTGQAPKP--RWRHTATLLNHKGKNYLFVFGGRTEKEPVLGDAHFLCLEDQHWTDARVPLEGCFPEPRHSHSACAYRGGVVIFGGLGRGGVPLGDVMWLNDSP----------------------TGFVWK---------KVQLRPALVPRYSHSAHVIGEN---------LVVVGGVWLQADGVPGVAVINLTTGSN----IEVTIDTSSVPWPLMLHSFCSELLDSDRTEVVLIGGGGNCFSFGTHLNIHPVTLDLRPV 687          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Sea Lamprey
Match: lcmt1 (leucine carboxyl methyltransferase 1 [Source:ZFIN;Acc:ZDB-GENE-040912-75])

HSP 1 Score: 103.219 bits (256), Expect = 4.650e-25
Identity = 56/209 (26.79%), Postives = 110/209 (52.63%), Query Frame = 2
Query:  392 FIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGS 1018
            + ELD+  +  RK  +++ ++ L K +       SL  D    +N+  + ++G+D+  L  +   +R +G+   LPT+ ++ECV+ Y++ + S+ L+++ A +F    F+ YEQ+  +D FG+ M  + +    SL G+   ++ + QM R    GW+ A + +M    YN +   ++ R+E +E  DE E       HY ++ A + +
Sbjct:   18 YFELDFPAITSRKIHIIKTKAPLSKAVLETHSSDSLALDGA-NLNSDRFAILGVDLRDLATVQQKLRDTGLDPQLPTVLVAECVLVYMTLEHSSRLVRWAADTFPTALFINYEQVNMEDRFGQVMIENLQHRQCSLAGVTACRSLQTQMARFSDNGWEKADALNMMTV-YNCLPHTDRRRMEKIEFLDEGELLQQLLQHYGLIWAVKDA 224          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001847.1 (pep scaffold:Pmarinus_7.0:GL480510:776:12411:1 gene:ENSPMAG00000001681.1 transcript:ENSPMAT00000001847.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 3.836e-14
Identity = 72/263 (27.38%), Postives = 105/263 (39.92%), Query Frame = 2
Query: 1646 CSPLIAVNEAD----KPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXX-XXXCSGSVVSIGTDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQQ----WTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDS------------KQIYIVGGGGNCFSFGTQLNENVYSIDL 2371
             +P +A++E       PS RWRH A       + +L +YGGR +    LSD +  D    +W QL    S      S +    G  +  +                    G+ LVP G +       Q     W ++       PR+SHT+H++          V +  VG  S   P+  +    IDL+  S +  +  VDT      V++H H +    DS            + I+IVGGGGNCFSFGT LN     + L
Sbjct:   98 AAPSLALSEVPCIGAAPSPRWRHAACVVSCRGRRFLFVYGGRDTQHLVLSDWHFLDLEAFTWTQLPVSGSRPEGRHSHAACGFGEGAVVAGG-----------------LGAALVPLGCVHLLSPAAQHEGFTWRQLPLRHPITPRYSHTAHVIEERR-----LVLVGGVGIHSAYPPALAI----IDLLTGSTQ--EYNVDTCGVEGPVLLHGHSAVERWDSGGGCGGDGKDHERHIFIVGGGGNCFSFGTHLNPRPLILRL 332          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Yeast
Match: PPM2 (AdoMet-dependent tRNA methyltransferase; also involved in methoxycarbonylation; required for the synthesis of wybutosine (yW), a modified guanosine found at the 3'-position adjacent to the anticodon of phe-tRNA; similarity to Ppm1p [Source:SGD;Acc:S000005501])

HSP 1 Score: 112.464 bits (280), Expect = 5.009e-26
Identity = 95/327 (29.05%), Postives = 158/327 (48.32%), Query Frame = 2
Query:  104 IRIQGTNDNSILSKCS-----MIKYGYFND----------EFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRL------HKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYD--LPTLFLSECVITYISTKKSASLLKFIAKSFSENC-FVLYEQIYPDDSFGRF---MCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEV--FDEYEEWLLKCNHYMV 997
            + IQGTN++SI SK S     + K    N+          E+  F + K  +R+P INRGY++R  AI   L + IE       I + +LG G+D   F+L        Q   D  +FI++DY D+ + K  L++   +L K +   E    +   N   +    Y     D+    +    +    + YD  +  +F++E  + Y+  ++S S+++  A S  EN  F++ EQ+ P   F  F   M +HFK+  S L+ +  Y T E Q++R    G+      DM + +    S++E ++ E L+V  FDE EE+ L C+HY++
Sbjct:   25 LAIQGTNNSSIASKRSVELLYLPKLSSANNFQMDKNNKLLEYFKFFVPKKIKRSPCINRGYWLRLFAIRSRLNSIIEQTPQDKKIVVVNLGCGYDPLPFQLLDTNNIQSQQYHDRVSFIDIDYSDLLKIKIELIKTIPELSKIIGLSEDKDYVDDSNVDFLTTPKYLARPCDLNDSKMFSTLLNECQL-YDPNVVKVFVAEVSLAYMKPERSDSIIE--ATSKMENSHFIILEQLIPKGPFEPFSKQMLAHFKRNDSPLQSVLKYNTIESQVQRFNKLGFAYVNVGDMFQLWE---SADEATKKELLKVEPFDELEEFHLFCHHYVL 345          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Yeast
Match: PPM1 (Carboxyl methyltransferase; methylates the C terminus of the protein phosphatase 2A catalytic subunit (Pph21p or Pph22p), which is important for complex formation with regulatory subunits; required for methionine to inhibit autophagy and promote growth [Source:SGD;Acc:S000002843])

HSP 1 Score: 94.7449 bits (234), Expect = 1.664e-21
Identity = 77/306 (25.16%), Postives = 142/306 (46.41%), Query Frame = 2
Query:  158 KYGYFNDEFLPFMIGKFSRRA------------PLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLD----ILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQI---YPDDSFGRFMCSHFKQLGS-SLRGIQTYKTKEMQMERLLHAGWDSATSW---DMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVA 1006
            KY  ++  +L   + KFSRRA            P++N G Y+R   I+  +L F+  N   + +Q+ +LG G D     L +     +  ++++DY +  + K  ++++   L   L   +   +    +  +I+   YKL   D+  +     +LD C +      ++PT+ +SEC++ Y+   +S  L+  I   FS   ++ Y+ I    P+D FG  M S+ K+  +  +  + TY +KE    R     W +A +    DM E +   +   E+ R+  L+  DE EE  +   HY+++ A
Sbjct:   40 KYTEWHRSYL-ITLKKFSRRAFGKVDKAMRSSFPVMNYGTYLRTVGIDAAILEFLVAN---EKVQVVNLGCGSDLRMLPLLQM--FPHLAYVDIDYNESVELKNSILRESEILRISLGLSKEDTA---KSPFLIDQGRYKLAACDLNDITETTRLLDVCTKR-----EIPTIVISECLLCYMHNNESQLLINTIMSKFSHGLWISYDPIGGSQPNDRFGAIMQSNLKESRNLEMPTLMTYNSKEKYASR-----WSAAPNVIVNDMWEIFNAQIPESERKRLRSLQFLDELEELKVMQTHYILMKA 326          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Nematostella
Match: EDO42453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1F7])

HSP 1 Score: 256.144 bits (653), Expect = 8.105e-75
Identity = 130/305 (42.62%), Postives = 190/305 (62.30%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNK--HMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGS 1018
            +Q TND+SILSK SM++ GYF DEFL F + K ++R+PLINRGYYIR KA+  +L  F+E++   +   +QI SLGAGFDTSFFR   +G+L N  F E+D+ +V + K   ++Q + L+      E P   H ++Y         L+G D+  L  L+  +   G+    PTL LSE V++Y+    S++++ + AK F    FV YEQ+YP+D FG  M +HF +LGS LR I +Y + + Q++R +  GW  A   DM  F+ N+   EEK R+E +E FDE+EEW LKC+HY+++   +GS
Sbjct:    1 VQSTNDSSILSKFSMVRAGYFKDEFLKFFVTKDAKRSPLINRGYYIRIKAVSQVLSLFLESSFKCYSHYLQILSLGAGFDTSFFRFASEGRLTNTRFFEVDFPEVVKHKIKFIKQ-NNLFNIPHENELPSGFHSEDY--------SLLGCDLKNLQGLEQKLLGCGIDTSCPTLLLSEVVLSYLDPISSSAVICWAAKRFDSAVFVSYEQVYPEDPFGVVMINHFNRLGSPLRSITSYPSPQAQVQRYIEKGWTKAQYQDMNSFFNNL-PVEEKQRVEAIEPFDEFEEWHLKCSHYILICGLKGS 295          

HSP 2 Score: 65.855 bits (159), Expect = 4.018e-11
Identity = 42/121 (34.71%), Postives = 66/121 (54.55%), Query Frame = 2
Query: 2006 RRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSID 2368
            ++ +  +I  N    PR+SHT+H+  RS        ++  +GGVS KT  C    + ++LV+ + + +   V   S    VM+HNH S       +I ++GGGGNCFSFGT LN+N   ++
Sbjct:  543 QKFEVQDIDINPPLPPRYSHTAHL--RSE-------SLILIGGVSQKTTGCPSATV-LNLVSMTWKLLAFPVSPSSSP--VMLHNHCSV-DIGFDRIMVLGGGGNCFSFGTHLNQNALVLN 650          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Nematostella
Match: EDO32727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU99])

HSP 1 Score: 139.813 bits (351), Expect = 2.255e-37
Identity = 77/222 (34.68%), Postives = 125/222 (56.31%), Query Frame = 2
Query:  116 GTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFK 781
             TND++   K S ++ GY+ D F+ + + +  RR P INRGYY R K +  ++  F+E      + QI SLGAGFDT F++L  +GK D   F+E+D+  V  RK   ++   +L K + + E  +++  +    +++ +Y LI  D+  L  LD      G+  DLPTLFL ECV  Y+  + SA+L+ +  ++F+   F+ +EQ+   D FG+ M  + K
Sbjct:   11 ATNDDASSCKRSAVQKGYWEDNFIQYFVKQAERRTPEINRGYYARVKGMHTLVEQFVELTDR--SCQIISLGAGFDTLFWQLKHKGK-DPAVFVEVDFSSVTSRKCHSIKMRKQL-KEVFTAEDNLTIDPNE---VHSKSYHLIAADLRDLSALDTKFTEIGLDRDLPTLFLVECVFVYMKPEHSAALIDWTGRNFNTAIFINFEQVNMQDRFGQVMIENLK 225          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Medaka
Match: lcmt1 (leucine carboxyl methyltransferase 1 [Source:NCBI gene;Acc:101171444])

HSP 1 Score: 153.68 bits (387), Expect = 6.940e-41
Identity = 92/305 (30.16%), Postives = 166/305 (54.43%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKF-SRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            ++ T D++ + K      GY+ D ++ + +     R+AP INRGYY R + +  +L  F++  K     QI +LGAG DT+F+RL K   L    F E+D+  +  RK   ++ +  L K +       SL  D +  +++  Y +IG D+  +  ++  ++   ++ +LPTL L+ECV+ Y++  +S+ L++++A++F    F+ YEQ    D FG+ M  + ++    L G++T ++ ++Q ER L +GW+ A++ DM    Y+++  E+  RIE LE  DE E       HY +  A +  +
Sbjct:   17 VRATCDDATVCKRFATSKGYWKDPYIQYFVRSVGERKAPEINRGYYARVQGVNFLLDAFLK--KTQCNCQIINLGAGLDTTFWRL-KDNNLMPRKFFEVDFPTIVSRKIHYIKTKPPLSKPIIETHSTDSLLLDAH-SLDSDRYCIIGADLRNISDMEEKLKKFQLNTELPTLVLTECVLVYMTPSQSSGLIRWVAETFHSAMFINYEQANMCDRFGQVMIENLQRRQCMLAGVETCQSLDLQKERFLRSGWEHASALDMITV-YSMLPQEDVGRIERLEFLDEGELLQQLLQHYSISWATKDKL 316          
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Medaka
Match: lcmt1 (leucine carboxyl methyltransferase 1 [Source:NCBI gene;Acc:101171444])

HSP 1 Score: 153.295 bits (386), Expect = 1.319e-40
Identity = 92/305 (30.16%), Postives = 166/305 (54.43%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKF-SRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSV 1021
            ++ T D++ + K      GY+ D ++ + +     R+AP INRGYY R + +  +L  F++  K     QI +LGAG DT+F+RL K   L    F E+D+  +  RK   ++ +  L K +       SL  D +  +++  Y +IG D+  +  ++  ++   ++ +LPTL L+ECV+ Y++  +S+ L++++A++F    F+ YEQ    D FG+ M  + ++    L G++T ++ ++Q ER L +GW+ A++ DM    Y+++  E+  RIE LE  DE E       HY +  A +  +
Sbjct:   17 VRATCDDATVCKRFATSKGYWKDPYIQYFVRSVGERKAPEINRGYYARVQGVNFLLDAFLK--KTQCNCQIINLGAGLDTTFWRL-KDNNLMPRKFFEVDFPTIVSRKIHYIKTKPPLSKPIIETHSTDSLLLDAH-SLDSDRYCIIGADLRNISDMEEKLKKFQLNTELPTLVLTECVLVYMTPSQSSGLIRWVAETFHSAMFINYEQANMCDRFGQVMIENLQRRQCMLAGVETCQSLDLQKERFLRSGWEHASALDMITV-YSMLPQEDVGRIERLEFLDEGELLQQLLQHYSISWATKDKL 316          
BLAST of Leucine carboxyl methyltransferase 2 vs. Planmine SMEST
Match: SMESG000049235.1 (SMESG000049235.1)

HSP 1 Score: 1372.84 bits (3552), Expect = 0.000e+0
Identity = 776/776 (100.00%), Postives = 776/776 (100.00%), Query Frame = 2
Query:   65 MXXXXXXKEISNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRPGPILIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTGNRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRHIEPARSQLLANSLCGSMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWXXXXXXXXXXXXCSGSVVSIGTDSFCSNDSPDRXXXXXXXXXXXXXXXXDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNIDFYK 2392
            MNSNNNNKEISNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRPGPILIDVPVTLAAAAAAAPVSPADPADPADTLRLPPLNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTGNRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRHIEPARSQLLANSLCGSMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYNADANAADGNAADGNAADGNAADANADNGGGGGGNLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWQQLLGQQSPGPLCSGSVVSIGTDSFCSNDSPDRCCGCCCLLLTGGLSGSDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNIDFYK
Sbjct:    1 MNSNNNNKEISNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGSVCWRPGPILIDVPVTLAAAAAAAPVSPADPADPADTLRLPPLNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTGNRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRHIEPARSQLLANSLCGSMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYNADANAADGNAADGNAADGNAADANADNGGGGGGNLWQAECSPLIAVNEADKPSARWRHMAGCYWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWQQLLGQQSPGPLCSGSVVSIGTDSFCSNDSPDRCCGCCCLLLTGGLSGSDLVPSGNIWRWCGRRQQWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSCGVTLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGGGNCFSFGTQLNENVYSIDLSNIDFYK 776          
BLAST of Leucine carboxyl methyltransferase 2 vs. Planmine SMEST
Match: SMESG000027726.1 (SMESG000027726.1)

HSP 1 Score: 130.954 bits (328), Expect = 3.643e-33
Identity = 92/304 (30.26%), Postives = 155/304 (50.99%), Query Frame = 2
Query:  110 IQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSRRAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLHKQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNYIVINASNYKLIGIDM-TKLDILDACIRASGVSYDLPTLFLSECVITYISTKKSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQTYKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYEEWLLKCNHYMVLVACRGS 1018
            IQ T+++++ +K S +K GY+ D ++ F I +   +AP INRGY+ R ++IE I   FI +N   ++ QI ++G+G DT + RL  Q  L    F+E+D  +   +K     Q  K++K   +      L +  Y       Y L   D+ +  + L   ++   +++  PTLF++ECV+ YI+++     L  +A  F  + F+ Y+ I   DSFG+ M S+ K     L GI    +KE  + R   A +     W ++E Y +  S +   RIE +E+ D+ E      +HY ++VA   S
Sbjct:    9 IQDTDNDAVEAKASAVKLGYWKDPYIKFFINEPKNKAPEINRGYFARTQSIEAITKEFIMSN---NSSQIINVGSGSDTLYLRLLDQDVLP-FKFVEIDLTENIMKKVSQFHQR-KIFKEKFNLNQQSKLSESIY----NHPYYLFSFDIRSDPNELIEILKKVEINFANPTLFITECVLVYINSESVDKFLSSMANHFQLSVFLSYDPINMLDSFGKVMVSNLKMRHIELNGISACMSKETHIHRFNKAYYSDVKVWLISEVYKSF-SKQTTKRIESIEMLDDPEMMKQLFDHYCLIVAMTKS 302          
The following BLAST results are available for this feature:
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LCMT24.502e-7528.85leucine carboxyl methyltransferase 2 [Source:HGNC ... [more]
LCMT13.852e-4533.87leucine carboxyl methyltransferase 1 [Source:HGNC ... [more]
LCMT12.139e-2442.45leucine carboxyl methyltransferase 1 [Source:HGNC ... [more]
LCMT17.709e-1730.72leucine carboxyl methyltransferase 1 [Source:HGNC ... [more]
LCMT16.940e-1340.00leucine carboxyl methyltransferase 1 [Source:HGNC ... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lcmt-11.543e-4133.54Leucine carboxyl methyltransferase 1 [Source:UniP... [more]
lcmt-11.543e-4133.54Leucine carboxyl methyltransferase 1 [Source:UniP... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG37935.791e-5435.31gene:FBgn0028507 transcript:FBtr0080761[more]
CG37936.385e-5435.31gene:FBgn0028507 transcript:FBtr0305560[more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lcmt22.302e-8244.59leucine carboxyl methyltransferase 2 [Source:ZFIN;... [more]
lcmt21.186e-7443.84leucine carboxyl methyltransferase 2 [Source:ZFIN;... [more]
lcmt11.648e-4131.15leucine carboxyl methyltransferase 1 [Source:ZFIN;... [more]
lcmt15.028e-4130.82leucine carboxyl methyltransferase 1 [Source:ZFIN;... [more]
lcmt21.199e-3250.43leucine carboxyl methyltransferase 2 [Source:ZFIN;... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slco1b31.477e-6740.45solute carrier organic anion transporter family me... [more]
slco1b31.477e-6740.45solute carrier organic anion transporter family me... [more]
slco1b32.297e-6540.26solute carrier organic anion transporter family me... [more]
lcmt12.407e-4231.15leucine carboxyl methyltransferase 1 [Source:NCBI ... [more]
lcmt13.388e-4231.15leucine carboxyl methyltransferase 1 [Source:NCBI ... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Lcmt28.086e-6837.01leucine carboxyl methyltransferase 2 [Source:MGI S... [more]
Lcmt12.049e-4832.79leucine carboxyl methyltransferase 1 [Source:MGI S... [more]
Lcmt14.382e-4832.79leucine carboxyl methyltransferase 1 [Source:MGI S... [more]
Lcmt26.956e-2445.83leucine carboxyl methyltransferase 2 [Source:MGI S... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O60294|TYW4_HUMAN2.162e-7428.85tRNA wybutosine-synthesizing protein 4 OS=Homo sap... [more]
sp|Q5XIA3|TYW4_RAT9.719e-6937.13tRNA wybutosine-synthesizing protein 4 OS=Rattus n... [more]
sp|Q8BYR1|TYW4_MOUSE5.656e-6737.01tRNA wybutosine-synthesizing protein 4 OS=Mus musc... [more]
sp|Q8VY08|LCMT1_ARATH6.383e-5735.60Leucine carboxyl methyltransferase 1 homolog OS=Ar... [more]
sp|Q6P4Z6|LCMT1_RAT2.245e-4632.46Leucine carboxyl methyltransferase 1 OS=Rattus nor... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2ZX291.474e-10931.63Leucine carboxyl methyltransferase 2 OS=Latimeria ... [more]
H2ZX301.665e-10931.25Leucine carboxyl methyltransferase 2 OS=Latimeria ... [more]
A0A401PCW13.208e-9131.03Uncharacterized protein OS=Scyliorhinus torazame O... [more]
A0A2G8JUX92.599e-8437.89Putative tRNA wybutosine-synthesizing protein 4 OS... [more]
A0A2G8JEX58.648e-8437.29Putative tRNA wybutosine-synthesizing protein 4 OS... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lcmt24.092e-8142.11leucine carboxyl methyltransferase 2 [Source:NCBI ... [more]
lcmt24.149e-8142.11leucine carboxyl methyltransferase 2 [Source:NCBI ... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lcmt14.650e-2526.79leucine carboxyl methyltransferase 1 [Source:ZFIN;... [more]
ENSPMAT00000001847.13.836e-1427.38pep scaffold:Pmarinus_7.0:GL480510:776:12411:1 gen... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PPM25.009e-2629.05AdoMet-dependent tRNA methyltransferase; also invo... [more]
PPM11.664e-2125.16Carboxyl methyltransferase; methylates the C termi... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO424538.105e-7542.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO327272.255e-3734.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lcmt16.940e-4130.16leucine carboxyl methyltransferase 1 [Source:NCBI ... [more]
lcmt11.319e-4030.16leucine carboxyl methyltransferase 1 [Source:NCBI ... [more]
back to top
BLAST of Leucine carboxyl methyltransferase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000049235.10.000e+0100.00SMESG000049235.1[more]
SMESG000027726.13.643e-3330.26SMESG000027726.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026423 ID=SMED30026423|Name=Leucine carboxyl methyltransferase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2417bp
GTCTCTACATTTACAATTAATTAATTATATTAAGCTATTAGATTTTTAGG
GGTTATATCTAATAATGAATAGCAACAATAATAATAAAGAAATTTCTAAT
GTTATAAGAATTCAAGGTACCAATGATAATAGTATTCTTAGTAAGTGCTC
TATGATAAAATATGGATACTTTAATGATGAATTTTTACCATTCATGATTG
GTAAATTTTCTAGACGAGCTCCACTTATTAATAGAGGATATTATATTCGT
GCCAAAGCTATTGAACACATTCTATTGACCTTTATTGAAAATAATAAGCA
CATGGATGCTATTCAAATATTCTCACTAGGCGCCGGATTCGATACATCAT
TTTTTCGTTTACATAAACAAGGAAAATTGGACAATTGTACATTTATAGAG
TTAGATTATTTCGATGTAGCTCAACGTAAAGCGGTATTAATGCAACAGGA
ATCGAAGCTCTGGAAATGCCTATCAAGCCCTGAACATCCAGTTTCATTGC
ATAAGGATAATTACATTGTGATAAATGCTTCTAATTATAAGCTAATCGGA
ATCGACATGACGAAACTGGATATATTGGACGCGTGCATCCGTGCCTCAGG
CGTGTCATACGACCTGCCGACCCTCTTCCTCTCGGAATGCGTCATAACAT
ACATCAGCACCAAGAAATCGGCAAGTTTGCTGAAATTTATTGCCAAATCA
TTTAGTGAGAATTGCTTCGTGTTGTATGAGCAGATCTATCCGGACGACAG
CTTTGGCAGATTCATGTGCTCCCATTTCAAGCAGTTGGGCTCGTCCCTGA
GAGGAATACAGACCTATAAAACAAAGGAGATGCAGATGGAGAGGTTGCTG
CACGCGGGCTGGGATTCCGCGACCAGCTGGGACATGGCAGAATTCTACTA
CAACATCGTCAGTTCCGAGGAGAAATCTCGCATCGAGCATCTGGAGGTGT
TTGATGAGTACGAGGAGTGGCTGCTGAAATGCAATCATTACATGGTGCTG
GTTGCGTGCAGAGGCAGTGTGTGTTGGAGGCCCGGCCCAATCCTGATTGA
TGTCCCGGTCACCCTTGCTGCTGCTGCTGCTGCTGCCCCTGTTAGCCCCG
CTGATCCCGCTGATCCCGCTGACACCCTGCGGTTACCCCCACTGAATCTC
ATCCAATATCATTCCGCCAATCAGCAGCAGCAGACAGAGGAACCCCAGTT
CAAATTCGGCGGCATCAAAACCCATTATGTGAAGGCTGATCTGATCGCTG
GCAACGGAACCGGGAACCGGCGGCAGTACCTGTTGCGGAGCTCTGGATAC
GGACAGAACCCGTTCAGTGCCGGCCATTGTCGATTGACTTGTCTCAGTAT
TCTCGATCTCACCACGAATGTCATGAGGCACATCGAGCCGGCCCGGTCGC
AGCTGCTCGCCAACTCTCTGTGCGGCAGCATGACGCGGATCTCGGGCAAC
TGCTTCATCATATTCGGTGGCAGATCATCACCGTTGAAACCGAATGATCT
GGCTACGAGATTGCAGTTGCATTACAATGCTGATGCCAATGCCGCTGATG
GCAATGCCGCTGATGGCAATGCCGCTGATGGCAATGCCGCTGATGCCAAT
GCTGATAATGGCGGCGGCGGCGGCGGCAATTTATGGCAGGCAGAATGCTC
ACCATTAATTGCCGTTAATGAAGCCGATAAACCATCTGCCCGATGGCGTC
ACATGGCCGGTTGCTATTGGTTACATGACAAACCATATCTGCTTATTTAC
GGCGGCAGAAGCAGTGATCCAAATCCGTTATCGGATAATTATATATTTGA
CTTTTCTCTGAATTCCTGGCAACAGTTGCTAGGGCAACAAAGTCCTGGTC
CGTTATGCAGTGGCTCCGTGGTTTCTATAGGCACTGATTCGTTCTGTAGC
AACGATTCACCTGACCGGTGCTGCGGTTGCTGTTGCCTGTTGCTAACTGG
CGGTCTCTCCGGTAGCGATTTGGTGCCCTCGGGTAACATCTGGCGCTGGT
GTGGCCGGCGGCAACAGTGGACCGAGATTGCTAGCAACCGATCCTTTCTG
CCGAGGTTCTCACATACGTCCCACATTGTCTATCGGTCCAATCATTGCAA
TCCCACAACGGTTACCATGGCATCTGTTGGAGGCGTTTCTCACAAGACCC
CGAGTTGCGGTGTGACCTTGATCTCAATCGATCTGGTTGCCAACAGCGCT
CGGTGCATTGATATGGCTGTGGATACGGGCAGCCAATCAGAATGCGTTAT
GATACACAATCACGGTAGCGCGTTTTCATCGGATTCCAAGCAAATATATA
TAGTCGGAGGCGGTGGAAACTGTTTCAGCTTTGGTACCCAGCTGAATGAG
AATGTTTACTCTATTGATTTGTCAAACATTGATTTTTATAAATAAATTTT
TGATTTTTCTAAAAAAA
back to top

protein sequence of SMED30026423-orf-1

>SMED30026423-orf-1 ID=SMED30026423-orf-1|Name=SMED30026423-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=777bp
MNSNNNNKEISNVIRIQGTNDNSILSKCSMIKYGYFNDEFLPFMIGKFSR
RAPLINRGYYIRAKAIEHILLTFIENNKHMDAIQIFSLGAGFDTSFFRLH
KQGKLDNCTFIELDYFDVAQRKAVLMQQESKLWKCLSSPEHPVSLHKDNY
IVINASNYKLIGIDMTKLDILDACIRASGVSYDLPTLFLSECVITYISTK
KSASLLKFIAKSFSENCFVLYEQIYPDDSFGRFMCSHFKQLGSSLRGIQT
YKTKEMQMERLLHAGWDSATSWDMAEFYYNIVSSEEKSRIEHLEVFDEYE
EWLLKCNHYMVLVACRGSVCWRPGPILIDVPVTLAAAAAAAPVSPADPAD
PADTLRLPPLNLIQYHSANQQQQTEEPQFKFGGIKTHYVKADLIAGNGTG
NRRQYLLRSSGYGQNPFSAGHCRLTCLSILDLTTNVMRHIEPARSQLLAN
SLCGSMTRISGNCFIIFGGRSSPLKPNDLATRLQLHYNADANAADGNAAD
GNAADGNAADANADNGGGGGGNLWQAECSPLIAVNEADKPSARWRHMAGC
YWLHDKPYLLIYGGRSSDPNPLSDNYIFDFSLNSWQQLLGQQSPGPLCSG
SVVSIGTDSFCSNDSPDRCCGCCCLLLTGGLSGSDLVPSGNIWRWCGRRQ
QWTEIASNRSFLPRFSHTSHIVYRSNHCNPTTVTMASVGGVSHKTPSCGV
TLISIDLVANSARCIDMAVDTGSQSECVMIHNHGSAFSSDSKQIYIVGGG
GNCFSFGTQLNENVYSIDLSNIDFYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR007213Ppm1/Ppm2/Tcmp
IPR029063SAM-dependent_MTases
IPR015915Kelch-typ_b-propeller
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 1..321
e-value: 5.5E-101
score: 340.1
NoneNo IPR availablePFAMPF13418Kelch_4coord: 543..594
e-value: 2.7E-5
score: 24.1
NoneNo IPR availablePANTHERPTHR46529FAMILY NOT NAMEDcoord: 4..771
IPR007213Methyltransferase Ppm1/Ppm2/TcmpPFAMPF04072LCMcoord: 49..210
e-value: 1.5E-21
score: 77.2
IPR015915Kelch-type beta propellerGENE3DG3DSA:2.120.10.80coord: 624..771
e-value: 3.3E-11
score: 44.8
IPR015915Kelch-type beta propellerSUPERFAMILYSSF117281Kelch motifcoord: 424..766
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 16..316