SMED30026417

Overview
NameSMED30026417
Smed IDSMED30026417
Length (bp)5981
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30026417 (SMED30026417) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30026417 (SMED30026417) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30026417 (SMED30026417) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30026417 (SMED30026417) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026417

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30026417SMESG000006455.1 dd_Smed_v4_11785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026417SMESG000006455.1 dd_Smed_v4_11785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026417SMESG000006455.1 dd_Smed_v4_11785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026417SMESG000006455.1 Contig26261newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026417SMESG000006455.1 Contig26261uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30026417 vs. TrEMBL
Match: A0A355ABF2 (Uncharacterized protein OS=Flavobacteriaceae bacterium OX=1871037 GN=DDZ39_05755 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 1.394e-95
Identity = 135/416 (32.45%), Postives = 225/416 (54.09%), Query Frame = -2
Query: 2336 KGMNAIITTILT*VMCIKGAEPFVVYDCNNIKIGDKYSLKETEECKAANPGRLQRTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXTRSECEKRFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVLVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTGMSTIVYHADTRSCRLTLLKSAIFDEVQGQVHSET----ETNTQKRAMEELRRTGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEK 3571
            K  N +I  +L  +  +   +    YDC+N K+G ++SL + EEC  A P + ++    + Y++YQE   I +  +ECTVTR+     C +HS S II+  +    + +    CE  F    IR+A ++ + A+ G +    +   G I A DG+CEGGEY    + ++  LVIE+YQ+ ++K +  FDP+T  +     C A    C  G ++I+Y    + C L  LK+  FD ++G++        + N++ + +    +T           I S  TP  + +  ++  +R ++   V KC + +   NY  I +S + +     KI  K++ L +Y NNK D+LYH  L   E +Y ++I NDC LNREIL+TK+A+ +TNP+ A P++PL +G F R++GEV+ T+KC++
Sbjct:  371 KVFNFVILMLL--LFSLPKGKAIKAYDCDNAKLGTQFSLLDAEECPEAYPNQFEKRFNRI-YHIYQERGLIYSAAKECTVTRRRSIRWCGHHSHSAIIKQPSMIEYLNIGHRNCEDAFRLKEIRLADKLILKAKPGILIQEDIIKVGSI-AFDGTCEGGEYWYQGKKIKQALVIETYQITIKKSEVAFDPDTNEMMSRSYCSAKSNFCFDGKTSIIYDIRKQECNLVFLKTVNFDVIRGKIFDNNLFIDKLNSRPKKIYRTEKT-----------INSHITPVVLIANKTSDAIRLVRKDQVVKCGQSVYLTNYDRIVVSTVRVKEAIIKISKKEINLAVYFNNKADYLYHHQLRQIEDLYREMIINDCKLNREILRTKMALIVTNPNIAAPVIPLGKGVFSRVLGEVLQTFKCKQ 771          

HSP 2 Score: 140.198 bits (352), Expect = 1.394e-95
Identity = 82/234 (35.04%), Postives = 136/234 (58.12%), Query Frame = -1
Query: 1656 RKVTGKLKIPSD-----KCINKGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPLRVFGLTELASEAEFKPV-DISRSGIYQTKDLERAREHLLFPTQKQAT*SNIVTITRGNNFGEKPNYELLLSPDHFQHATANMMKAMWGRFLIFGQMMAXXXXXXXXXXXXXXXLTQMLAYFDIYKRERKINWKMTLGFLPFLAKTMV---LHGHSKDIHK 2330
            ++V  K+ I SD       I K K  + +PVTR++ P         CS ++ P ++  D +W+  P+   +AP + F LT L +  +F  + D+ +SG+Y  K +E AR++LL+P  +    + IV  + G+  G +PNYELLLSP+HF+ A  N+MK +WGRFLIFGQ +A ++GI  ++  ++  + Q+ + +++YK     +WK+ LG +P LA+  +   LH    D+ K
Sbjct:  770 KQVEVKINISSDCTHELPVIYKNKFMYLEPVTRLLLPDVIKVKKIKCSPLFSPAYKLSDNTWIVTPSLTPIAPPKRFQLTNLRNAVKFSRLKDLMKSGLYDKKAMEDARKYLLYPQVRDRILTEIVETSLGD--GNRPNYELLLSPNHFEKAAKNVMKKVWGRFLIFGQAIAGLMGIYYVVIFLKTFIEQVTSTYELYKI-MGFSWKLILGIIPCLARPFISKKLHDKINDVEK 1000          
BLAST of SMED30026417 vs. TrEMBL
Match: A0A232EWL2 (Uncharacterized protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_006613 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.241e-16
Identity = 47/149 (31.54%), Postives = 68/149 (45.64%), Query Frame = -1
Query: 1833 FAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQF---PTRVIVAPLRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQKQAT*SNIVTITRGNNF-GEKPNYELLLSPDHFQHATANMMKAMWGRFLIFGQMMA 2267
            F  P TR++  A       SCS    P+F      WLQF   P+ V V+P  +   T+   E    P  I+ SGIY   DL   R+H++FP +K +  +N+     G +  G+  +    L P+  +    N    +WGRFL FG   A
Sbjct:  322 FLSPRTRILTRAG---TQISCSGAMPPMFNIGTH-WLQFLPAPSSV-VSPETLRPQTKSTWEYA-TPRAIAVSGIYTESDLNSLRDHIMFPLEKSSVLNNVAMGMSGKSITGKGISINQFLDPEVLESLANNTWDHLWGRFLTFGTASA 464          

HSP 2 Score: 56.225 bits (134), Expect = 1.241e-16
Identity = 26/87 (29.89%), Postives = 51/87 (58.62%), Query Frame = -2
Query: 2342 KAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKC 2602
            KA    +++ +++Y+N+K  ++     +   ++YYDL+K+ C L R+IL   L++A+ +PD     L  + G+   + GEV++  KC
Sbjct:  209 KANSPVENLDIFMYVNSKFVYVERHFKSQINQMYYDLLKHKCELERQILTNALSIAVQSPDEFAFRLMKEPGHMAVVAGEVIHLVKC 295          
BLAST of SMED30026417 vs. TrEMBL
Match: A0A151IXX8 (Uncharacterized protein OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_14657 PE=4 SV=1)

HSP 1 Score: 54.299 bits (129), Expect = 4.735e-12
Identity = 36/128 (28.12%), Postives = 54/128 (42.19%), Query Frame = -1
Query: 1833 FSCSNVYGPLFETRDRSWLQFPTRVIVAPLRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQKQAT*SNIVTITRGNNF-GEKPNYELLLSPDHFQHATANMMKAMWGRFLIFGQMMA 2213
             SC+ V  P+F   D  +   PT     P  +       +     P  ++ SGIY  KDLE  R+H++FP +K    + +    +G     +  +   LL     Q  T N  K +WG F+ FG   A
Sbjct:  340 ISCNCVIPPMFFLNDGWYRMTPTPEHSLPPTIMKPMTKPTWHYTNPGSLAASGIYSDKDLENLRDHIMFPAEKGGILNAMARGVKGEPIVSQGISLSHLLDESSIQKITENTWKKIWGNFISFGNASA 467          

HSP 2 Score: 49.2914 bits (116), Expect = 4.735e-12
Identity = 23/95 (24.21%), Postives = 50/95 (52.63%), Query Frame = -2
Query: 2321 VKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIARL 2605
             K ++  +++ ++ Y+N+K  ++     +    +Y D++K  C L +++LK  L++ I +PD     +    GY   I GEV++  KC   + ++
Sbjct:  211 TKHRLSTENLDIFTYINSKFVYVEKHIRSQMNLLYRDVLKQCCTLEQQVLKGALSLTINSPDEFAYQIMKGPGYMAVISGEVVHIIKCTPVVVKI 305          
BLAST of SMED30026417 vs. TrEMBL
Match: A0A0J7KGQ0 (Uncharacterized protein OS=Lasius niger OX=67767 GN=RF55_10780 PE=4 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 2.704e-11
Identity = 70/348 (20.11%), Postives = 129/348 (37.07%), Query Frame = -2
Query: 2342 DFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXTRSECEKRFNTGVIRI-AGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVLVIESYQVKLEKFQSYFDPNTQAI--KKYPQCVATHGSCTTGMSTIVYHADTRSCRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRTGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKID--PKD-VKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKC 3367
            D+   E+ +C V      ++C  HS  +++  G    +     + C + F  G   + AG +    +  +     +  AGRI + DGSC+G +Y+        V+V    ++ L ++ +    N+  I  K    CV +   C        Y     +      +  I  E                     + T  + NP+         TPT  + T   I     K +    C   ++   + ++F+      +  A  D  P D + ++ YMN+K  ++          +Y+++++  C L R+++   L+ A   PD     L    GY     GEV +  KC
Sbjct:   61 DYDHAEVIQCKVEISRSIYYCGMHSHISVVHNGKADYIHETGYTRCLRMFQDGSFSLGAGNVIHGLKTNQTSFHSLTLAGRI-SNDGSCKGTQYSDPYGTWDDVVVQAVVKISLRQYHASVQLNSGKIILKSGTACVLSDSFCLDSNDGYTYWKPIPASSCNFHQYDILYEGPAT-----------------KITDDVTNPS---------TPTVYSLTTQDITFALTKTKEQPLCGYTLLRTEHPKLFILETKKGDTFAHRDVIPVDNLDIFAYMNSKFVYVEKHIRQQMTSLYHNVVQQKCDLERQVITNALSFATLQPDEFAYRLMKGPGYMAVTTGEVTHIVKC 381          

HSP 2 Score: 44.669 bits (104), Expect = 2.704e-11
Identity = 48/176 (27.27%), Postives = 76/176 (43.18%), Query Frame = -1
Query: 1833 IPSDKCINKGKIRFAQ-PVT-----RMINPAKFIPNMFS----CSNVYGPLFETRDRSWLQF---PTRVIVAPLRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQKQAT*SNIVTITRGNNFGEKPNYEL-----LLSPDHFQHATANMMKAMWGRFLIFGQMMA 2306
            IP D  I K K  +++ PVT       + P   I   F     CS     ++   D +W+QF   P    + P  +  +T L+ E    P  ++ SGIY  +D+++ R+H++FP +K A    + TI RG + G   + +      LL          N    +W  F+ FG   A
Sbjct:  382 IPVDVTIRKTKDCYSELPVTVRNASLFLTPKSRIITKFGNERECSYELPTMYRVED-TWIQFAPDPQVRQLPPQLLQPMTTLSWEY-LTPGPLAISGIYSEQDIQKLRDHIMFPAEKPAL---LNTIARGLS-GHPVDSDAVSVYNLLDEASLNKIAENAASRVWNGFVKFGSATA 551          
BLAST of SMED30026417 vs. TrEMBL
Match: A0A195EK66 (Uncharacterized protein OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_01896 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.744e-9
Identity = 90/407 (22.11%), Postives = 154/407 (37.84%), Query Frame = -2
Query: 2342 AEPFVVYDCNNIKIG-DKYSLKETEECKAANPGRLQRTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXTRSECEKRFNTGVIRIAGRIQVAAEDGKIK-------TTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVLVIESYQVKLEKFQSYFDPNTQAI--KKYPQCVATHGSC--TTGMSTIVYHADTRSCRLTLLKSAIFDEV-QGQVHSETETNTQKRAMEELRRTGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISN---VKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKC 3514
            A   V YDC    +     SL +  +C + +   ++     V   + Q  DF KT + +C +    + ++C  HS  +I+  G    +     S C +   TG I + GR      DG I        +TR        + DG C G +Y+        V+V  + +V L  F++    N+  I       C  T G C  T G  T        SC  +      +D + +GQ    T    Q               PTI T+I  ETT                +    S C   +I   + ++F+          V+++I   ++ ++ Y+N+K  ++         ++Y D+ +  C L ++IL+  L ++   PD     +    GY   + GE ++  KC
Sbjct:   19 ARGLVGYDCGGHGLNITSLSLLDIGDCDSED---VEPITENVHVQLLQLSDFDKTRVIQCKIEIDRIIYYCGMHSHISIVHGGRRVYLQETAASNCRRIHETGTIDLGGR------DGYISGIKPNSSSTRSVTLAGYTSVDGRCSGTQYSDPYGTWDSVVVQATIKVTLRDFEAPIRRNSHEIILPSGLHCKVTAGECLDTDGGETFWSTVPPDSCHFSH-----YDVLYEGQASKLTPKANQT-------------TPTIYTVITRETT------------FALTQTGRTSLCGYTLIQTEHPKLFILETQQDRGFRVRSRISVNNLDIFAYVNSKFVYVEKHIRTQLTRLYRDITEQKCALEKQILQNALTLSSIAPDEMAHRIMKSPGYTAVVAGEAIHLIKC 386          
BLAST of SMED30026417 vs. Planmine SMEST
Match: SMESG000053822.1 (SMESG000053822.1)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 401/481 (83.37%), Postives = 434/481 (90.23%), Query Frame = -2
Query: 2300 DIIIKAIEPFILSQSGWQAFINLVSGDDQTDMMQTMLKELLKEFEIIINTSDPRTARKGMNAIITTILT*VMCIKGAEPFVVYDCNNIKIGDKYSLKETEECKAANPGRLQRTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXTRSECEKRFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVLVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTGMSTIVYHADTRSCRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRTGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIARLPENSRSP 3742
            DII K IEPFIL+Q GWQAFINLVS DDQT+MMQ  LKELL EFE  IN SDP+TARKGMN IITTIL  +MC+KG EPFVVYDC+NIKIGDKYSLKETEECKAANPG+LQ TATAVSYNVYQEVDFIKTEI+EC+VTRKIVAFHC +HS STIIE GTETTVV+VTRSECE+ F TG I IAGR+ VAAE+GKIKTTRVYAAGRI AGDG+C+GGEYTLLNQLV+GV+VIESYQVKLEK+Q YFDP+TQA+KKYPQC+AT  SC TGMSTIVYHADTR+CRLTLLKSAIFDEVQGQVH ETETNTQK A++ELRRTG+I  PTITT IGSE TPT V STD+ IGMRFIKGRMVSKCDEM+ S NYK IFLS   I N KA+IDPKDVKLYLY+NNKMDFLYH+GLASTEKIYYDL+KNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIA+LPENS  P
Sbjct: 1202 DIIRKVIEPFILTQGGWQAFINLVSKDDQTEMMQAKLKELLTEFETTINASDPKTARKGMNTIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGKLQTTATAVSYNVYQEVDFIKTEIKECSVTRKIVAFHCGHHSHSTIIEAGTETTVVSVTRSECEEGFTTGRISIAGRVNVAAEEGKIKTTRVYAAGRITAGDGTCQGGEYTLLNQLVKGVVVIESYQVKLEKYQGYFDPDTQAMKKYPQCLATDRSCNTGMSTIVYHADTRTCRLTLLKSAIFDEVQGQVHRETETNTQKSALDELRRTGRIGKPTITTTIGSEVTPTVVISTDTTIGMRFIKGRMVSKCDEMVASTNYKGIFLSRTAIPNAKAQIDPKDVKLYLYINNKMDFLYHKGLASTEKIYYDLVKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIAKLPENSTIP 1682          

HSP 2 Score: 278.87 bits (712), Expect = 0.000e+0
Identity = 135/171 (78.95%), Postives = 150/171 (87.72%), Query Frame = -3
Query: 3736 KGNGYMMEKRPRGQPKTNKPATEKKTKEQIQMDQLTTKLNKLSQITKQLQGKLTGQEQGAKWINKLIADMLGFSNPEAKINHKLSNIGTEAKQLWAIIKLIVTKIMDNKVRTKTKDPEELLLIINNLTKRSDDPNRYLVGIAYLMYNTITIYRKRTPNYNPNGYEFVITTL 4248
            K  G +MEK+ RG+ K +KPA E+KTKEQ+QMDQLTTKLNKLSQ+TKQLQGKL GQEQGAKWIN+LI DMLG +NPE K N KL+NIGTEAKQLWA IK I+ KIMDNK+RT TKDPEELLLIIN+LTKRSDDPNRYLVG+AYLMYNTI IYRKRTP YNPNGYEF IT +
Sbjct: 1033 KETGTVMEKKSRGRTKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLITDMLGLANPEIKRNLKLNNIGTEAKQLWAAIKPIINKIMDNKLRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIAIYRKRTPRYNPNGYEFAITDI 1203          

HSP 3 Score: 189.504 bits (480), Expect = 1.100e-111
Identity = 91/111 (81.98%), Postives = 98/111 (88.29%), Query Frame = -2
Query:  683 ESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGMDFMPERLKEIIIDLGSMELRDRTGRICTLKFEVRCSENIVVPGRTQMICYVKVDEETRGEIIFEQITNLRKRE 1015
            ESV+VIGKIWS IEYKNVKINTYLAVIR+LSADCIIG D MPE LKEIIIDLGSMELRD++GRIC LK EVRCSE IVVPGRTQMICYVKV+EETRGE+IFE      KR+
Sbjct: 2005 ESVAVIGKIWSIIEYKNVKINTYLAVIRRLSADCIIGTDLMPELLKEIIIDLGSMELRDKSGRICMLKSEVRCSEKIVVPGRTQMICYVKVNEETRGEMIFEPNHKFEKRK 2115          

HSP 4 Score: 169.088 bits (427), Expect = 1.100e-111
Identity = 83/107 (77.57%), Postives = 92/107 (85.98%), Query Frame = -3
Query: 1021 PVEQNTPITRPTTLRNIYPTLYEPNWAELVSRTSRRSKSVDQEVETQTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMHKIQGRLWPPIEETNMDVITC 1341
            PVE++ P  R TTLRNIYP  YEPNWA+LV RTS+RS+SVDQ+ ET+TIAMLQTLAGPTLT+PI+IN  EIKAMIDTGANIS IKM KI GRLWP IEE NMDVITC
Sbjct: 1896 PVERHVPTPRSTTLRNIYPVPYEPNWADLVPRTSQRSRSVDQDPETRTIAMLQTLAGPTLTVPIEINGVEIKAMIDTGANISAIKMDKIPGRLWPCIEEANMDVITC 2002          

HSP 5 Score: 64.3142 bits (155), Expect = 1.100e-111
Identity = 36/72 (50.00%), Postives = 53/72 (73.61%), Query Frame = -1
Query: 1428 GILTRMNGTDEEVGRNFKAIMKM*AERTRIKRQKTSNWKRWIDF-KXXXXXXXXXXNQRGTQKLTQGKLQQY 1640
             IL+ +     E GR FKAIM++ AE+TR+KRQKTSNW+RW++F  + S ++  ++NQ GTQ LTQ +L+Q+
Sbjct: 1792 AILSNIVTITGEAGRKFKAIMRLEAEKTRMKRQKTSNWRRWMNFKDDSSDNSDKDENQGGTQMLTQEQLKQW 1863          

HSP 6 Score: 46.2098 bits (108), Expect = 1.100e-111
Identity = 17/24 (70.83%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1352 WENQKTKLNEHYNHLPPAYECLKK 1423
            WEN+KT+ + HYNH PP YECLKK
Sbjct: 1863 WENRKTRHSGHYNHPPPVYECLKK 1886          

HSP 7 Score: 149.828 bits (377), Expect = 2.660e-64
Identity = 72/93 (77.42%), Postives = 80/93 (86.02%), Query Frame = -2
Query:  332 LTSITNNARAQWTNTHIVLTESVNRGLHQAARLEEQQRTILQLQRINEQLTNQVR*QAEEIRRLRIIQQGTEQRSWVEWISTTPEFTPEQDST 610
            +T ITNNA+ QWTNTH+VLTESVNRGL QA RLEEQQRTILQLQRINEQLT+QVR QA+EIRRLR  QQ  +  SWVEWI++ PEFTPE DST
Sbjct: 4021 MTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTILQLQRINEQLTDQVRWQADEIRRLRSNQQHVDPASWVEWIASMPEFTPEPDST 4113          

HSP 8 Score: 117.857 bits (294), Expect = 2.660e-64
Identity = 67/88 (76.14%), Postives = 76/88 (86.36%), Query Frame = -1
Query:    9 TISNQRIIVDMQTIIEKIRGSENPSEATRQIMKEKIRIINXXXXXXXXXXXXXXXXGTRQTRCGCRICTDCTIEVIETNIRTFPGCDE 272
            T SNQ+I VDMQTIIE+IRGSENPSE TR+IMKEKI+++N I+E+ KCCKCK LLIG RQT+CGCRICTDCTIEVIET     PGCDE
Sbjct: 4119 TSSNQKIFVDMQTIIERIRGSENPSETTRRIMKEKIKVVNDIKERQKCCKCKELLIGARQTKCGCRICTDCTIEVIETKTIKCPGCDE 4206          

HSP 9 Score: 213.772 bits (543), Expect = 6.710e-55
Identity = 102/121 (84.30%), Postives = 107/121 (88.43%), Query Frame = -1
Query: 1962 IPSDKCIN------KGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPLRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQKQAT*SNIVTIT 2306
            IP DKCIN      KGKIRFAQPVTRMINP KF+PNMFSCSNVYGPLFE RD SWLQFPTRVIVAP ++FGLTELASEAEFKPVDIS+SGIYQTKDLERAREHLLFP Q+QA  SNIVTIT
Sbjct: 1681 IPRDKCINELEIMHKGKIRFAQPVTRMINPEKFVPNMFSCSNVYGPLFEIRDGSWLQFPTRVIVAPPKIFGLTELASEAEFKPVDISQSGIYQTKDLERAREHLLFPAQRQAILSNIVTIT 1801          
BLAST of SMED30026417 vs. Planmine SMEST
Match: SMESG000066529.1 (SMESG000066529.1)

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 400/481 (83.16%), Postives = 436/481 (90.64%), Query Frame = -2
Query: 2300 DIIIKAIEPFILSQSGWQAFINLVSGDDQTDMMQTMLKELLKEFEIIINTSDPRTARKGMNAIITTILT*VMCIKGAEPFVVYDCNNIKIGDKYSLKETEECKAANPGRLQRTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXTRSECEKRFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVLVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTGMSTIVYHADTRSCRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRTGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIARLPENSRSP 3742
            DII K IEPFIL+Q GWQAFINLVS DDQT++MQT LKELL EFE  IN SDP+TARKGMNAIITTIL  +MC+KG EPFVVYDC+NIKIGDKYSLKETEECKAANPG+LQ TATAVSYNVYQEVDFIKTEI+EC+VTRKIVAFHC +HS STIIE GTETTVV+VTR+ECE+ F TG I IAGR+ VAAE+GKIKTTRVYAAGRI AGDG+C+GGEYTLLNQLV+GV+VIESYQVKLEK+Q YFDP+TQA+KKYPQC+AT  SC TGMSTIVYHADTR+CRLTLLKSAIFDEVQG+VHSETETNTQK A++ELRRTG+I  PTITT IGSE TPT V STD+ IGMRFIKGRMVSKCDEM+ S NYK IFLS   I N KA+I PKDVKLYLY+NNKMDFLYH+GLASTEKIYYDL+KNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIA+LPENS  P
Sbjct:  560 DIIRKVIEPFILTQGGWQAFINLVSKDDQTEIMQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGKLQTTATAVSYNVYQEVDFIKTEIKECSVTRKIVAFHCGHHSHSTIIEAGTETTVVSVTRNECEEGFTTGRISIAGRVNVAAEEGKIKTTRVYAAGRITAGDGTCQGGEYTLLNQLVKGVVVIESYQVKLEKYQGYFDPDTQAMKKYPQCLATDRSCNTGMSTIVYHADTRTCRLTLLKSAIFDEVQGRVHSETETNTQKSALDELRRTGRIGKPTITTTIGSEVTPTVVISTDTTIGMRFIKGRMVSKCDEMVASTNYKGIFLSRTAIPNAKAQIYPKDVKLYLYINNKMDFLYHKGLASTEKIYYDLVKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIAKLPENSTIP 1040          

HSP 2 Score: 355.14 bits (910), Expect = 0.000e+0
Identity = 190/300 (63.33%), Postives = 218/300 (72.67%), Query Frame = -1
Query: 1428 IPSDKCIN------KGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPLRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQKQAT*SNIVTITRGNNFGEKPNYELLLSPDHFQHATANMMKAMWGRFLIFGQMMAXXXXXXXXXXXXXXXLTQMLAYFDIYKRERKINWKMTLGFLPFLAKTMVLHGHSKDIHKIKRLVGILTRMNGTDEEVGRNFKAIMKM*AERTRIKRQKTSNWKRWIDFK-XXXXXXXXXXNQRGTQKLTQGKLQQY 2306
            IP DKCIN      KGKIRFAQPVTRMINP KF+PNMFSCSNVYGPLFE RD SWLQFPTRVIVAP ++FGLTELASEAEFKPVD+S+SGIYQTKDLERAREHLLFP Q+QA  SNIVT               +            +++      +I  QM+A                      FDIYKRERKINWKM +GFLPFLAKTMVLHGHSKDIHKIKRLVGILT+MNGTDEEVGR FKAIM++ AE+TR+KRQKTSNWKRWI+FK + S ++  ++NQ GT+ LTQ +L+Q+
Sbjct: 1039 IPRDKCINELEIMHKGKIRFAQPVTRMINPEKFVPNMFSCSNVYGPLFEIRDGSWLQFPTRVIVAPPKIFGLTELASEAEFKPVDVSQSGIYQTKDLERAREHLLFPAQRQAILSNIVT---------------ITGGILGIILIIQIVR------VILTQMLAC---------------------FDIYKRERKINWKMAIGFLPFLAKTMVLHGHSKDIHKIKRLVGILTKMNGTDEEVGRKFKAIMRLEAEKTRMKRQKTSNWKRWINFKDDSSDNSDNDENQGGTRMLTQEQLKQW 1296          

HSP 3 Score: 275.789 bits (704), Expect = 0.000e+0
Identity = 133/171 (77.78%), Postives = 148/171 (86.55%), Query Frame = -3
Query: 3736 KGNGYMMEKRPRGQPKTNKPATEKKTKEQIQMDQLTTKLNKLSQITKQLQGKLTGQEQGAKWINKLIADMLGFSNPEAKINHKLSNIGTEAKQLWAIIKLIVTKIMDNKVRTKTKDPEELLLIINNLTKRSDDPNRYLVGIAYLMYNTITIYRKRTPNYNPNGYEFVITTL 4248
            K  G + EK+PRG+PK +KPA E+KTKEQ+QMDQLTTKLNKLSQ+TKQLQGKL GQEQGAKWIN+LI DMLG +NPE K N KL+NIG EAKQLW  IK I+ KI+DNKVRT TKDPEELLLIIN+LTKR DDPNRYLVG+AYLMYNTI IYRKRTP YNPNGYEF IT +
Sbjct:  391 KETGTVTEKKPRGRPKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWTAIKPIINKIIDNKVRTTTKDPEELLLIINHLTKRFDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDI 561          

HSP 4 Score: 185.652 bits (470), Expect = 0.000e+0
Identity = 88/102 (86.27%), Postives = 94/102 (92.16%), Query Frame = -2
Query:  710 ESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGMDFMPERLKEIIIDLGSMELRDRTGRICTLKFEVRCSENIVVPGRTQMICYVKVDEETRGEIIFE 1015
            ESV+VIGKIWS IEYKNVKINTYLAVIR+LSADCIIG D MPE LKEIIIDLGSMELRD+TGRIC LK E+RCSE IVVPGRTQMICYVKV+ ETRGE+IFE
Sbjct: 1438 ESVAVIGKIWSIIEYKNVKINTYLAVIRRLSADCIIGTDLMPELLKEIIIDLGSMELRDKTGRICMLKSELRCSEKIVVPGRTQMICYVKVNGETRGEMIFE 1539          

HSP 5 Score: 174.481 bits (441), Expect = 0.000e+0
Identity = 85/107 (79.44%), Postives = 94/107 (87.85%), Query Frame = -3
Query: 1021 PVEQNTPITRPTTLRNIYPTLYEPNWAELVSRTSRRSKSVDQEVETQTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMHKIQGRLWPPIEETNMDVITC 1341
            PV++  PI RPTTLRNIYP  YEPNWA+LVSRTS+RS+SVDQ+ ET+TIAMLQTLAGPTLT+PI+IN  EIKAMIDTGANIS IKM KI GRLWP IEE NMDVITC
Sbjct: 1329 PVDRQVPIPRPTTLRNIYPVPYEPNWADLVSRTSQRSRSVDQDPETRTIAMLQTLAGPTLTVPIEINGVEIKAMIDTGANISAIKMDKIPGRLWPCIEEANMDVITC 1435          

HSP 6 Score: 46.2098 bits (108), Expect = 0.000e+0
Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1352 SWENQKTKLNEHYNHLPPAYECLKK 1426
             WEN+KT+ + HYNH PP YECLKK
Sbjct: 1295 QWENRKTRHSGHYNHPPPVYECLKK 1319          

HSP 7 Score: 312.768 bits (800), Expect = 1.961e-115
Identity = 175/286 (61.19%), Postives = 213/286 (74.48%), Query Frame = -2
Query: 4313 RYLPTDIDDSVEEELTRLTETQKCRELAAILRTGAKNQR*TVTDLTKWIIESCNRI*NLRNTVKEIEEYIKV-CFVP*TI*RNHQEIETCRLGS*NYREERFKNHDTRFRTNRKGFYITVKVSEVKKRISYELLFHLQHEGRSLDDDIKIGVTPLQLGVINVLTVTKIEGRELNKREIKSKTLIGREESLNTPEIPLATDEITII-TGDEKILNDLNDIVNEEPTRKIPESRDLFXXXXXXXXXXXXXDGFVCAQKQQAETVEPNT--EKKERRKEDAESQQETNW 5158
            +YLPTDIDD VEE LTRLTETQKCRELAAILRTGAKNQR TVTDL KWII+SC+R+ NLRN VKEIEEY ++  + P       ++ +     +    +   K     F    + FYIT KVSEVKKRI YE  FHLQ+EGRSLDDD++IGVT +QLG+IN+LTV KI GRELNKREIK+KT IGR+ESLNTPE+P A DE+ +I TGDE+ILNDLNDIV+EE TR+IPESRDLF T++END+ TD+ D  VC Q+Q  E +EP+T  EKK + +  +   +  NW
Sbjct:   86 KYLPTDIDDPVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTDLAKWIIDSCSRVENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYSLKIMTPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYEGRSLDDDLEIGVTQMQLGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEEKTRRIPESRDLFMTEDENDLITDEPDELVCGQRQPVEIIEPDTEEEKKGKGRRSSTGDEWDNW 371          

HSP 8 Score: 93.2041 bits (230), Expect = 1.961e-115
Identity = 47/66 (71.21%), Postives = 56/66 (84.85%), Query Frame = -1
Query: 5160 KPRSTQNVVGGMPQFLLKKYGT*ETSPFVKNDAIYITIEVETVKEMKILVQKEEARPRINVLEKRI 5357
            KP+ST+NV GG+P+FLLKKY T     FVK+D IYITIEVET +EMKI +Q+E+ARPRINVLEKRI
Sbjct:   20 KPKSTENVAGGVPRFLLKKYVT---PQFVKDDTIYITIEVETEREMKIRIQQEQARPRINVLEKRI 82          

HSP 9 Score: 54.299 bits (129), Expect = 1.961e-115
Identity = 26/33 (78.79%), Postives = 27/33 (81.82%), Query Frame = -1
Query: 4233 STGDELDNRIKECGATTSRNTTDEQPKRKETDT 4331
            STGDE DN I E GATTS+ TTDEQPKRKET T
Sbjct:  363 STGDEWDNWINERGATTSKETTDEQPKRKETGT 395          

HSP 10 Score: 145.591 bits (366), Expect = 1.677e-59
Identity = 71/96 (73.96%), Postives = 81/96 (84.38%), Query Frame = -2
Query:  332 CKL-TSITNNARAQWTNTHIVLTESVNRGLHQAARLEEQQRTILQLQRINEQLTNQVR*QAEEIRRLRIIQQGTEQRSWVEWISTTPEFTPEQDST 616
            C+L T ITNNA+ QWTNTH+VLTESVNRGL QA RLEEQQRTI+QLQR+NEQL +QVR QA+EIRRLR  QQ  +  SWVEWI++ PEFTPE DST
Sbjct: 3276 CELMTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTIIQLQRMNEQLADQVRWQADEIRRLRNNQQHVDPASWVEWIASMPEFTPEPDST 3371          

HSP 11 Score: 106.301 bits (264), Expect = 1.677e-59
Identity = 62/81 (76.54%), Postives = 70/81 (86.42%), Query Frame = -1
Query:    3 DMQTIIEKIRGSENPSEATRQIMKEKIRIINXXXXXXXXXXXXXXXXGTRQTRCGCRICTDCTIEVIETNIRTFPGCDETF 245
            D  TIIE+IRGSENPSE TR+IMKEKI+++N I+E+LKCCKCK LLIG RQT+CGCRICTDCTIEVIET     PGCDETF
Sbjct: 3369 DSTTIIERIRGSENPSETTRRIMKEKIKVVNDIKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETETIKCPGCDETF 3449          
BLAST of SMED30026417 vs. Planmine SMEST
Match: SMESG000066529.1 (SMESG000066529.1)

HSP 1 Score: 808.905 bits (2088), Expect = 0.000e+0
Identity = 400/481 (83.16%), Postives = 436/481 (90.64%), Query Frame = -2
Query: 2300 DIIIKAIEPFILSQSGWQAFINLVSGDDQTDMMQTMLKELLKEFEIIINTSDPRTARKGMNAIITTILT*VMCIKGAEPFVVYDCNNIKIGDKYSLKETEECKAANPGRLQRTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXTRSECEKRFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVLVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTGMSTIVYHADTRSCRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRTGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIARLPENSRSP 3742
            DII K IEPFIL+Q GWQAFINLVS DDQT++MQT LKELL EFE  IN SDP+TARKGMNAIITTIL  +MC+KG EPFVVYDC+NIKIGDKYSLKETEECKAANPG+LQ TATAVSYNVYQEVDFIKTEI+EC+VTRKIVAFHC +HS STIIE GTETTVV+VTR+ECE+ F TG I IAGR+ VAAE+GKIKTTRVYAAGRI AGDG+C+GGEYTLLNQLV+GV+VIESYQVKLEK+Q YFDP+TQA+KKYPQC+AT  SC TGMSTIVYHADTR+CRLTLLKSAIFDEVQG+VHSETETNTQK A++ELRRTG+I  PTITT IGSE TPT V STD+ IGMRFIKGRMVSKCDEM+ S NYK IFLS   I N KA+I PKDVKLYLY+NNKMDFLYH+GLASTEKIYYDL+KNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIA+LPENS  P
Sbjct:  560 DIIRKVIEPFILTQGGWQAFINLVSKDDQTEIMQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGKLQTTATAVSYNVYQEVDFIKTEIKECSVTRKIVAFHCGHHSHSTIIEAGTETTVVSVTRNECEEGFTTGRISIAGRVNVAAEEGKIKTTRVYAAGRITAGDGTCQGGEYTLLNQLVKGVVVIESYQVKLEKYQGYFDPDTQAMKKYPQCLATDRSCNTGMSTIVYHADTRTCRLTLLKSAIFDEVQGRVHSETETNTQKSALDELRRTGRIGKPTITTTIGSEVTPTVVISTDTTIGMRFIKGRMVSKCDEMVASTNYKGIFLSRTAIPNAKAQIYPKDVKLYLYINNKMDFLYHKGLASTEKIYYDLVKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIAKLPENSTIP 1040          

HSP 2 Score: 355.14 bits (910), Expect = 0.000e+0
Identity = 190/300 (63.33%), Postives = 218/300 (72.67%), Query Frame = -1
Query: 1428 IPSDKCIN------KGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPLRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQKQAT*SNIVTITRGNNFGEKPNYELLLSPDHFQHATANMMKAMWGRFLIFGQMMAXXXXXXXXXXXXXXXLTQMLAYFDIYKRERKINWKMTLGFLPFLAKTMVLHGHSKDIHKIKRLVGILTRMNGTDEEVGRNFKAIMKM*AERTRIKRQKTSNWKRWIDFK-XXXXXXXXXXNQRGTQKLTQGKLQQY 2306
            IP DKCIN      KGKIRFAQPVTRMINP KF+PNMFSCSNVYGPLFE RD SWLQFPTRVIVAP ++FGLTELASEAEFKPVD+S+SGIYQTKDLERAREHLLFP Q+QA  SNIVT               +            +++      +I  QM+A                      FDIYKRERKINWKM +GFLPFLAKTMVLHGHSKDIHKIKRLVGILT+MNGTDEEVGR FKAIM++ AE+TR+KRQKTSNWKRWI+FK + S ++  ++NQ GT+ LTQ +L+Q+
Sbjct: 1039 IPRDKCINELEIMHKGKIRFAQPVTRMINPEKFVPNMFSCSNVYGPLFEIRDGSWLQFPTRVIVAPPKIFGLTELASEAEFKPVDVSQSGIYQTKDLERAREHLLFPAQRQAILSNIVT---------------ITGGILGIILIIQIVR------VILTQMLAC---------------------FDIYKRERKINWKMAIGFLPFLAKTMVLHGHSKDIHKIKRLVGILTKMNGTDEEVGRKFKAIMRLEAEKTRMKRQKTSNWKRWINFKDDSSDNSDNDENQGGTRMLTQEQLKQW 1296          

HSP 3 Score: 275.789 bits (704), Expect = 0.000e+0
Identity = 133/171 (77.78%), Postives = 148/171 (86.55%), Query Frame = -3
Query: 3736 KGNGYMMEKRPRGQPKTNKPATEKKTKEQIQMDQLTTKLNKLSQITKQLQGKLTGQEQGAKWINKLIADMLGFSNPEAKINHKLSNIGTEAKQLWAIIKLIVTKIMDNKVRTKTKDPEELLLIINNLTKRSDDPNRYLVGIAYLMYNTITIYRKRTPNYNPNGYEFVITTL 4248
            K  G + EK+PRG+PK +KPA E+KTKEQ+QMDQLTTKLNKLSQ+TKQLQGKL GQEQGAKWIN+LI DMLG +NPE K N KL+NIG EAKQLW  IK I+ KI+DNKVRT TKDPEELLLIIN+LTKR DDPNRYLVG+AYLMYNTI IYRKRTP YNPNGYEF IT +
Sbjct:  391 KETGTVTEKKPRGRPKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWTAIKPIINKIIDNKVRTTTKDPEELLLIINHLTKRFDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDI 561          

HSP 4 Score: 185.652 bits (470), Expect = 0.000e+0
Identity = 88/102 (86.27%), Postives = 94/102 (92.16%), Query Frame = -2
Query:  710 ESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGMDFMPERLKEIIIDLGSMELRDRTGRICTLKFEVRCSENIVVPGRTQMICYVKVDEETRGEIIFE 1015
            ESV+VIGKIWS IEYKNVKINTYLAVIR+LSADCIIG D MPE LKEIIIDLGSMELRD+TGRIC LK E+RCSE IVVPGRTQMICYVKV+ ETRGE+IFE
Sbjct: 1438 ESVAVIGKIWSIIEYKNVKINTYLAVIRRLSADCIIGTDLMPELLKEIIIDLGSMELRDKTGRICMLKSELRCSEKIVVPGRTQMICYVKVNGETRGEMIFE 1539          

HSP 5 Score: 174.481 bits (441), Expect = 0.000e+0
Identity = 85/107 (79.44%), Postives = 94/107 (87.85%), Query Frame = -3
Query: 1021 PVEQNTPITRPTTLRNIYPTLYEPNWAELVSRTSRRSKSVDQEVETQTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMHKIQGRLWPPIEETNMDVITC 1341
            PV++  PI RPTTLRNIYP  YEPNWA+LVSRTS+RS+SVDQ+ ET+TIAMLQTLAGPTLT+PI+IN  EIKAMIDTGANIS IKM KI GRLWP IEE NMDVITC
Sbjct: 1329 PVDRQVPIPRPTTLRNIYPVPYEPNWADLVSRTSQRSRSVDQDPETRTIAMLQTLAGPTLTVPIEINGVEIKAMIDTGANISAIKMDKIPGRLWPCIEEANMDVITC 1435          

HSP 6 Score: 46.2098 bits (108), Expect = 0.000e+0
Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1352 SWENQKTKLNEHYNHLPPAYECLKK 1426
             WEN+KT+ + HYNH PP YECLKK
Sbjct: 1295 QWENRKTRHSGHYNHPPPVYECLKK 1319          

HSP 7 Score: 312.768 bits (800), Expect = 1.913e-115
Identity = 175/286 (61.19%), Postives = 213/286 (74.48%), Query Frame = -2
Query: 4313 RYLPTDIDDSVEEELTRLTETQKCRELAAILRTGAKNQR*TVTDLTKWIIESCNRI*NLRNTVKEIEEYIKV-CFVP*TI*RNHQEIETCRLGS*NYREERFKNHDTRFRTNRKGFYITVKVSEVKKRISYELLFHLQHEGRSLDDDIKIGVTPLQLGVINVLTVTKIEGRELNKREIKSKTLIGREESLNTPEIPLATDEITII-TGDEKILNDLNDIVNEEPTRKIPESRDLFXXXXXXXXXXXXXDGFVCAQKQQAETVEPNT--EKKERRKEDAESQQETNW 5158
            +YLPTDIDD VEE LTRLTETQKCRELAAILRTGAKNQR TVTDL KWII+SC+R+ NLRN VKEIEEY ++  + P       ++ +     +    +   K     F    + FYIT KVSEVKKRI YE  FHLQ+EGRSLDDD++IGVT +QLG+IN+LTV KI GRELNKREIK+KT IGR+ESLNTPE+P A DE+ +I TGDE+ILNDLNDIV+EE TR+IPESRDLF T++END+ TD+ D  VC Q+Q  E +EP+T  EKK + +  +   +  NW
Sbjct:   86 KYLPTDIDDPVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTDLAKWIIDSCSRVENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYSLKIMTPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYEGRSLDDDLEIGVTQMQLGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEEKTRRIPESRDLFMTEDENDLITDEPDELVCGQRQPVEIIEPDTEEEKKGKGRRSSTGDEWDNW 371          

HSP 8 Score: 93.2041 bits (230), Expect = 1.913e-115
Identity = 47/66 (71.21%), Postives = 56/66 (84.85%), Query Frame = -1
Query: 5160 KPRSTQNVVGGMPQFLLKKYGT*ETSPFVKNDAIYITIEVETVKEMKILVQKEEARPRINVLEKRI 5357
            KP+ST+NV GG+P+FLLKKY T     FVK+D IYITIEVET +EMKI +Q+E+ARPRINVLEKRI
Sbjct:   20 KPKSTENVAGGVPRFLLKKYVT---PQFVKDDTIYITIEVETEREMKIRIQQEQARPRINVLEKRI 82          

HSP 9 Score: 54.299 bits (129), Expect = 1.913e-115
Identity = 26/33 (78.79%), Postives = 27/33 (81.82%), Query Frame = -1
Query: 4233 STGDELDNRIKECGATTSRNTTDEQPKRKETDT 4331
            STGDE DN I E GATTS+ TTDEQPKRKET T
Sbjct:  363 STGDEWDNWINERGATTSKETTDEQPKRKETGT 395          

HSP 10 Score: 113.235 bits (282), Expect = 2.119e-24
Identity = 65/82 (79.27%), Postives = 73/82 (89.02%), Query Frame = -1
Query:    3 VDMQTIIEKIRGSENPSEATRQIMKEKIRIINXXXXXXXXXXXXXXXXGTRQTRCGCRICTDCTIEVIETNIRTFPGCDETF 248
            VDMQTIIE+IRGSENPSE TR+IMKEKI+++N I+E+LKCCKCK LLIG RQT+CGCRICTDCTIEVIET     PGCDETF
Sbjct: 3364 VDMQTIIERIRGSENPSETTRRIMKEKIKVVNDIKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETETIKCPGCDETF 3445          

HSP 11 Score: 110.923 bits (276), Expect = 9.133e-24
Identity = 56/72 (77.78%), Postives = 63/72 (87.50%), Query Frame = -2
Query:  404 CKL-TSITNNARAQWTNTHIVLTESVNRGLHQAARLEEQQRTILQLQRINEQLTNQVR*QAEEIRRLRIIQQ 616
            C+L T ITNNA+ QWTNTH+VLTESVNRGL QA RLEEQQRTI+QLQR+NEQL +QVR QA+EIRRLR  QQ
Sbjct: 3276 CELMTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTIIQLQRMNEQLADQVRWQADEIRRLRNNQQ 3347          
BLAST of SMED30026417 vs. Planmine SMEST
Match: SMESG000066529.1 (SMESG000066529.1)

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 400/481 (83.16%), Postives = 436/481 (90.64%), Query Frame = -2
Query: 2300 DIIIKAIEPFILSQSGWQAFINLVSGDDQTDMMQTMLKELLKEFEIIINTSDPRTARKGMNAIITTILT*VMCIKGAEPFVVYDCNNIKIGDKYSLKETEECKAANPGRLQRTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXTRSECEKRFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVLVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTGMSTIVYHADTRSCRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRTGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIARLPENSRSP 3742
            DII K IEPFIL+Q GWQAFINLVS DDQT++MQT LKELL EFE  IN SDP+TARKGMNAIITTIL  +MC+KG EPFVVYDC+NIKIGDKYSLKETEECKAANPG+LQ TATAVSYNVYQEVDFIKTEI+EC+VTRKIVAFHC +HS STIIE GTETTVV+VTR+ECE+ F TG I IAGR+ VAAE+GKIKTTRVYAAGRI AGDG+C+GGEYTLLNQLV+GV+VIESYQVKLEK+Q YFDP+TQA+KKYPQC+AT  SC TGMSTIVYHADTR+CRLTLLKSAIFDEVQG+VHSETETNTQK A++ELRRTG+I  PTITT IGSE TPT V STD+ IGMRFIKGRMVSKCDEM+ S NYK IFLS   I N KA+I PKDVKLYLY+NNKMDFLYH+GLASTEKIYYDL+KNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIA+LPENS  P
Sbjct:  560 DIIRKVIEPFILTQGGWQAFINLVSKDDQTEIMQTKLKELLTEFETTINASDPKTARKGMNAIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGKLQTTATAVSYNVYQEVDFIKTEIKECSVTRKIVAFHCGHHSHSTIIEAGTETTVVSVTRNECEEGFTTGRISIAGRVNVAAEEGKIKTTRVYAAGRITAGDGTCQGGEYTLLNQLVKGVVVIESYQVKLEKYQGYFDPDTQAMKKYPQCLATDRSCNTGMSTIVYHADTRTCRLTLLKSAIFDEVQGRVHSETETNTQKSALDELRRTGRIGKPTITTTIGSEVTPTVVISTDTTIGMRFIKGRMVSKCDEMVASTNYKGIFLSRTAIPNAKAQIYPKDVKLYLYINNKMDFLYHKGLASTEKIYYDLVKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIAKLPENSTIP 1040          

HSP 2 Score: 330.102 bits (845), Expect = 0.000e+0
Identity = 181/300 (60.33%), Postives = 205/300 (68.33%), Query Frame = -1
Query: 1428 IPSDKCIN------KGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPLRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQKQAT*SNIVTITRGNNFGEKPNYELLLSPDHFQHATANMMKAMWGRFLIFGQMMAXXXXXXXXXXXXXXXLTQMLAYFDIYKRERKINWKMTLGFLPFLAKTMVLHGHSKDIHKIKRLVGILTRMNGTDEEVGRNFKAIMKM*AERTRIKRQKTSNWKRWIDFK-XXXXXXXXXXNQRGTQKLTQGKLQQY 2306
            IP DKCIN      KGKIRFAQPVTRMINP KF+PNMFSCSNVYGPLFE RD SWLQFPTRVIVAP ++FGLTELASEAEFKPVD+S+SGIYQTKDLERAR                               E LL P   Q   +N++        I G                        A FDIYKRERKINWKM +GFLPFLAKTMVLHGHSKDIHKIKRLVGILT+MNGTDEEVGR FKAIM++ AE+TR+KRQKTSNWKRWI+FK + S ++  ++NQ GT+ LTQ +L+Q+
Sbjct: 1039 IPRDKCINELEIMHKGKIRFAQPVTRMINPEKFVPNMFSCSNVYGPLFEIRDGSWLQFPTRVIVAPPKIFGLTELASEAEFKPVDVSQSGIYQTKDLERAR-------------------------------EHLLFPAQRQAILSNIV-------TITG------------------------ACFDIYKRERKINWKMAIGFLPFLAKTMVLHGHSKDIHKIKRLVGILTKMNGTDEEVGRKFKAIMRLEAEKTRMKRQKTSNWKRWINFKDDSSDNSDNDENQGGTRMLTQEQLKQW 1276          

HSP 3 Score: 275.789 bits (704), Expect = 0.000e+0
Identity = 133/171 (77.78%), Postives = 148/171 (86.55%), Query Frame = -3
Query: 3736 KGNGYMMEKRPRGQPKTNKPATEKKTKEQIQMDQLTTKLNKLSQITKQLQGKLTGQEQGAKWINKLIADMLGFSNPEAKINHKLSNIGTEAKQLWAIIKLIVTKIMDNKVRTKTKDPEELLLIINNLTKRSDDPNRYLVGIAYLMYNTITIYRKRTPNYNPNGYEFVITTL 4248
            K  G + EK+PRG+PK +KPA E+KTKEQ+QMDQLTTKLNKLSQ+TKQLQGKL GQEQGAKWIN+LI DMLG +NPE K N KL+NIG EAKQLW  IK I+ KI+DNKVRT TKDPEELLLIIN+LTKR DDPNRYLVG+AYLMYNTI IYRKRTP YNPNGYEF IT +
Sbjct:  391 KETGTVTEKKPRGRPKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLITDMLGLANPEIKRNLKLNNIGAEAKQLWTAIKPIINKIIDNKVRTTTKDPEELLLIINHLTKRFDDPNRYLVGMAYLMYNTIVIYRKRTPRYNPNGYEFAITDI 561          

HSP 4 Score: 185.652 bits (470), Expect = 0.000e+0
Identity = 88/102 (86.27%), Postives = 94/102 (92.16%), Query Frame = -2
Query:  710 ESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGMDFMPERLKEIIIDLGSMELRDRTGRICTLKFEVRCSENIVVPGRTQMICYVKVDEETRGEIIFE 1015
            ESV+VIGKIWS IEYKNVKINTYLAVIR+LSADCIIG D MPE LKEIIIDLGSMELRD+TGRIC LK E+RCSE IVVPGRTQMICYVKV+ ETRGE+IFE
Sbjct: 1418 ESVAVIGKIWSIIEYKNVKINTYLAVIRRLSADCIIGTDLMPELLKEIIIDLGSMELRDKTGRICMLKSELRCSEKIVVPGRTQMICYVKVNGETRGEMIFE 1519          

HSP 5 Score: 174.481 bits (441), Expect = 0.000e+0
Identity = 85/107 (79.44%), Postives = 94/107 (87.85%), Query Frame = -3
Query: 1021 PVEQNTPITRPTTLRNIYPTLYEPNWAELVSRTSRRSKSVDQEVETQTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMHKIQGRLWPPIEETNMDVITC 1341
            PV++  PI RPTTLRNIYP  YEPNWA+LVSRTS+RS+SVDQ+ ET+TIAMLQTLAGPTLT+PI+IN  EIKAMIDTGANIS IKM KI GRLWP IEE NMDVITC
Sbjct: 1309 PVDRQVPIPRPTTLRNIYPVPYEPNWADLVSRTSQRSRSVDQDPETRTIAMLQTLAGPTLTVPIEINGVEIKAMIDTGANISAIKMDKIPGRLWPCIEEANMDVITC 1415          

HSP 6 Score: 46.2098 bits (108), Expect = 0.000e+0
Identity = 17/25 (68.00%), Postives = 20/25 (80.00%), Query Frame = -2
Query: 1352 SWENQKTKLNEHYNHLPPAYECLKK 1426
             WEN+KT+ + HYNH PP YECLKK
Sbjct: 1275 QWENRKTRHSGHYNHPPPVYECLKK 1299          

HSP 7 Score: 312.768 bits (800), Expect = 2.202e-115
Identity = 175/286 (61.19%), Postives = 213/286 (74.48%), Query Frame = -2
Query: 4313 RYLPTDIDDSVEEELTRLTETQKCRELAAILRTGAKNQR*TVTDLTKWIIESCNRI*NLRNTVKEIEEYIKV-CFVP*TI*RNHQEIETCRLGS*NYREERFKNHDTRFRTNRKGFYITVKVSEVKKRISYELLFHLQHEGRSLDDDIKIGVTPLQLGVINVLTVTKIEGRELNKREIKSKTLIGREESLNTPEIPLATDEITII-TGDEKILNDLNDIVNEEPTRKIPESRDLFXXXXXXXXXXXXXDGFVCAQKQQAETVEPNT--EKKERRKEDAESQQETNW 5158
            +YLPTDIDD VEE LTRLTETQKCRELAAILRTGAKNQR TVTDL KWII+SC+R+ NLRN VKEIEEY ++  + P       ++ +     +    +   K     F    + FYIT KVSEVKKRI YE  FHLQ+EGRSLDDD++IGVT +QLG+IN+LTV KI GRELNKREIK+KT IGR+ESLNTPE+P A DE+ +I TGDE+ILNDLNDIV+EE TR+IPESRDLF T++END+ TD+ D  VC Q+Q  E +EP+T  EKK + +  +   +  NW
Sbjct:   86 KYLPTDIDDPVEEGLTRLTETQKCRELAAILRTGAKNQRRTVTDLAKWIIDSCSRVENLRNIVKEIEEYRRMYAWYPEQFREIIRKWKHTEWAAETIEKYSLKIMTPDFEPIEREFYITAKVSEVKKRIPYEPPFHLQYEGRSLDDDLEIGVTQMQLGLINILTVAKIAGRELNKREIKTKTPIGRQESLNTPEVPPAADEVIVITTGDEEILNDLNDIVDEEKTRRIPESRDLFMTEDENDLITDEPDELVCGQRQPVEIIEPDTEEEKKGKGRRSSTGDEWDNW 371          

HSP 8 Score: 93.2041 bits (230), Expect = 2.202e-115
Identity = 47/66 (71.21%), Postives = 56/66 (84.85%), Query Frame = -1
Query: 5160 KPRSTQNVVGGMPQFLLKKYGT*ETSPFVKNDAIYITIEVETVKEMKILVQKEEARPRINVLEKRI 5357
            KP+ST+NV GG+P+FLLKKY T     FVK+D IYITIEVET +EMKI +Q+E+ARPRINVLEKRI
Sbjct:   20 KPKSTENVAGGVPRFLLKKYVT---PQFVKDDTIYITIEVETEREMKIRIQQEQARPRINVLEKRI 82          

HSP 9 Score: 53.9138 bits (128), Expect = 2.202e-115
Identity = 26/33 (78.79%), Postives = 27/33 (81.82%), Query Frame = -1
Query: 4233 STGDELDNRIKECGATTSRNTTDEQPKRKETDT 4331
            STGDE DN I E GATTS+ TTDEQPKRKET T
Sbjct:  363 STGDEWDNWINERGATTSKETTDEQPKRKETGT 395          

HSP 10 Score: 113.235 bits (282), Expect = 2.082e-24
Identity = 65/82 (79.27%), Postives = 73/82 (89.02%), Query Frame = -1
Query:    3 VDMQTIIEKIRGSENPSEATRQIMKEKIRIINXXXXXXXXXXXXXXXXGTRQTRCGCRICTDCTIEVIETNIRTFPGCDETF 248
            VDMQTIIE+IRGSENPSE TR+IMKEKI+++N I+E+LKCCKCK LLIG RQT+CGCRICTDCTIEVIET     PGCDETF
Sbjct: 3344 VDMQTIIERIRGSENPSETTRRIMKEKIKVVNDIKERLKCCKCKELLIGARQTKCGCRICTDCTIEVIETETIKCPGCDETF 3425          

HSP 11 Score: 110.923 bits (276), Expect = 9.600e-24
Identity = 56/72 (77.78%), Postives = 63/72 (87.50%), Query Frame = -2
Query:  404 CKL-TSITNNARAQWTNTHIVLTESVNRGLHQAARLEEQQRTILQLQRINEQLTNQVR*QAEEIRRLRIIQQ 616
            C+L T ITNNA+ QWTNTH+VLTESVNRGL QA RLEEQQRTI+QLQR+NEQL +QVR QA+EIRRLR  QQ
Sbjct: 3256 CELMTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTIIQLQRMNEQLADQVRWQADEIRRLRNNQQ 3327          
BLAST of SMED30026417 vs. Planmine SMEST
Match: SMESG000053822.1 (SMESG000053822.1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 401/481 (83.37%), Postives = 434/481 (90.23%), Query Frame = -2
Query: 2300 DIIIKAIEPFILSQSGWQAFINLVSGDDQTDMMQTMLKELLKEFEIIINTSDPRTARKGMNAIITTILT*VMCIKGAEPFVVYDCNNIKIGDKYSLKETEECKAANPGRLQRTATAVSYNVYQEVDFIKTEIRECTVTRKIVAFHCRNHSQSXXXXXXXXXXXXXXTRSECEKRFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLLNQLVRGVLVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTGMSTIVYHADTRSCRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRTGQIRNPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIFLS*ITISNVKAKIDPKDVKLYLYMNNKMDFLYHRGLASTEKIYYDLIKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIARLPENSRSP 3742
            DII K IEPFIL+Q GWQAFINLVS DDQT+MMQ  LKELL EFE  IN SDP+TARKGMN IITTIL  +MC+KG EPFVVYDC+NIKIGDKYSLKETEECKAANPG+LQ TATAVSYNVYQEVDFIKTEI+EC+VTRKIVAFHC +HS STIIE GTETTVV+VTRSECE+ F TG I IAGR+ VAAE+GKIKTTRVYAAGRI AGDG+C+GGEYTLLNQLV+GV+VIESYQVKLEK+Q YFDP+TQA+KKYPQC+AT  SC TGMSTIVYHADTR+CRLTLLKSAIFDEVQGQVH ETETNTQK A++ELRRTG+I  PTITT IGSE TPT V STD+ IGMRFIKGRMVSKCDEM+ S NYK IFLS   I N KA+IDPKDVKLYLY+NNKMDFLYH+GLASTEKIYYDL+KNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIA+LPENS  P
Sbjct: 1208 DIIRKVIEPFILTQGGWQAFINLVSKDDQTEMMQAKLKELLTEFETTINASDPKTARKGMNTIITTILIWMMCVKGVEPFVVYDCDNIKIGDKYSLKETEECKAANPGKLQTTATAVSYNVYQEVDFIKTEIKECSVTRKIVAFHCGHHSHSTIIEAGTETTVVSVTRSECEEGFTTGRISIAGRVNVAAEEGKIKTTRVYAAGRITAGDGTCQGGEYTLLNQLVKGVVVIESYQVKLEKYQGYFDPDTQAMKKYPQCLATDRSCNTGMSTIVYHADTRTCRLTLLKSAIFDEVQGQVHRETETNTQKSALDELRRTGRIGKPTITTTIGSEVTPTVVISTDTTIGMRFIKGRMVSKCDEMVASTNYKGIFLSRTAIPNAKAQIDPKDVKLYLYINNKMDFLYHKGLASTEKIYYDLVKNDCILNREILKTKLAMAITNPDNAIPLLPLQEGYFGRIVGEVMYTYKCEKTIAKLPENSTIP 1688          

HSP 2 Score: 278.1 bits (710), Expect = 0.000e+0
Identity = 135/171 (78.95%), Postives = 150/171 (87.72%), Query Frame = -3
Query: 3736 KGNGYMMEKRPRGQPKTNKPATEKKTKEQIQMDQLTTKLNKLSQITKQLQGKLTGQEQGAKWINKLIADMLGFSNPEAKINHKLSNIGTEAKQLWAIIKLIVTKIMDNKVRTKTKDPEELLLIINNLTKRSDDPNRYLVGIAYLMYNTITIYRKRTPNYNPNGYEFVITTL 4248
            K  G +MEK+ RG+ K +KPA E+KTKEQ+QMDQLTTKLNKLSQ+TKQLQGKL GQEQGAKWIN+LI DMLG +NPE K N KL+NIGTEAKQLWA IK I+ KIMDNK+RT TKDPEELLLIIN+LTKRSDDPNRYLVG+AYLMYNTI IYRKRTP YNPNGYEF IT +
Sbjct: 1039 KETGTVMEKKSRGRTKIDKPAPERKTKEQMQMDQLTTKLNKLSQVTKQLQGKLKGQEQGAKWINRLITDMLGLANPEIKRNLKLNNIGTEAKQLWAAIKPIINKIMDNKLRTTTKDPEELLLIINHLTKRSDDPNRYLVGMAYLMYNTIAIYRKRTPRYNPNGYEFAITDI 1209          

HSP 3 Score: 189.119 bits (479), Expect = 7.483e-112
Identity = 91/111 (81.98%), Postives = 98/111 (88.29%), Query Frame = -2
Query:  683 ESVSVIGKIWSTIEYKNVKINTYLAVIRKLSADCIIGMDFMPERLKEIIIDLGSMELRDRTGRICTLKFEVRCSENIVVPGRTQMICYVKVDEETRGEIIFEQITNLRKRE 1015
            ESV+VIGKIWS IEYKNVKINTYLAVIR+LSADCIIG D MPE LKEIIIDLGSMELRD++GRIC LK EVRCSE IVVPGRTQMICYVKV+EETRGE+IFE      KR+
Sbjct: 2011 ESVAVIGKIWSIIEYKNVKINTYLAVIRRLSADCIIGTDLMPELLKEIIIDLGSMELRDKSGRICMLKSEVRCSEKIVVPGRTQMICYVKVNEETRGEMIFEPNHKFEKRK 2121          

HSP 4 Score: 169.088 bits (427), Expect = 7.483e-112
Identity = 83/107 (77.57%), Postives = 92/107 (85.98%), Query Frame = -3
Query: 1021 PVEQNTPITRPTTLRNIYPTLYEPNWAELVSRTSRRSKSVDQEVETQTIAMLQTLAGPTLTIPIDINEFEIKAMIDTGANISEIKMHKIQGRLWPPIEETNMDVITC 1341
            PVE++ P  R TTLRNIYP  YEPNWA+LV RTS+RS+SVDQ+ ET+TIAMLQTLAGPTLT+PI+IN  EIKAMIDTGANIS IKM KI GRLWP IEE NMDVITC
Sbjct: 1902 PVERHVPTPRSTTLRNIYPVPYEPNWADLVPRTSQRSRSVDQDPETRTIAMLQTLAGPTLTVPIEINGVEIKAMIDTGANISAIKMDKIPGRLWPCIEEANMDVITC 2008          

HSP 5 Score: 65.0846 bits (157), Expect = 7.483e-112
Identity = 36/72 (50.00%), Postives = 53/72 (73.61%), Query Frame = -1
Query: 1428 GILTRMNGTDEEVGRNFKAIMKM*AERTRIKRQKTSNWKRWIDF-KXXXXXXXXXXNQRGTQKLTQGKLQQY 1640
             IL+ +     E GR FKAIM++ AE+TR+KRQKTSNW+RW++F  + S ++  ++NQ GTQ LTQ +L+Q+
Sbjct: 1798 AILSNIVTITGEAGRKFKAIMRLEAEKTRMKRQKTSNWRRWMNFKDDSSDNSDKDENQGGTQMLTQEQLKQW 1869          

HSP 6 Score: 46.2098 bits (108), Expect = 7.483e-112
Identity = 17/24 (70.83%), Postives = 20/24 (83.33%), Query Frame = -2
Query: 1352 WENQKTKLNEHYNHLPPAYECLKK 1423
            WEN+KT+ + HYNH PP YECLKK
Sbjct: 1869 WENRKTRHSGHYNHPPPVYECLKK 1892          

HSP 7 Score: 150.984 bits (380), Expect = 1.702e-64
Identity = 72/93 (77.42%), Postives = 80/93 (86.02%), Query Frame = -2
Query:  332 LTSITNNARAQWTNTHIVLTESVNRGLHQAARLEEQQRTILQLQRINEQLTNQVR*QAEEIRRLRIIQQGTEQRSWVEWISTTPEFTPEQDST 610
            +T ITNNA+ QWTNTH+VLTESVNRGL QA RLEEQQRTILQLQRINEQLT+QVR QA+EIRRLR  QQ  +  SWVEWI++ PEFTPE DST
Sbjct: 4034 MTLITNNAQTQWTNTHLVLTESVNRGLQQAIRLEEQQRTILQLQRINEQLTDQVRWQADEIRRLRSNQQHVDPASWVEWIASMPEFTPEPDST 4126          

HSP 8 Score: 117.472 bits (293), Expect = 1.702e-64
Identity = 67/88 (76.14%), Postives = 76/88 (86.36%), Query Frame = -1
Query:    9 TISNQRIIVDMQTIIEKIRGSENPSEATRQIMKEKIRIINXXXXXXXXXXXXXXXXGTRQTRCGCRICTDCTIEVIETNIRTFPGCDE 272
            T SNQ+I VDMQTIIE+IRGSENPSE TR+IMKEKI+++N I+E+ KCCKCK LLIG RQT+CGCRICTDCTIEVIET     PGCDE
Sbjct: 4132 TSSNQKIFVDMQTIIERIRGSENPSETTRRIMKEKIKVVNDIKERQKCCKCKELLIGARQTKCGCRICTDCTIEVIETKTIKCPGCDE 4219          

HSP 9 Score: 213.001 bits (541), Expect = 1.137e-54
Identity = 102/121 (84.30%), Postives = 107/121 (88.43%), Query Frame = -1
Query: 1962 IPSDKCIN------KGKIRFAQPVTRMINPAKFIPNMFSCSNVYGPLFETRDRSWLQFPTRVIVAPLRVFGLTELASEAEFKPVDISRSGIYQTKDLERAREHLLFPTQKQAT*SNIVTIT 2306
            IP DKCIN      KGKIRFAQPVTRMINP KF+PNMFSCSNVYGPLFE RD SWLQFPTRVIVAP ++FGLTELASEAEFKPVDIS+SGIYQTKDLERAREHLLFP Q+QA  SNIVTIT
Sbjct: 1687 IPRDKCINELEIMHKGKIRFAQPVTRMINPEKFVPNMFSCSNVYGPLFEIRDGSWLQFPTRVIVAPPKIFGLTELASEAEFKPVDISQSGIYQTKDLERAREHLLFPAQRQAILSNIVTIT 1807          
The following BLAST results are available for this feature:
BLAST of SMED30026417 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A355ABF21.394e-9532.45Uncharacterized protein OS=Flavobacteriaceae bacte... [more]
A0A232EWL21.241e-1631.54Uncharacterized protein OS=Trichomalopsis sarcopha... [more]
A0A151IXX84.735e-1228.13Uncharacterized protein OS=Trachymyrmex cornetzi O... [more]
A0A0J7KGQ02.704e-1120.11Uncharacterized protein OS=Lasius niger OX=67767 G... [more]
A0A195EK663.744e-922.11Uncharacterized protein OS=Trachymyrmex cornetzi O... [more]
back to top
BLAST of SMED30026417 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026417 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053822.11.100e-11183.37SMESG000053822.1[more]
SMESG000066529.11.961e-11583.16SMESG000066529.1[more]
SMESG000066529.11.913e-11583.16SMESG000066529.1[more]
SMESG000066529.12.202e-11583.16SMESG000066529.1[more]
SMESG000053822.17.483e-11283.37SMESG000053822.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026417 ID=SMED30026417|Name=SMED30026417|organism=Schmidtea mediterranea sexual|type=transcript|length=5981bp
TCGAATGTTTCATCGCATCCTGGGAATGTTCTTATATTGGTTTCTATTAC
TTCTATTGTACAGTCCGTACATATTCTGCATCCACACCTTGTCTGTCTTG
TTCCAATCAGTAGTCCTTTGCATTTACAACATTTCAACTTTTCTTCTATT
CCATTTATTATTCTGATTTTCTCTTTCATTATTTGTCTCGTAGCTTCTGA
CGGATTTTCGCTTCCTCTAATCTTCTCGATAATTGTCTGCATATCTACAA
TAATTCTCTGATTACTTATCGTCGTTCATTTTTAGCTGTTTATTTACACA
TATTTACATGATACGCTCTATTTTAATCCTCTGTTGAATCTTGCTCTGGG
GTAAATTCTGGCGTCGTTGATATCCATTCAACCCAGCTCCTTTGTTCTGT
ACCCTGTTGGATGATCCGCAGTCTTCTGATTTCTTCGGCTTGCTATCTGA
CTTGGTTAGTTAGTTGTTCGTTGATCCTTTGTAGTTGCAATATGGTTCTT
TGTTGTTCTTCAAGTCTAGCCGCTTGATGTAAGCCTCGATTCACGCTTTC
CGTTAATACTATATGGGTATTGGTCCATTGTGCTCGGGCGTTGTTGGTTA
TCGATGTCAATTTGCATTGATGATATTGATTTGTATTTCACTGTTGTCAT
TGATATACGCTATTTCGATGCTAGTGGTAGTTCTCTCTTTTTCTCAAATT
TGTGATTTGTTCGAAAATAATTTCTCCTCTGGTCTCCTCATCGACTTTTA
CGTAGCAGATCATTTGCGTACGTCCTGGTACTACTATATTCTCTGAGCAC
CTTACTTCAAACTTTAACGTACATATCCTCCCGGTTCTGTCTCTTAATTC
CATTGATCCTAGGTCGATTATTATTTCTTTTAATCGCTCAGGCATAAAAT
CCATTCCAATGATGCAATCCGCGCTTAACTTTCTGATGACTGCTAGGTAG
GTATTGATTTTTACATTTTTGTATTCTATTGTTGACCAGATTTTACCGAT
GACTGACACTGATTCTGTCTGCAGGTTATTACGTCCATATTCGTTTCTTC
AATAGGTGGCCATAATCTCCCTTGTATTTTGTGCATTTTTATTTCCGAAA
TGTTTGCTCCAGTATCGATCATTGCCTTTATCTCGAATTCATTTATGTCT
ATTGGTATCGTTAACGTTGGTCCTGCTAATGTTTGTAGCATGGCTATGGT
TTGCGTTTCTACCTCTTGATCTACACTTTTCGATCTTCGGCTGGTTCTCG
ATACTAATTCTGCCCAATTTGGTTCGTATAGTGTTGGGTATATGTTGCGT
AGTGTTGTTGGTCTTGTTATTGGTGTGTTTTGCTCTACGGGTTTCGTTTA
TTTTTTTCAGGCATTCATATGCTGGTGGTAGATGATTGTAATGTTCGTTT
AGTTTTGTCTTCTGGTTTTCCCAACTAGTATTGTTGGAGTTTTCCTTGGG
TTAACTTCTGCGTTCCCCGTTGATTGTCGTTGTAGCTGTTATCGCTGCTA
TCGTTCTTGAAATCTATCCATCGTTTCCAGTTGCTTGTCTTCTGCCTTTT
TATTCTGGTTCTCTCGGCTTACATCTTCATTATTGCCTTAAAGTTTCGTC
CCACTTCTTCGTCCGTACCATTCATTCTAGTCAAAATTCCTACTAATCTC
TTTATCTTGTGGATGTCTTTCGAATGTCCATGTAAGACCATTGTCTTTGC
TAAAAAAGGCAAAAATCCTAGAGTCATTTTCCAGTTTATTTTCCTTTCCC
TTTTATATATATCAAAGTATGCCAACATTTGTGTTAGAATCACTCTCACA
ATTTGGATGATGAGTATGATCCCTAGAATTCTTGCCATCATTTGTCCGAA
TATTAAAAATCTTCCCCACATGGCTTTCATCATATTTGCGGTTGCATGTT
GAAAATGGTCTGGTGATAATAATAATTCATAATTTGGTTTTTCTCCAAAG
TTATTTCCTCTTGTTATAGTCACGATATTTGATCATGTTGCTTGTTTTTG
TGTTGGAAATAATAAGTGTTCTCGAGCGCGTTCTAGATCCTTTGTTTGAT
ATATTCCACTCCGTGATATATCCACTGGTTTGAATTCTGCTTCGCTGGCT
AATTCCGTGAGTCCAAATACTCTTAGTGGGGCTACTATTACCCGAGTTGG
AAATTGTAACCAGCTTCTATCTCTCGTTTCGAATAATGGTCCGTATACAT
TGCTGCAGCTGAACATATTAGGTATGAATTTAGCTGGGTTTATCATCCTT
GTTACTGGTTGAGCGAATCTAATTTTTCCTTTGTTTATACACTTGTCACT
GGGGATCTTGAGTTTTCCGGTAACCTTGCGATTGTCTTCTCGCATTTGTA
CGTATACATTACTTCGCCTACGATTCTTCCGAAATATCCTTCTTGGAGTG
GTAGTAATGGAATTGCATTGTCGGGGTTGGTGATAGCCATAGCTAACTTA
GTTTTTAATATTTCTCTATTCAGGATACAGTCATTTTTTATTAGGTCGTA
ATATATTTTCTCTGTTGATGCTAGGCCTCTGTGATATAGGAAATCCATTT
TGTTATTCATGTAGAGATACAGCTTTACATCCTTTGGGTCTATCTTTGCT
TTGACGTTTGATATTGTTATTCACGATAGGAATATTTCTTTGTAATTTAT
GCTGATTATCATTTCGTCGCACTTGCTTACCATTCGTCCTTTGATGAATC
TCATTCCTATTGCACTGTCGGTTGAATTTACTCCTGTTGGTGTGGTTTCT
GATCCGATAATGGTGGTAATGGTTGGGTTTCTGATTTGTCCGGTTCTTCG
TAATTCTTCCATAGCTCTCTTCTGAGTATTTGTTTCGGTTTCACTGTGTA
CTTGTCCTTGTACTTCGTCGAATATTGCGCTTTTTAATAAGGTAAGTCGA
CAAGATCTAGTATCCGCGTGATACACGATTGTTGACATCCCCGTAGTGCA
TGATCCATGTGTTGCTACGCATTGTGGATACTTCTTTATTGCCTGCGTGT
TGGGGTCAAAGTAGCTTTGAAATTTTTCCAACTTCACTTGGTAACTTTCT
ATCACTAGTACACCTCGCACCAACTGGTTTAACAGTGTGTATTCTCCCCC
TTCACATGATCCATCTCCAGCTTTTATTCTTCCTGCGGCGTATACTCTGG
TGGTTTTTATTTTTCCATCTTCTGCTGCGACTTGAATTCGTCCTGCTATT
CTGATAACTCCGGTATTGAATCTTTTTTCACATTCGCTCCGTGTTACTGT
GACTACTGTCGTCTCTGTTCCGGTTTCTATAATTGTTGATTGTGAGTGAT
TTCGACAATGGAACGCTACGATTTTTCTTGTCACGGTGCATTCTCGGATT
TCCGTTTTTATGAAATCTACTTCTTGATACACATTATATGACACTGCTGT
GGCAGTTCTCTGCAACCTTCCGGGATTTGCGGCTTTGCATTCTTCCGTTT
CTTTCAGTGAATATTTGTCGCCAATCTTTATATTATTGCAGTCGTACACC
ACAAATGGTTCTGCTCCTTTTATGCACATCACTCATGTAAGTATTGTGGT
GATAATTGCGTTCATTCCTTTTCTGGCTGTTCTTGGGTCACTTGTATTGA
TTATTATCTCGAATTCTTTCAATAATTCCTTTAACATTGTTTGCATCATA
TCCGTTTGGTCATCTCCGCTTACTAAGTTTATAAAAGCTTGCCATCCACT
TTGAGATAAGATAAATGGTTCGATTGCTTTTATGATAATGTCGTTATCAC
AAATTCATATCCATTTGGGTTATAGTTTGGTGTTCGTTTTCTATAGATGG
TTATGGTGTTATACATCAAGTAAGCTATTCCTACTAAATATCTATTTGGG
TCATCTGATCGTTTGGTTAGATTATTTATGATTAATAGTAATTCTTCCGG
ATCTTTAGTTTTGGTTCGTACTTTATTATCCATGATCTTGGTTACTATTA
ATTTTATTATTGCCCAAAGCTGTTTTGCTTCCGTCCCGATATTACTGAGT
TTATGGTTTATCTTTGCTTCTGGATTTGAAAATCCCAGCATGTCGGCTAT
TAGTTTGTTGATCCACTTTGCTCCTTGTTCTTGACCTGTTAGTTTTCCTT
GTAATTGTTTTGTTATTTGACTGAGTTTATTCAGTTTCGTTGTTAGTTGA
TCCATTTGGATTTGTTCTTTGGTTTTCTTTTCTGTTGCTGGTTTGTTCGT
TTTCGGTTGTCCTCTTGGTCTCTTTTCCATCATGTATCCGTTTCCTTTCG
TTTGGGTTGCTCGTCTGTTGTGTTTCTTGACGTCGTAGCTCCACATTCTT
TTATCCTATTGTCCAATTCGTCTCCTGTTGACTTTCGGCGTCCTCTTTCC
TCCTTTCTTTCTTTTCTGTATTTGGTTCTACCGTTTCAGCCTGTTGCTTT
TGCGCGCATACGAATCCGTCTAAGTCATCTGTTGTCATATCATTTTCGTT
ATCTGTGGTGAATAGATCTCTGGATTCTGGGATTTTCCTTGTTGGTTCTT
CGTTTACAATGTCATTTAAATCATTTAATATTTTTTCGTCTCCTGTTATG
ATGGTTATTTCATCTGTTGCAAGTGGGATTTCAGGCGTATTTAGGCTTTC
CTCTCGCCCTATTAGGGTTTTCGATTTGATTTCTCTTTTGTTGAGTTCTC
TACCTTCAATTTTTGTTACTGTCAACACATTTATTACTCCCAGTTGTAAC
GGTGTGACTCCAATTTTGATATCGTCGTCTAAGGATCGTCCTTCATGTTG
TAGGTGGAATAGTAATTCGTATGATATTCTCTTTTTTACTTCACTTACCT
TGACTGTGATGTAGAATCCTTTTCTATTGGTTCGAAATCTGGTGTCATGA
TTTTTAAACCTTTCTTCTCTATAGTTTCAGCTGCCCAATCTGCATGTTTC
TATTTCCTGATGATTTCTCTAAATTGTTCAGGGTACAAAACAGACTTTTA
TGTATTCTTCTATCTCCTTTACTGTGTTTCGTAAATTTTATATTCTGTTG
CATGATTCGATTATCCACTTTGTGAGGTCTGTTACTGTTCATCTTTGATT
CTTTGCGCCTGTTCTCAATATTGCCGCTAATTCTCTGCATTTTTGAGTTT
CTGTTAATCTCGTCAATTCTTCCTCTACTGAATCGTCAATATCTGTGGGT
AAATATCTTGATTCGTTTTTCGAGTACGTTGATTCGTGGTCTAGCTTCCT
CCTTTTGGACCAGTATTTTCATCTCTTTTACGGTTTCCACTTCAATTGTG
ATGTATATTGCGTCATTTTTCACAAATGGCGATGTTTCTCATGTTCCATA
TTTCTTAAGTAAGAATTGTGGCATTCCTCCCACTACGTTTTGTGTGGATC
TCGGTTTAGATCTCGATTATTTTAAAATTCTCCATTAAAAACACTTTAAA
AAATTTAAGTTTGATTAAATAATTATTTTTTTAAAAACTGAATTGTCAAA
TATTTCAAAATATATCGGATGTTTGCTTTATATGCAAACATTGTCCCATT
GGAGAGAGGCCTCTATGGCACCATAGCCACGTCGAGGTGGTCAATAATTT
TGTGAAAAATTATTGTATTAGATGCAGCCTATTCCAGAAATATTATATGC
TGCATTGTTACTCCAAACATTATTCAAGTAATTTATTATTGTAAATTTTT
TATAATATATTTAATAATTTAGGTCATGAATTCACGGAATCAAGTCCGAC
TGCAAATACTTCTCCAAATGTGTCTTCAATCGCATCACGTAATAAATATT
TTTTTTAAATAAATTTGAATAAATAATTTAGATAATTTTAAAGATGTTGA
AGATTTCGAATATGTTGAAGATATGAATGAAAATGCTAATGAAAATGCTA
ATGAAAATGGTATTGAAAATGGTAATGAAAATGGTATTGAAAATGGTAAT
GAAAATGGTAATGAAAATAATAATGAAAATGGTAATAAAAATATTAATGA
AAAAAATATTATAGTATTTTTTAAAATCAAA
back to top

protein sequence of SMED30026417-orf-1

>SMED30026417-orf-1 ID=SMED30026417-orf-1|Name=SMED30026417-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=303bp
MCIKGAEPFVVYDCNNIKIGDKYSLKETEECKAANPGRLQRTATAVSYNV
YQEVDFIKTEIRECTVTRKIVAFHCRNHSQSTIIETGTETTVVTVTRSEC
EKRFNTGVIRIAGRIQVAAEDGKIKTTRVYAAGRIKAGDGSCEGGEYTLL
NQLVRGVLVIESYQVKLEKFQSYFDPNTQAIKKYPQCVATHGSCTTGMST
IVYHADTRSCRLTLLKSAIFDEVQGQVHSETETNTQKRAMEELRRTGQIR
NPTITTIIGSETTPTGVNSTDSAIGMRFIKGRMVSKCDEMIISINYKEIF
LS*
back to top

protein sequence of SMED30026417-orf-2

>SMED30026417-orf-2 ID=SMED30026417-orf-2|Name=SMED30026417-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=121bp
MREDNRKVTGKLKIPSDKCINKGKIRFAQPVTRMINPAKFIPNMFSCSNV
YGPLFETRDRSWLQFPTRVIVAPLRVFGLTELASEAEFKPVDISRSGIYQ
TKDLERAREHLLFPTQKQAT*
back to top

protein sequence of SMED30026417-orf-3

>SMED30026417-orf-3 ID=SMED30026417-orf-3|Name=SMED30026417-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MWSYDVKKHNRRATQTKGNGYMMEKRPRGQPKTNKPATEKKTKEQIQMDQ
LTTKLNKLSQITKQLQGKLTGQEQGAKWINKLIADMLGFSNPEAKINHKL
SNIGTEAKQLWAIIKLIVTKIMDNKVRTKTKDPEELLLIINNLTKRSDDP
NRYLVGIAYLMYNTITIYRKRTPNYNPNGYEFVITTLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR021109Peptidase_aspartic_dom_sf
IPR013083Znf_RING/FYVE/PHD
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 37..59
NoneNo IPR availableTMHMMTMhelixcoord: 5..27