MPV17 mitochondrial membrane protein-like 2

Overview
NameMPV17 mitochondrial membrane protein-like 2
Smed IDSMED30026414
Length (bp)974
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MPV17 mitochondrial membrane protein-like 2 (SMED30026414) t-SNE clustered cells

Violin plots show distribution of expression levels for MPV17 mitochondrial membrane protein-like 2 (SMED30026414) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MPV17 mitochondrial membrane protein-like 2 (SMED30026414) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MPV17 mitochondrial membrane protein-like 2 (SMED30026414) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026414

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30026414SMESG000062744.1 dd_Smed_v4_4214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026414SMESG000062744.1 dd_Smed_v4_4214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026414SMESG000062744.1 Contig50899newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026414SMESG000062744.1 Contig50899uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30026414SMESG000062744.1 SMED30026414smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026414SMESG000062744.1 SMED30026414smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30026414SMESG000062744.1 dd_Smed_v6_4214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30026414SMESG000062744.1 dd_Smed_v4_4214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Human
Match: MPV17L2 (MPV17 mitochondrial inner membrane protein like 2 [Source:HGNC Symbol;Acc:HGNC:28177])

HSP 1 Score: 82.8037 bits (203), Expect = 3.592e-18
Identity = 49/170 (28.82%), Postives = 82/170 (48.24%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVK---TVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYF 741
            + LL TN L CG + AAGD V Q    S  ++    + FD   +R+       C + P  HY+Y  LD+    + ++    V+KK+ +D  +  P+ L  +YF+  G L G +   + Q+L +     +  D   W   Q +NF F+ P++RV+ +N     +D   +Y 
Sbjct:   23 RALLVTNTLGCGALMAAGDGVRQ----SWEIRARPGQVFD--PRRSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPL-LGVWYFLGLGCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYL 185          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Human
Match: MPV17 (mitochondrial inner membrane protein MPV17 [Source:HGNC Symbol;Acc:HGNC:7224])

HSP 1 Score: 63.5438 bits (153), Expect = 1.676e-11
Identity = 44/175 (25.14%), Postives = 73/175 (41.71%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALC-ILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            +Q     H     +L  G +   GD + Q+LV    +++           RT       C  + P+   +YK LD+++ GT     +KKM +D   F P  L  F  + G L+G SA      L++        +   W  VQ+ NF  +   YR++VV   A  ++   ++  H
Sbjct:    7 YQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRG-------RTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAH 174          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Human
Match: MPV17 (mitochondrial inner membrane protein MPV17 [Source:HGNC Symbol;Acc:HGNC:7224])

HSP 1 Score: 63.5438 bits (153), Expect = 1.676e-11
Identity = 44/175 (25.14%), Postives = 73/175 (41.71%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALC-ILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            +Q     H     +L  G +   GD + Q+LV    +++           RT       C  + P+   +YK LD+++ GT     +KKM +D   F P  L  F  + G L+G SA      L++        +   W  VQ+ NF  +   YR++VV   A  ++   ++  H
Sbjct:    7 YQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRG-------RTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAH 174          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Human
Match: MPV17L (MPV17 mitochondrial inner membrane protein like [Source:HGNC Symbol;Acc:HGNC:26827])

HSP 1 Score: 58.9214 bits (141), Expect = 8.404e-10
Identity = 40/159 (25.16%), Postives = 75/159 (47.17%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCF 720
            +H   TN+L+ G + +AGD + QRL           ++ +W   R  +    +   A  ++ + + L++ L G A   ++ K+  D  +  PI++SAFY    +L G    +   DL+Q     +   L++W  VQ+ NF  +  ++R +   V  F +
Sbjct:   14 RHPWPTNVLLYGSLVSAGDALQQRL---------QGREANWRQTRR-VATLVVTFHANFNYVWLRLLERALPGRAPHALLAKLLCDQVVGAPIAVSAFYVGMSILQGKDDIFL--DLKQKFWNTYLSGLMYWPFVQLTNFSLVPVQWRTAYAGVCGFLW 160          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Human
Match: MPV17L (MPV17 mitochondrial inner membrane protein like [Source:HGNC Symbol;Acc:HGNC:26827])

HSP 1 Score: 58.9214 bits (141), Expect = 8.404e-10
Identity = 40/159 (25.16%), Postives = 75/159 (47.17%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCF 720
            +H   TN+L+ G + +AGD + QRL           ++ +W   R  +    +   A  ++ + + L++ L G A   ++ K+  D  +  PI++SAFY    +L G    +   DL+Q     +   L++W  VQ+ NF  +  ++R +   V  F +
Sbjct:   14 RHPWPTNVLLYGSLVSAGDALQQRL---------QGREANWRQTRR-VATLVVTFHANFNYVWLRLLERALPGRAPHALLAKLLCDQVVGAPIAVSAFYVGMSILQGKDDIFL--DLKQKFWNTYLSGLMYWPFVQLTNFSLVPVQWRTAYAGVCGFLW 160          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Celegans
Match: ZK470.1 (pep chromosome:WBcel235:X:4164302:4166138:1 gene:WBGene00022744.1 transcript:ZK470.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK470.1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.320e-17
Identity = 49/171 (28.65%), Postives = 77/171 (45.03%), Query Frame = 1
Query:  229 QNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLF-GTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTY 738
            +N   +HLL TN+          D + Q +         D  +  WD +RT   A    ++AP  H +Y+ LD   F G+    V+KK+  DT  F+P     F  V  +  G S S    +  +    +W +D   W P Q+INF F+ P  RV  VN+ +  ++ + +Y
Sbjct:    6 RNFLARHLLLTNVGTSCAQIGTADIIQQHI-------NGDVDRDGWDWRRTCRMAAIGLVMAPSLHCFYRVLDTRKFIGSRNCKVLKKLAWDTA-FIPYFSCIFMTVGSIYEGKSLSAAFAEYRRKMWHIWKVDFTLWPPAQLINFYFMPPALRVVYVNLVSLLYNCIMSY 168          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Celegans
Match: T18D3.9 (Mpv17-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q7YWV6])

HSP 1 Score: 65.855 bits (159), Expect = 1.114e-12
Identity = 47/163 (28.83%), Postives = 76/163 (46.63%), Query Frame = 1
Query:  253 LFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFA-GALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTY 738
            L T + + G +S +GD + Q L H+           +WD  RT  F+  + C +AP    +++ L+K         +VKK+ ID   F P   +A  F   LL   SA  +   L++    ++A  L  W  VQ++N  F+   YRV +  V AF ++   +Y
Sbjct:   16 LSTQMCIAGTISGSGDCLAQYLSHNQ----------EWDRWRTARFSFLSSCFMAPSLFIWFRLLEKVKGNNKSLLLVKKLCIDQLCFSPCFNAAILFNLRLLQHQSAEKSWDLLKEDWFNIYATSLKVWPFVQVVNLCFVPLNYRVILNQVVAFFWNCYLSY 168          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Fly
Match: CG32262 (gene:FBgn0052262 transcript:FBtr0073184)

HSP 1 Score: 97.4413 bits (241), Expect = 3.263e-23
Identity = 61/205 (29.76%), Postives = 97/205 (47.32%), Query Frame = 1
Query:  166 FQKYLQLFVQSKAVIK-----------TKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            +QKY   F   K   +           TK    NMF K+LL TN++  G +   GD + Q   +   ++ +D  +FD D       AGAL    P+ HY Y ++D+ +    +K + KK+ ID  +  P  +  F++    L   +   T Q+L      ++ LD + W   Q +NFR++  KYRV+ VNV    ++VL +Y  H
Sbjct:   38 YQKYGLRFTHGKGETEGGALSFILLRWTKIAWSNMFGKYLLVTNVVGSGLLMVVGDVIAQEYEYRRGLRHQD--RFDTDRMYRMFVAGAL--QGPLHHYVYNWMDRVMPARTLKNIFKKILIDQLVMSPACIVIFFYSLCYLERQTLDATNQELISKFPYVYMLDWMTWPAAQYLNFRYLDTKYRVTFVNVCTAVYNVLMSYMKH 238          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Fly
Match: CG32263 (gene:FBgn0052263 transcript:FBtr0073183)

HSP 1 Score: 93.5893 bits (231), Expect = 2.106e-22
Identity = 58/181 (32.04%), Postives = 90/181 (49.72%), Query Frame = 1
Query:  196 SKAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTY 738
            S A     +    +F K+LL TN +  G + A GD + Q+       +  + K FD+      +  G+  ++ P+ H +Y  LD  L GT+   V+ K+ +D  I  PI +  F++V  LL G S      +L +  L  W LD  FW  +Q +NFRF++  YRV  VNVA   + VL ++
Sbjct:   23 STAPPPNAKFWTKLFGKYLLLTNTIGSGLLLAIGDAIAQQYE-----RFGEKKAFDYSRSGCMMITGS--VIGPIQHGFYLLLDGVLPGTSGWGVLHKILVDQLIMSPIYIFLFFYVSSLLGGKSFVECNSELSEKFLYTWMLDCCFWPGLQYLNFRFLNSLYRVVFVNVANCVYVVLLSH 196          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Fly
Match: CG1662 (gene:FBgn0030481 transcript:FBtr0342624)

HSP 1 Score: 88.9669 bits (219), Expect = 2.596e-20
Identity = 59/197 (29.95%), Postives = 102/197 (51.78%), Query Frame = 1
Query:  202 AVIKTKEIHQNMFD-KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRERWHKVKLEKIP 789
            A+ K +E H + F  + LLFTN+ +   +S  GD + Q L     +   + ++F+  S RT   A +   +  + HY+YK LDK + G  ++ V KK+ +D  I  PI +SAF+   GLL   +     +++++   +++A +   W   Q +NF +I   YR+   N+ +  +DVL +   H +   H   L+KIP
Sbjct:   58 ALQKLREWHASAFSSRFLLFTNVGISLTLSCVGDVLEQHL----EIYCGEIERFE--STRTAHMAISGVTVGVICHYWYKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQSHSH---LKKIP 245          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Fly
Match: CG1662 (gene:FBgn0030481 transcript:FBtr0073776)

HSP 1 Score: 88.9669 bits (219), Expect = 2.596e-20
Identity = 59/197 (29.95%), Postives = 102/197 (51.78%), Query Frame = 1
Query:  202 AVIKTKEIHQNMFD-KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRERWHKVKLEKIP 789
            A+ K +E H + F  + LLFTN+ +   +S  GD + Q L     +   + ++F+  S RT   A +   +  + HY+YK LDK + G  ++ V KK+ +D  I  PI +SAF+   GLL   +     +++++   +++A +   W   Q +NF +I   YR+   N+ +  +DVL +   H +   H   L+KIP
Sbjct:   58 ALQKLREWHASAFSSRFLLFTNVGISLTLSCVGDVLEQHL----EIYCGEIERFE--STRTAHMAISGVTVGVICHYWYKMLDKRMPGRTMRVVAKKIVLDQLICSPIYISAFFVTLGLLEQKTKHEVWEEIKEKAWKLYAAEWTVWPVAQFVNFYWIPTHYRIFYDNIISLGYDVLTSKVKHKQSHSH---LKKIP 245          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Fly
Match: CG5906 (gene:FBgn0036217 transcript:FBtr0076071)

HSP 1 Score: 78.9518 bits (193), Expect = 4.074e-17
Identity = 54/172 (31.40%), Postives = 83/172 (48.26%), Query Frame = 1
Query:  226 HQNMFD-KHLLFTNILVCGGVSAAGDFVCQ---RLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAV-KTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDV 726
            HQ  F  K+LLFTNI +  G+S  GD + Q   RL+  L          DW+  RT     +   +  + HY+Y+ LD YLF     K VV K+ +D  I  P  ++ F+    +L  ++     Q++ +  L ++A +   W   Q INF  I P+YRV   N  +  +D+
Sbjct:   18 HQIAFSPKYLLFTNIGISVGLSMVGDTMEQSYERLIGELP---------DWNRTRTIRMGISGLTVGLVCHYWYQHLD-YLFPKRTYKVVVVKILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVWPLAQFINFLLIKPQYRVFYDNTISLGYDI 179          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Zebrafish
Match: mpv17l2 (MPV17 mitochondrial membrane protein-like 2 [Source:NCBI gene;Acc:436840])

HSP 1 Score: 105.531 bits (262), Expect = 8.605e-27
Identity = 54/169 (31.95%), Postives = 86/169 (50.89%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            + L+ TN + CGG+ AAGD + Q    +  +++   +  DW   RT       C + P  HY+Y++LDKY  G  +  V KK+ +D  +  P +L A+YF+  G++ GH+     Q+        +  D   W   Q+INF F+ PK+RV  VN+    +D   +Y  H
Sbjct:   24 RFLIVTNTVSCGGMLAAGDLIQQ----TREIRRTPGRTRDWS--RTGCMFAVGCSMGPFMHYWYQWLDKYFIGNGINNVCKKVLVDQLVASP-TLGAWYFLGMGMMEGHTFIEAQQEFRDKFWEFYKADWCVWPAAQMINFYFLPPKFRVLYVNIVTLGWDTYLSYLKH 185          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Zebrafish
Match: mpv17l2 (MPV17 mitochondrial membrane protein-like 2 [Source:NCBI gene;Acc:436840])

HSP 1 Score: 105.531 bits (262), Expect = 8.605e-27
Identity = 54/169 (31.95%), Postives = 86/169 (50.89%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            + L+ TN + CGG+ AAGD + Q    +  +++   +  DW   RT       C + P  HY+Y++LDKY  G  +  V KK+ +D  +  P +L A+YF+  G++ GH+     Q+        +  D   W   Q+INF F+ PK+RV  VN+    +D   +Y  H
Sbjct:   24 RFLIVTNTVSCGGMLAAGDLIQQ----TREIRRTPGRTRDWS--RTGCMFAVGCSMGPFMHYWYQWLDKYFIGNGINNVCKKVLVDQLVASP-TLGAWYFLGMGMMEGHTFIEAQQEFRDKFWEFYKADWCVWPAAQMINFYFLPPKFRVLYVNIVTLGWDTYLSYLKH 185          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Zebrafish
Match: mpv17 (mitochondrial inner membrane protein MPV17 [Source:NCBI gene;Acc:394140])

HSP 1 Score: 72.7886 bits (177), Expect = 6.557e-15
Identity = 44/171 (25.73%), Postives = 75/171 (43.86%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTY 738
            +Q +  KH     I+  G +   GD + Q+L+    +   + ++        + F G      P+   +YK LDK + G      +KKM +D   F P  L AF  + G L+G +       L++        +   W PVQI NF FI   +R++VV + A  ++   ++
Sbjct:    8 YQALMAKHPWKVQIITAGSLVGVGDVISQQLIERRGLANHNARRTAKMMSIGFFFVG------PVVGGWYKVLDKLVTGGTKSAALKKMLVDQVGFAPCFLGAFLGITGTLNGLTVEENVAKLQRDYTDALISNYYLWPPVQIANFYFIPLHHRLAVVQIVAVVWNSYLSW 172          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Zebrafish
Match: pxmp2 (peroxisomal membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-040912-184])

HSP 1 Score: 67.3958 bits (163), Expect = 6.203e-13
Identity = 45/175 (25.71%), Postives = 79/175 (45.14%), Query Frame = 1
Query:  232 NMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRE 756
            ++  K+ + T  +  G +SA G+ + Q L +   VK+   KK        +     L I  P+SHY+Y  L+  L  T    ++K++ ++  IF P  L  FY V   L G + +     L+ +      ++   W P Q IN  ++  ++RV   N+ A  +   + Y   VR+
Sbjct:   23 SLLKKYPIITKSVTSGILSALGNLLSQVLEYQKNVKENSPKKKISILGPVHFAIYGLFITGPVSHYFYHLLEVLLPTTVPYCLIKRLLLERLIFAPAFLLLFYVVMNALEGKTLADVQNKLKTSYWPAMKMNWKVWTPFQFININYVPVQFRVLFANMVALFW---YAYLASVRK 194          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Zebrafish
Match: si:ch211-120k19.1 (si:ch211-120k19.1 [Source:ZFIN;Acc:ZDB-GENE-100922-282])

HSP 1 Score: 51.6026 bits (122), Expect = 2.844e-7
Identity = 32/127 (25.20%), Postives = 55/127 (43.31%), Query Frame = 1
Query:  361 DWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYF 741
            DW         G  C  A  ++++ + L++   G   K V  K+ +D  I  P+++SAFY   GL +   A    +D +      +   +V+W  +Q +NF  I P  R   V   A  + +   +F
Sbjct:   99 DWSQTARVALVG-FCFHANFNYHWLRGLERMFPGGGTKRVSLKVILDQLIAAPMTISAFYI--GLSTLEGAEDPFEDWKNKFWTSYKTGVVYWSTMQAVNFSLIPPAARTVFVGGVALGWTIFLCHF 222          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Xenopus
Match: mpv17l2 (MPV17 mitochondrial membrane protein-like 2 [Source:NCBI gene;Acc:448319])

HSP 1 Score: 94.3597 bits (233), Expect = 2.680e-22
Identity = 52/172 (30.23%), Postives = 86/172 (50.00%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRE 756
            + L+ TN + CG +   GD + Q    S  V+++  +K DW   RT       C + P+ H++Y +LD+   G  +  V++K+ ID  +  P+ L  +YF+  G + G     + Q+  +     +  D   W   Q+INF F+SPKYRV  +NV    +D   +Y  H +E
Sbjct:   23 RFLIVTNTVSCGLLLGIGDSIQQ----SREVRRDPERKRDW--LRTGRMFAIGCSMGPLMHFWYSWLDRSFPGRGITVVMRKVLIDQLVASPV-LGLWYFLGMGSMEGQKLEKSWQEFREKFWEFYKADWTVWPAAQMINFYFLSPKYRVIYINVITVGWDTYLSYLKHRKE 187          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Xenopus
Match: ENSXETT00000020072.1 (mpv17-like protein 2 [Source:NCBI gene;Acc:100497159])

HSP 1 Score: 88.9669 bits (219), Expect = 2.223e-20
Identity = 57/185 (30.81%), Postives = 90/185 (48.65%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRERWHKVKLEKIPIAN 798
            + LL TN +  G + + GD + Q    +  +++   KK DW   RT       C L P+ HY+Y FLD+ L G  V+ V+KK+ ++  +  PI  + F+   GL+ GHS   +  + +     M+ ++   W P QIINF F+  KYRV  VN     +D+   Y  H     H+   +   + N
Sbjct:   23 QTLLITNTVSAGVLLSTGDAIQQ----TWEMRRNKEKKRDW--LRTGRMFAIGCCLGPVDHYWYVFLDRILPGATVRVVLKKVLVEQIVASPILGTMFFMGTGLMEGHSVEESWVEFKGKFWEMYKVEWCVWPPAQIINFYFLPTKYRVMYVNFVTLAWDIYLCYLKHKNPVTHETPAKSEEVLN 201          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Xenopus
Match: ENSXETT00000022732.1 (MPV17 mitochondrial membrane protein-like [Source:NCBI gene;Acc:100493944])

HSP 1 Score: 64.6994 bits (156), Expect = 8.767e-12
Identity = 45/172 (26.16%), Postives = 81/172 (47.09%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRER 759
            +H   TN+ + G + A+ D V Q+L       K   +  D+         G  C  A  + ++ +F+++   G+A   V++K+  D  +  PI++SAFY    LL G S  +  ++L++     +   ++ W   Q INF  I P  R + + V AF +    T+  ++R R
Sbjct:   10 RHPWLTNVTIYGSLFASADIVQQKL------SKSPGEPIDFKQTAKVGIVG-FCFHANFNFFWLRFIERTFPGSAPLNVIRKVACDQLMAAPITISAFYTGLSLLDGESDIF--KNLKEKFWPTYKTGVMCWTVFQTINFSVIPPFVRTAYIGVCAFLWT---TFLCYIRNR 169          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Xenopus
Match: dagla (diacylglycerol lipase, alpha [Source:Xenbase;Acc:XB-GENE-6037909])

HSP 1 Score: 62.003 bits (149), Expect = 7.415e-11
Identity = 41/155 (26.45%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  253 LFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAG-ALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAF 714
            + T  L    +SA G+ + Q +      +KE     + D +    FA   L    P+SHY+Y  L++ +  +A    ++++ I+  I  P  L  F+ V  LL G + +   Q L+ +  +   L+   W P Q IN  ++  ++RV   N+ AF
Sbjct:   31 VLTKALTSAILSALGNILSQTIQKW---RKEQKHPQNVDLRGPLRFAVYGLLFTGPLSHYFYLLLEQLVPSSAPLAGLQRLLIERLIIAPAFLLLFFLVMNLLEGKNFTKLNQKLKSSYWQALKLNWKVWTPFQFININYVPVQFRVLFANLVAF 182          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Xenopus
Match: ENSXETT00000022723.1 (MPV17 mitochondrial membrane protein-like [Source:NCBI gene;Acc:100493944])

HSP 1 Score: 57.3806 bits (137), Expect = 3.660e-9
Identity = 45/172 (26.16%), Postives = 79/172 (45.93%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRER 759
            +H   TN+ + G + A+ D V Q+L       K   +  D+         G  C  A  + ++ +F+++   G+A   V++K+  D  +  PI++SAFY    LL G S  +  ++L++   + W    V       INF  I P  R + + V AF +    T+  ++R R
Sbjct:   10 RHPWLTNVTIYGSLFASADIVQQKL------SKSPGEPIDFKQTAKVGIVG-FCFHANFNFFWLRFIERTFPGSAPLNVIRKVACDQLMAAPITISAFYTGLSLLDGESDIF--KNLKE---KFWPTYKVTCSFPSTINFSVIPPFVRTAYIGVCAFLWT---TFLCYIRNR 166          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Mouse
Match: Mpv17l2 (MPV17 mitochondrial membrane protein-like 2 [Source:MGI Symbol;Acc:MGI:2681846])

HSP 1 Score: 78.5666 bits (192), Expect = 8.127e-17
Identity = 54/191 (28.27%), Postives = 91/191 (47.64%), Query Frame = 1
Query:  199 KAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKT---VVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYF-YHVRE 756
            KA+   + + Q    + LL TN L CG + AAGD   Q       V+    ++F   ++R+       C + P  H++Y +LD+ L  + +++   V+KK+ +D  +  PI L  +YF+  G L G +   + Q+L       +  D   W   Q++NF FI   +RV+ +N     +D   +Y  Y V E
Sbjct:   11 KALAAGRPLFQG---RALLLTNTLGCGVLMAAGDGARQ----VWEVRARPGQRFS--ARRSASMFAVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPI-LGVWYFLGLGSLEGQTLEESCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDTYLSYLKYWVPE 191          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Mouse
Match: Mpv17l2 (MPV17 mitochondrial membrane protein-like 2 [Source:MGI Symbol;Acc:MGI:2681846])

HSP 1 Score: 78.5666 bits (192), Expect = 8.127e-17
Identity = 54/191 (28.27%), Postives = 91/191 (47.64%), Query Frame = 1
Query:  199 KAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKT---VVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYF-YHVRE 756
            KA+   + + Q    + LL TN L CG + AAGD   Q       V+    ++F   ++R+       C + P  H++Y +LD+ L  + +++   V+KK+ +D  +  PI L  +YF+  G L G +   + Q+L       +  D   W   Q++NF FI   +RV+ +N     +D   +Y  Y V E
Sbjct:   11 KALAAGRPLFQG---RALLLTNTLGCGVLMAAGDGARQ----VWEVRARPGQRFS--ARRSASMFAVGCSMGPFLHFWYLWLDRLLPASGLRSLPSVMKKVLVDQTVASPI-LGVWYFLGLGSLEGQTLEESCQELRAKFWDFYKADWCVWPAAQLVNFLFIPSHFRVTYINGLTLGWDTYLSYLKYWVPE 191          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Mouse
Match: Pxmp2 (peroxisomal membrane protein 2 [Source:MGI Symbol;Acc:MGI:107487])

HSP 1 Score: 65.855 bits (159), Expect = 2.299e-12
Identity = 45/162 (27.78%), Postives = 75/162 (46.30%), Query Frame = 1
Query:  259 TNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFY 744
            T  +  G +SA G+ + Q    ++  +K+D++  +      YL  G L +  P+SHY Y F++  +        VK++ +D   F P  L  F+FV  LL G + S     +         ++   W P+Q IN  ++  ++RV   N+AA     LF Y Y
Sbjct:   36 TKAVSSGILSALGNLLAQ----TIEKRKKDSQNLEVSGLLRYLVYG-LFVTGPLSHYLYLFMEYSVPPEVPWASVKRLLLDRLFFAPTFLLLFFFVMNLLEGKNVSVFVAKMRSGFWPALQMNWRMWTPLQFININYVPLQFRVLFANMAA-----LFWYAY 187          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Mouse
Match: Mpv17 (MpV17 mitochondrial inner membrane protein [Source:MGI Symbol;Acc:MGI:97138])

HSP 1 Score: 63.1586 bits (152), Expect = 1.343e-11
Identity = 47/175 (26.86%), Postives = 73/175 (41.71%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALC-ILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            +Q     H     +L  G +   GD + Q+LV    +++         + RT       C  + P+   +YK LD  + GT     +KKM +D   F P  L  F  + G+L+G S    AQD        WA     W  VQ+ NF  +   YR++VV   A  ++   ++  H
Sbjct:    7 YQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQHQ-------AGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMS----AQD-------NWAKLKRLWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSWKAH 163          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Mouse
Match: Mpv17 (MpV17 mitochondrial inner membrane protein [Source:MGI Symbol;Acc:MGI:97138])

HSP 1 Score: 63.1586 bits (152), Expect = 1.684e-11
Identity = 44/175 (25.14%), Postives = 73/175 (41.71%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALC-ILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            +Q     H     +L  G +   GD + Q+LV    +++         + RT       C  + P+   +YK LD  + GT     +KKM +D   F P  L  F  + G+L+G SA      L++        +   W  VQ+ NF  +   YR++VV   A  ++   ++  H
Sbjct:    7 YQRALAAHPWKVQVLTAGSLMGVGDMISQQLVERRGLQQHQ-------AGRTLTMVSLGCGFVGPVVGGWYKVLDHLIPGTTKVHALKKMLLDQGGFAPCFLGCFLPLVGILNGMSAQDNWAKLKRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAIVWNSYLSWKAH 174          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. UniProt/SwissProt
Match: sp|Q6DGV7|M17L2_DANRE (Mpv17-like protein 2 OS=Danio rerio OX=7955 GN=mpv17l2 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 6.496e-26
Identity = 54/169 (31.95%), Postives = 86/169 (50.89%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            + L+ TN + CGG+ AAGD + Q    +  +++   +  DW   RT       C + P  HY+Y++LDKY  G  +  V KK+ +D  +  P +L A+YF+  G++ GH+     Q+        +  D   W   Q+INF F+ PK+RV  VN+    +D   +Y  H
Sbjct:   24 RFLIVTNTVSCGGMLAAGDLIQQ----TREIRRTPGRTRDWS--RTGCMFAVGCSMGPFMHYWYQWLDKYFIGNGINNVCKKVLVDQLVASP-TLGAWYFLGMGMMEGHTFIEAQQEFRDKFWEFYKADWCVWPAAQMINFYFLPPKFRVLYVNIVTLGWDTYLSYLKH 185          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. UniProt/SwissProt
Match: sp|Q6DIY8|M17L2_XENTR (Mpv17-like protein 2 OS=Xenopus tropicalis OX=8364 GN=mpv17l2 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.420e-21
Identity = 52/172 (30.23%), Postives = 86/172 (50.00%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRE 756
            + L+ TN + CG +   GD + Q    S  V+++  +K DW   RT       C + P+ H++Y +LD+   G  +  V++K+ ID  +  P+ L  +YF+  G + G     + Q+  +     +  D   W   Q+INF F+SPKYRV  +NV    +D   +Y  H +E
Sbjct:   23 RFLIVTNTVSCGLLLGIGDSIQQ----SREVRRDPERKRDW--LRTGRMFAIGCSMGPLMHFWYSWLDRSFPGRGITVVMRKVLIDQLVASPV-LGLWYFLGMGSMEGQKLEKSWQEFREKFWEFYKADWTVWPAAQMINFYFLSPKYRVIYINVITVGWDTYLSYLKHRKE 187          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. UniProt/SwissProt
Match: sp|Q567V2|M17L2_HUMAN (Mpv17-like protein 2 OS=Homo sapiens OX=9606 GN=MPV17L2 PE=1 SV=2)

HSP 1 Score: 82.8037 bits (203), Expect = 1.725e-17
Identity = 49/170 (28.82%), Postives = 82/170 (48.24%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVK---TVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYF 741
            + LL TN L CG + AAGD V Q    S  ++    + FD   +R+       C + P  HY+Y  LD+    + ++    V+KK+ +D  +  P+ L  +YF+  G L G +   + Q+L +     +  D   W   Q +NF F+ P++RV+ +N     +D   +Y 
Sbjct:   23 RALLVTNTLGCGALMAAGDGVRQ----SWEIRARPGQVFD--PRRSASMFAVGCSMGPFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPL-LGVWYFLGLGCLEGQTVGESCQELREKFWEFYKADWCVWPAAQFVNFLFVPPQFRVTYINGLTLGWDTYLSYL 185          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. UniProt/SwissProt
Match: sp|A5D787|M17L2_BOVIN (Mpv17-like protein 2 OS=Bos taurus OX=9913 GN=MPV17L2 PE=2 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.955e-17
Identity = 51/176 (28.98%), Postives = 85/176 (48.30%), Query Frame = 1
Query:  229 QNMFD-KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTA---VKTVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYF 741
            Q +F  + LL TN L CG + AAGD   Q    +  ++    +KFD   +R+       C + P  HY+Y +LD+    +    +  V+KK+ ID  +  P+ L  +YF+  G L G +   + Q+L       +  D   W   Q++NF F+ P++RV+ +N     +D   +Y 
Sbjct:   17 QPLFQGRALLVTNTLGCGVLMAAGDGARQ----TWEIRARPGQKFD--PRRSVSMFAVGCSMGPFLHYWYLWLDRLFPASGFPGLPNVLKKVLIDQLVASPM-LGVWYFLGLGCLEGQTLDKSCQELRDKFWEFYKADWCVWPAAQLVNFLFVPPQFRVTYINGLTLGWDTYLSYL 185          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. UniProt/SwissProt
Match: sp|Q54XX9|PX24B_DICDI (PXMP2/4 family protein 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0278529 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.516e-17
Identity = 48/181 (26.52%), Postives = 82/181 (45.30%), Query Frame = 1
Query:  235 MFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAG-ALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRV---SVVNV--AAFCFDVLFTYFYHVRER 759
            + D H L T  L  G +   GD + QRL H     K++  +F  D KR    +   +    PM HY+Y+ LD  + G     ++KKM ID  +F P+++  F  V   ++        ++  +       ++ + W   QIINF  + P  RV   S++++    F   + F   +H+R +
Sbjct:   11 LLDNHPLVTKSLSTGFLMGTGDILAQRLEHKF---KDEKSQFKLDYKRVATMSTVGIFYSGPMLHYWYRSLDIMVKGEGRSVIIKKMLIDQLLFAPVAIGGFMTVTNFINNKGELKNLENFTKELFYAVKINWLIWPAAQIINFSLVPPNLRVLYSSIISIFWGMFLSHISFDKDHHIRNQ 188          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. TrEMBL
Match: A0A5K3FT80 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.907e-29
Identity = 66/197 (33.50%), Postives = 100/197 (50.76%), Query Frame = 1
Query:  166 FQKYLQLFVQSKAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRE 756
            F K L +F + +++     +  ++     L +NIL+CG  S   D   Q     L  +K++ ++   D +R + F  +  +LAP  HY+Y +LD  + G+ V  + KK+  D  IF PI +  FY       G   +   Q L  TG  +W L+ V WIP+Q INFRF+   YRV   NV +F FD L++  YH  E
Sbjct:    6 FMKRLSVFGRLRSLNLMNRLSTSLSKHKWLLSNILLCGSTSVVADLSTQ-----LFSQKDNQEELAIDWRRVFAFGSSSLVLAPTVHYWYIYLDGIVAGSQVSIIFKKLGYDAVIFSPIYIFLFYCFQSAFEGTCYADCFQKLRATGPVLWTLESVSWIPLQFINFRFVPLTYRVLYDNVVSFSFDTLYSLVYHADE 197          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. TrEMBL
Match: A0A0R3SCK1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS2319 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.837e-28
Identity = 69/199 (34.67%), Postives = 100/199 (50.25%), Query Frame = 1
Query:  181 QLFVQSKAVIKTKEIHQNM------FDKH-LLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRE 756
            +LF+QS + IKT +  +++      F KH  L  NIL+CGG S   D      V S  +  +  KKF  + +R   F     +LAP  H++Y FLD    GT+   + KK+  D+ IF P+ +  FY    +      S     L   G  +W  +   WIP+QI+NFR +  +YRV   NV +FCFD L++  YH  E
Sbjct:    4 RLFIQSLSAIKTLQTSRSLGLIRQSFSKHKWLIFNILLCGGTSFVAD------VTSQYICCDKEKKFHIECERVCAFTATSLVLAPAVHHWYIFLDNIAVGTSATAIAKKLAYDSLIFSPLYILLFYCCQSVFERKQCSECFYKLHTNGPILWISESFSWIPIQIVNFRLVPLRYRVLYDNVVSFCFDTLYSSVYHTDE 196          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. TrEMBL
Match: A0A1D2NN33 (Mpv17-like protein 2 OS=Orchesella cincta OX=48709 GN=Ocin01_00034 PE=3 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 5.603e-27
Identity = 64/199 (32.16%), Postives = 102/199 (51.26%), Query Frame = 1
Query:  151 ARVKYFQKYLQLFVQSKAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            A +K     L  F+ S  V K +   + MF +HLL TNI +   +S  GD + Q        +K  +++  ++ +RT   +GA      + HY+Y +LDKY+ G   K  +KKM +D  I  PI+++ F+    +L   SA+   Q+L     R++  + V W P Q+INF ++  KYRV   N  + C+DV  +Y  H
Sbjct:    3 ATMKISHLMLNRFINSSFVTKMRSGTRYMFQRHLLLTNIAISASISTVGDSIEQ------NYEKYKDRERKYEVRRTLNMSGAGVTTGVVCHYWYIWLDKYMPGRTFKIAMKKMLLDQVINSPITIATFFITLAVLERSSATEFIQELRAKSWRLYLAEWVIWPPAQLINFFWLPLKYRVLYDNTISMCYDVYTSYVKH 195          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. TrEMBL
Match: A0A0R3TUK2 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11435 PE=3 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.046e-26
Identity = 63/207 (30.43%), Postives = 101/207 (48.79%), Query Frame = 1
Query:  136 FSKKMARVKYFQKYLQLFVQSKAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRE 756
            F + ++ +K FQ    LF++ + +++ K           L +N+ +CGG S   D   Q +         D++KF  +  R   F     +LAP  HY+Y FLD    GT+   + KK+  D+ IF P+ +  FY    +            L   G  +W  + + WIP+QI+NFRF++ +YRV   NV ++CFD L++  YH  E
Sbjct:    6 FLQCLSAIKNFQASNSLFLKGQTLLRHK----------WLISNVFLCGGTSFVADVTSQYIC-------RDHEKFQIEWDRVCAFTATSIVLAPAVHYWYIFLDNVAIGTSAIAIAKKLAYDSLIFSPLYILLFYCCQSIFERRDFYECFHKLHTNGPILWLSESISWIPIQIVNFRFVALRYRVLYDNVISYCFDTLYSSVYHTDE 195          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. TrEMBL
Match: R4WJ81 (Pmp22 peroxisomal membrane protein, putative OS=Riptortus pedestris OX=329032 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 2.385e-26
Identity = 65/183 (35.52%), Postives = 96/183 (52.46%), Query Frame = 1
Query:  211 KTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRER 759
            K K ++  MF+KHLL TN+ +  G+S  GD + Q  +     KK  NK+  ++   T L  GA+C      H++Y +LDK L G  +K V+KK  ID   F P  +S F+   GLL   S S T +++   G  ++  + + W P QIINF F+  KYRV   N  +  +D+  +Y  H  E 
Sbjct:   16 KIKTVNSVMFNKHLLLTNLGISLGLSGFGDVLQQNYMILQGEKKAWNKRRTFNMSVTGLTVGAVC------HHWYNYLDKKLPGRTLKIVLKKCLIDQIFFSPFYISVFFVTIGLLENSSLSQTVKEIINKGKHLYVAEWIVWPPAQIINFYFLPTKYRVLYDNTISLGYDIYTSYVKHELEE 192          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Cavefish
Match: mpv17l2 (MPV17 mitochondrial inner membrane protein like 2 [Source:NCBI gene;Acc:103046905])

HSP 1 Score: 102.064 bits (253), Expect = 2.325e-25
Identity = 57/169 (33.73%), Postives = 88/169 (52.07%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            K+L+ TNI+  GG+ A GD + Q      + +K+   +  W+ +RT   A   C + P  H++Y++LDK   G  VKTV KK+ ID  I  P+ L A+YF+  G++ GH A     + ++     +  D   W   Q+INF F+  K+RV  VN     +D   +Y  H
Sbjct:   23 KYLIVTNIVSSGGMLALGDCIQQ------SREKQRTPEKSWEWQRTGRMAAVGCSMGPFLHFWYEWLDKAYAGRMVKTVAKKVLIDQLIASPL-LGAWYFIGMGIMEGHGAVKGCTEFKEKFWEFYKADWCVWPTAQMINFYFLPAKFRVLYVNTITLGWDTYLSYLKH 184          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Cavefish
Match: pxmp2 (peroxisomal membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-040912-184])

HSP 1 Score: 61.2326 bits (147), Expect = 1.271e-10
Identity = 45/178 (25.28%), Postives = 80/178 (44.94%), Query Frame = 1
Query:  235 MFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAG-ALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWA---LDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRE 756
            +  ++ + T  +  G +SA G+ + Q L  S   +KE     + D      FA   L +  P+SHY+Y  L+          ++K++ ++  +F P  L  F+ V   L G S   TA+  ++   R W    ++   W P Q +N  F+  ++RV   N+ A  +   + Y   VR+
Sbjct:   64 LLKRYPIITKSVTSGILSALGNLLSQAL-ESKKNRKEGRPAKEVDIHGPVRFAVYGLVVTGPISHYFYHLLEALFPAAEPYCMLKRLLLERLVFAPAFLMLFFTVMNALEGKS---TAELQDKVKSRYWPALKMNWKVWTPFQFVNINFVPVQFRVLFANMIALFW---YAYLASVRK 234          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Cavefish
Match: mpv17 (mitochondrial inner membrane protein MPV17 [Source:NCBI gene;Acc:394140])

HSP 1 Score: 58.151 bits (139), Expect = 2.032e-9
Identity = 41/174 (23.56%), Postives = 71/174 (40.80%), Query Frame = 1
Query:  169 QKYLQLFVQSKAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRV 690
            Q +    V  K++      +Q +  +      IL  G +   GD + Q+L+    +     K+        + F G      P+   +YK LD+ + G   +  +KKM +D   F P  L+ F  + G L+G +       L++  +     +   W  VQI NF FI   +R+
Sbjct:   93 QIFTSFCVSEKSMAGLWRSYQLLMARRPWTVQILTAGSLVGVGDVISQQLIERRGLSNHCVKRTAKMMSIGFFFVG------PVVGGWYKVLDQLITGGTKQAALKKMLVDQVCFAPCFLATFLGISGTLNGLTVEENVAKLQRDYVDALISNYYLWPAVQIANFYFIPLHHRL 260          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Cavefish
Match: mpv17 (mitochondrial inner membrane protein MPV17 [Source:NCBI gene;Acc:394140])

HSP 1 Score: 55.4546 bits (132), Expect = 5.482e-9
Identity = 38/155 (24.52%), Postives = 63/155 (40.65%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRV 690
            +Q +  +      IL  G +   GD + Q+L+    +     K+        + F G      P+   +YK LD+ + G   +  +KKM +D   F P  L+ F  + G L+G +       L++            W  VQI NF FI   +R+
Sbjct:    8 YQLLMARRPWTVQILTAGSLVGVGDVISQQLIERRGLSNHCVKRTAKMMSIGFFFVG------PVVGGWYKVLDQLITGGTKQAALKKMLVDQVCFAPCFLATFLGISGTLNGLTVEENVAKLQR-----------LWPAVQIANFYFIPLHHRL 145          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Cavefish
Match: ENSAMXT00000011501.2 (mpv17-like protein [Source:NCBI gene;Acc:103042289])

HSP 1 Score: 50.447 bits (119), Expect = 3.426e-7
Identity = 38/152 (25.00%), Postives = 64/152 (42.11%), Query Frame = 1
Query:  259 TNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAF 714
            +N+ V G + A GD   Q L  S        +K DW   R      A       S  + +FL++   G +V  V++K+ +D  +  P++ S FY     L G +     +D ++  L  +   L++W  +Q +NF  +    R       AF
Sbjct:   16 SNVTVYGCLFAGGDLAQQCLSGS--------EKLDWGRTRNVAVV-AFGFHGNFSFLWLRFLERRFPGNSVSMVLRKLLLDQTVAAPLATSVFYTGVSFLEGKND--ILEDWKKKFLNTYKTGLMYWPFMQFLNFSLVPLYLRTIFTGCCAF 156          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Sea Lamprey
Match: mpv17 (mitochondrial inner membrane protein MPV17 [Source:NCBI gene;Acc:394140])

HSP 1 Score: 63.929 bits (154), Expect = 1.521e-12
Identity = 40/171 (23.39%), Postives = 72/171 (42.11%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTY 738
            +Q +  +H     I   G     GD + Q++V    ++  D       ++   +       + P+   +Y+ LD+ + GT     +KKM +D   F P  L  F  + G L+G +       L +        +   W  VQI NF FI  ++R++VV   A  ++V  ++
Sbjct:    8 YQGLMVRHPWKVQITTAGSFVGVGDIISQQVVEHKGLRNHDR------ARTAKMMLIGFAFVGPVIGGWYRVLDRLVPGTTKTVALKKMALDQGAFAPPFLVGFMSIVGTLNGLTNPQILDKLRRDYRDTLTANYYIWPAVQIANFYFIPLQHRLAVVQCVALIWNVYLSW 172          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Sea Lamprey
Match: si:ch211-120k19.1 (si:ch211-120k19.1 [Source:ZFIN;Acc:ZDB-GENE-100922-282])

HSP 1 Score: 54.6842 bits (130), Expect = 3.127e-9
Identity = 32/103 (31.07%), Postives = 51/103 (49.51%), Query Frame = 1
Query:  430 YYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTY 738
            + + L++ + G+A + VV K+  D  +  PI++SAF+    LL G    Y  +DL Q     +   +V+W  +Q INF  + P  R   V V AF +     Y
Sbjct:   60 WLRGLERAIPGSAARAVVVKVLADQTVAGPITISAFFTGMSLLEGKPDIY--KDLRQKFWPTYKTGVVYWSAMQTINFTLVPPYARSVFVGVCAFLWTCYLCY 160          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Nematostella
Match: EDO32785 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SU19])

HSP 1 Score: 57.3806 bits (137), Expect = 6.321e-10
Identity = 38/161 (23.60%), Postives = 69/161 (42.86%), Query Frame = 1
Query:  247 HLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAG-ALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDV 726
            H + T  +     S  G  V Q     L  K+   +  ++  +    F+G    +  P+ HY+Y +L++++      +  KK+FID  IF P     F+++  +  G S       ++        + L  W  VQ +NF +I  +YRV   N+ A  + +
Sbjct:   33 HPILTKSITSAITSGLGQLVSQ-----LAAKRATGQNINY--RAIAAFSGFGFLVTGPLVHYFYNYLEQFVPRGVPFSKAKKLFIDRLIFSPPFYLLFFYIVAIFEGKSNKEAIARIKANYWGALKMSLKVWPLVQFVNFTYIPVQYRVLFANLVALFWSI 186          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Nematostella
Match: EDO45507 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSR7])

HSP 1 Score: 56.6102 bits (135), Expect = 1.022e-9
Identity = 48/188 (25.53%), Postives = 78/188 (41.49%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTV--VKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLF-TYFYHVRERWHKVKLE 780
            +Q +   H   T  +  G V A GD + Q+ +        + K  + D KRT         + P+   +Y  LDK +  +    +  +KK+F+D  +F P  ++ F+ +   +SG +     Q L +  L     +   W  VQI+ F  I   YRV  V     CF V + TY   +  R  +   E
Sbjct:    8 YQRLMVSHPWTTQTVSVGVVVAFGDVITQQAI--------ERKGINHDVKRTLKMGAVGLFVGPIIRTWYLTLDKLVVASRRPKLDALKKVFLDQSLFAPCFIAVFFGIKCTVSGQTLDEYKQVLREHYLNTLIANYKLWPAVQIVTFSIIPFSYRVLFVQ----CFAVFWNTYLCWMANRPSETNTE 183          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Medaka
Match: mpv17l2 (MPV17 mitochondrial inner membrane protein like 2 [Source:NCBI gene;Acc:101164222])

HSP 1 Score: 89.7373 bits (221), Expect = 9.235e-21
Identity = 52/172 (30.23%), Postives = 86/172 (50.00%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRE 756
            ++LL TN L  G + + GD + Q    +   +++ ++  DW         G  C L P+ HY+Y +LD+   G A+ T++KK+ +D  +  P +L  +YF+   LL GH+ S    +        + +D   W   Q+INF F+SPK+RV  +N     +D   +Y  H  E
Sbjct:   24 RYLLLTNTLSGGVMLSLGDILQQ----TREKRRKPDRVRDWARTGRMFVVG--CSLGPLLHYWYLWLDRVYVGKALNTLIKKVLVDQLVASP-TLGLWYFLGMDLLEGHTLSQGWAEFRDKFWEFYKVDWCVWPAAQMINFYFLSPKFRVVYINFITLGWDTYLSYLKHRDE 188          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Medaka
Match: mpv17l2 (MPV17 mitochondrial inner membrane protein like 2 [Source:NCBI gene;Acc:101164222])

HSP 1 Score: 88.5817 bits (218), Expect = 9.856e-21
Identity = 51/169 (30.18%), Postives = 85/169 (50.30%), Query Frame = 1
Query:  244 KHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVH-GLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH 747
            ++LL TN L  G + + GD + Q    +   +++ ++  DW         G  C L P+ HY+Y +LD+   G A+ T++KK+ +D  +  P +L  +YF+   LL GH+ S    +        + +D   W   Q+INF F+SPK+RV  +N     +D   +Y  H
Sbjct:   24 RYLLLTNTLSGGVMLSLGDILQQ----TREKRRKPDRVRDWARTGRMFVVG--CSLGPLLHYWYLWLDRVYVGKALNTLIKKVLVDQLVASP-TLGLWYFLGMDLLEGHTLSQGWAEFRDKFWEFYKVDWCVWPAAQMINFYFLSPKFRVVYINFITLGWDTYLSYLKH 185          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Medaka
Match: mpv17 (mitochondrial inner membrane protein MPV17 [Source:NCBI gene;Acc:101175610])

HSP 1 Score: 66.2402 bits (160), Expect = 1.001e-12
Identity = 40/154 (25.97%), Postives = 65/154 (42.21%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYR 687
            +Q M  K+     I+  G +   GD + Q+L+    +++   ++        + F G      P+   +YK LD+ + G      +KKM +D   F P  L AF  + G L+G S       L+         +   W PVQI NF F+   +R
Sbjct:    8 YQTMMSKYPWTVQIMTAGSLVGVGDVISQQLIERRGLRRHSVRRTARMMSIGFFFVG------PVIGSWYKVLDRIVVGGGKSAAMKKMLVDQLCFAPCFLGAFLSICGALNGLSVEENVAKLKGDYTDALICNYYLWPPVQIANFYFVPLNHR 155          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Medaka
Match: mpv17 (mitochondrial inner membrane protein MPV17 [Source:NCBI gene;Acc:101175610])

HSP 1 Score: 56.6102 bits (135), Expect = 2.018e-9
Identity = 38/154 (24.68%), Postives = 63/154 (40.91%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYR 687
            +Q M  K+     I+  G +   GD + Q+L+    +++   ++        + F G      P+   +YK LD+ + G      +KKM +D   F P  L AF  + G L+G S       L+      +         VQI NF F+   +R
Sbjct:    8 YQTMMSKYPWTVQIMTAGSLVGVGDVISQQLIERRGLRRHSVRRTARMMSIGFFFVG------PVIGSWYKVLDRIVVGGGKSAAMKKMLVDQLCFAPCFLGAFLSICGALNGLSVEENVAKLKGVSPPPFPTLWPP---VQIANFYFVPLNHR 152          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Medaka
Match: mpv17 (mitochondrial inner membrane protein MPV17 [Source:NCBI gene;Acc:101175610])

HSP 1 Score: 55.0694 bits (131), Expect = 9.881e-9
Identity = 31/124 (25.00%), Postives = 53/124 (42.74%), Query Frame = 1
Query:  226 HQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLE 597
            +Q M  K+     I+  G +   GD + Q+L+    +++   ++        + F G      P+   +YK LD+ + G      +KKM +D   F P  L AF  + G L+G S       L+
Sbjct:    8 YQTMMSKYPWTVQIMTAGSLVGVGDVISQQLIERRGLRRHSVRRTARMMSIGFFFVG------PVIGSWYKVLDRIVVGGGKSAAMKKMLVDQLCFAPCFLGAFLSICGALNGLSVEENVAKLK 125          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Planmine SMEST
Match: SMESG000062744.1 (SMESG000062744.1)

HSP 1 Score: 449.899 bits (1156), Expect = 1.056e-161
Identity = 217/217 (100.00%), Postives = 217/217 (100.00%), Query Frame = 1
Query:  148 MARVKYFQKYLQLFVQSKAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRERWHKVKLEKIPIAN 798
            MARVKYFQKYLQLFVQSKAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRERWHKVKLEKIPIAN
Sbjct:    1 MARVKYFQKYLQLFVQSKAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRERWHKVKLEKIPIAN 217          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Planmine SMEST
Match: SMESG000040050.1 (SMESG000040050.1)

HSP 1 Score: 114.775 bits (286), Expect = 1.388e-30
Identity = 55/180 (30.56%), Postives = 96/180 (53.33%), Query Frame = 1
Query:  229 QNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRERWHK 768
            Q  + K+L FTN+     +    D + QR+        E N +F W+  RT+L   +L  +  +SH YY+ +DK   G + K V+ K+F D  + +P++LS +    GL    +     +D +     +++++L FWIP QI NFRF++P+YR+   N+    +  LF+Y YH+  + ++
Sbjct:   13 QQAYGKYLFFTNMGTYFLIGGTADSIAQRIEKLSEESIEKNAEFQWNKDRTFLHTRSLACMGCVSHNYYRIIDKVFIGYSWKIVLIKLFFDITVNIPLTLSTYITARGLWERRTFKSIFKDFKCLMKTLYSVELSFWIPYQIFNFRFVNPQYRILCENLGNLIYQNLFSYMYHILRKTYR 192          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Planmine SMEST
Match: SMESG000048507.1 (SMESG000048507.1)

HSP 1 Score: 111.309 bits (277), Expect = 2.665e-29
Identity = 61/180 (33.89%), Postives = 93/180 (51.67%), Query Frame = 1
Query:  217 KEIHQNMFDKHLLFTNILVCGGVSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRE 756
            K IH  +FDK+LL TN  +CG  +   D   Q+L  +L ++K+     +W+  RT  F+G   I+ P  H++Y++LDK + G ++K V  K  ID   F P  + AFY +    +          L   G + W  +     P+QI NFRF+  KYRV   N  ++ FD +F YF++  E
Sbjct:    9 KNIHSVLFDKYLLLTNTFICGFGAGVSDITAQKL-ENLIIEKQF-VGINWN--RTMKFSGIALIMGPTVHFWYRWLDKIIPGNSLKIVCTKSLIDGFSFSPAYICAFYLIEKSFNKADNKSGLLGLNINGFKYWVFETALASPLQIFNFRFLPLKYRVVFDNFVSYWFDTVFAYFFNKEE 184          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Planmine SMEST
Match: SMESG000040050.1 (SMESG000040050.1)

HSP 1 Score: 107.071 bits (266), Expect = 7.964e-28
Identity = 49/156 (31.41%), Postives = 84/156 (53.85%), Query Frame = 1
Query:  283 VSAAGDFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHV 750
            +    D + QR+        E N +F W+  RT+L   +L  +  +SH YY+ +DK   G + K V+ K+F D  + +P++LS +    GL    +     +D +     +++++L FWIP QI NFRF++P+YR+   N+    +  LF+Y YH+
Sbjct:    7 IGGTADSIAQRIEKLSEESIEKNAEFQWNKDRTFLHTRSLACMGCVSHNYYRIIDKVFIGYSWKIVLIKLFFDITVNIPLTLSTYITARGLWERRTFKSIFKDFKCLMKTLYSVELSFWIPYQIFNFRFVNPQYRILCENLGNLIYQNLFSYMYHI 162          
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Planmine SMEST
Match: SMESG000040050.1 (SMESG000040050.1)

HSP 1 Score: 83.9593 bits (206), Expect = 7.974e-20
Identity = 38/120 (31.67%), Postives = 69/120 (57.50%), Query Frame = 1
Query:  409 LAPMSHYYYKFLDKYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLEQTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYHVRERWHK 768
            +  +SH YY+ +DK   G + K V+ K+F D  + +P++LS +    GL    +     +D +     +++++L FWIP QI NFRF++P+YR+   N+    +  LF+Y YH+  + ++
Sbjct:    1 MGCVSHNYYRIIDKVFIGYSWKIVLIKLFFDITVNIPLTLSTYITARGLWERRTFKSIFKDFKCLMKTLYSVELSFWIPYQIFNFRFVNPQYRILCENLGNLIYQNLFSYMYHILRKTYR 120          
The following BLAST results are available for this feature:
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPV17L23.592e-1828.82MPV17 mitochondrial inner membrane protein like 2 ... [more]
MPV171.676e-1125.14mitochondrial inner membrane protein MPV17 [Source... [more]
MPV171.676e-1125.14mitochondrial inner membrane protein MPV17 [Source... [more]
MPV17L8.404e-1025.16MPV17 mitochondrial inner membrane protein like [S... [more]
MPV17L8.404e-1025.16MPV17 mitochondrial inner membrane protein like [S... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ZK470.12.320e-1728.65pep chromosome:WBcel235:X:4164302:4166138:1 gene:W... [more]
T18D3.91.114e-1228.83Mpv17-like protein [Source:UniProtKB/Swiss-Prot;A... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG322623.263e-2329.76gene:FBgn0052262 transcript:FBtr0073184[more]
CG322632.106e-2232.04gene:FBgn0052263 transcript:FBtr0073183[more]
CG16622.596e-2029.95gene:FBgn0030481 transcript:FBtr0342624[more]
CG16622.596e-2029.95gene:FBgn0030481 transcript:FBtr0073776[more]
CG59064.074e-1731.40gene:FBgn0036217 transcript:FBtr0076071[more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpv17l28.605e-2731.95MPV17 mitochondrial membrane protein-like 2 [Sourc... [more]
mpv17l28.605e-2731.95MPV17 mitochondrial membrane protein-like 2 [Sourc... [more]
mpv176.557e-1525.73mitochondrial inner membrane protein MPV17 [Source... [more]
pxmp26.203e-1325.71peroxisomal membrane protein 2 [Source:ZFIN;Acc:ZD... [more]
si:ch211-120k19.12.844e-725.20si:ch211-120k19.1 [Source:ZFIN;Acc:ZDB-GENE-100922... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpv17l22.680e-2230.23MPV17 mitochondrial membrane protein-like 2 [Sourc... [more]
ENSXETT00000020072.12.223e-2030.81mpv17-like protein 2 [Source:NCBI gene;Acc:1004971... [more]
ENSXETT00000022732.18.767e-1226.16MPV17 mitochondrial membrane protein-like [Source:... [more]
dagla7.415e-1126.45diacylglycerol lipase, alpha [Source:Xenbase;Acc:X... [more]
ENSXETT00000022723.13.660e-926.16MPV17 mitochondrial membrane protein-like [Source:... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mpv17l28.127e-1728.27MPV17 mitochondrial membrane protein-like 2 [Sourc... [more]
Mpv17l28.127e-1728.27MPV17 mitochondrial membrane protein-like 2 [Sourc... [more]
Pxmp22.299e-1227.78peroxisomal membrane protein 2 [Source:MGI Symbol;... [more]
Mpv171.343e-1126.86MpV17 mitochondrial inner membrane protein [Source... [more]
Mpv171.684e-1125.14MpV17 mitochondrial inner membrane protein [Source... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DGV7|M17L2_DANRE6.496e-2631.95Mpv17-like protein 2 OS=Danio rerio OX=7955 GN=mpv... [more]
sp|Q6DIY8|M17L2_XENTR1.420e-2130.23Mpv17-like protein 2 OS=Xenopus tropicalis OX=8364... [more]
sp|Q567V2|M17L2_HUMAN1.725e-1728.82Mpv17-like protein 2 OS=Homo sapiens OX=9606 GN=MP... [more]
sp|A5D787|M17L2_BOVIN3.955e-1728.98Mpv17-like protein 2 OS=Bos taurus OX=9913 GN=MPV1... [more]
sp|Q54XX9|PX24B_DICDI5.516e-1726.52PXMP2/4 family protein 2 OS=Dictyostelium discoide... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FT807.907e-2933.50Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3SCK13.837e-2834.67Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A1D2NN335.603e-2732.16Mpv17-like protein 2 OS=Orchesella cincta OX=48709... [more]
A0A0R3TUK21.046e-2630.43Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
R4WJ812.385e-2635.52Pmp22 peroxisomal membrane protein, putative OS=Ri... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpv17l22.325e-2533.73MPV17 mitochondrial inner membrane protein like 2 ... [more]
pxmp21.271e-1025.28peroxisomal membrane protein 2 [Source:ZFIN;Acc:ZD... [more]
mpv172.032e-923.56mitochondrial inner membrane protein MPV17 [Source... [more]
mpv175.482e-924.52mitochondrial inner membrane protein MPV17 [Source... [more]
ENSAMXT00000011501.23.426e-725.00mpv17-like protein [Source:NCBI gene;Acc:103042289... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mpv171.521e-1223.39mitochondrial inner membrane protein MPV17 [Source... [more]
si:ch211-120k19.13.127e-931.07si:ch211-120k19.1 [Source:ZFIN;Acc:ZDB-GENE-100922... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO327856.321e-1023.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455071.022e-925.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpv17l29.235e-2130.23MPV17 mitochondrial inner membrane protein like 2 ... [more]
mpv17l29.856e-2130.18MPV17 mitochondrial inner membrane protein like 2 ... [more]
mpv171.001e-1225.97mitochondrial inner membrane protein MPV17 [Source... [more]
mpv172.018e-924.68mitochondrial inner membrane protein MPV17 [Source... [more]
mpv179.881e-925.00mitochondrial inner membrane protein MPV17 [Source... [more]
back to top
BLAST of MPV17 mitochondrial membrane protein-like 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062744.11.056e-161100.00SMESG000062744.1[more]
SMESG000040050.11.388e-3030.56SMESG000040050.1[more]
SMESG000048507.12.665e-2933.89SMESG000048507.1[more]
SMESG000040050.17.964e-2831.41SMESG000040050.1[more]
SMESG000040050.17.974e-2031.67SMESG000040050.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026414 ID=SMED30026414|Name=MPV17 mitochondrial membrane protein-like 2|organism=Schmidtea mediterranea sexual|type=transcript|length=974bp
GTGATAAACGTTTACGTAAAAGCTCACTTGTTATTAATAAAATCTATTTC
AAAATTGTGTTAAGTAAGAATTTGTTTATTTAAACATACAATAGTTTTCG
GACTTTTTTAAAATATTTGTTTTAAATTTGAAAGGTTTTCCAAAAAAATG
GCTCGGGTCAAATATTTTCAAAAGTATCTACAACTATTTGTTCAATCGAA
AGCAGTTATAAAAACAAAAGAGATTCATCAAAATATGTTCGATAAACATT
TGTTATTTACAAACATTCTCGTCTGTGGAGGAGTAAGTGCAGCTGGGGAT
TTTGTTTGTCAGCGTTTGGTCCATTCTCTAACTGTTAAAAAGGAAGATAA
TAAAAAATTCGATTGGGATAGCAAAAGAACTTATTTATTTGCAGGCGCCT
TGTGTATTCTTGCTCCAATGAGCCATTATTATTACAAATTTCTAGACAAA
TATTTATTTGGTACCGCTGTCAAAACTGTAGTGAAAAAAATGTTCATCGA
TACCTGCATTTTCGTTCCGATTTCGTTGAGCGCATTCTATTTTGTACACG
GTCTACTGAGCGGTCACTCAGCCTCTTATACTGCCCAAGATTTAGAACAA
ACAGGACTGAGAATGTGGGCTCTAGATTTGGTGTTCTGGATCCCGGTGCA
AATTATTAATTTCCGTTTTATTTCTCCGAAATATCGAGTTTCTGTTGTGA
ACGTTGCAGCATTTTGTTTTGACGTGTTGTTTACGTATTTCTATCACGTT
CGTGAAAGGTGGCATAAAGTCAAATTGGAAAAAATCCCAATCGCAAATTA
ATATGCAAAAATTGAATGATAAAAATTTGGAACTGGAAAATAATAATAAT
GTTGAAAAATTCATTTTTGTAAAAATATATCAGCAACTTTGTGGATAATC
ATAAATATTTATAAATTTTAAATTCATTAAATTATTATAGCAATTGTAGT
ATAAATTTCAACGTGTGAACTGAC
back to top

protein sequence of SMED30026414-orf-1

>SMED30026414-orf-1 ID=SMED30026414-orf-1|Name=SMED30026414-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=218bp
MARVKYFQKYLQLFVQSKAVIKTKEIHQNMFDKHLLFTNILVCGGVSAAG
DFVCQRLVHSLTVKKEDNKKFDWDSKRTYLFAGALCILAPMSHYYYKFLD
KYLFGTAVKTVVKKMFIDTCIFVPISLSAFYFVHGLLSGHSASYTAQDLE
QTGLRMWALDLVFWIPVQIINFRFISPKYRVSVVNVAAFCFDVLFTYFYH
VRERWHKVKLEKIPIAN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR007248Mpv17_PMP22
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007248Mpv17/PMP22PFAMPF04117Mpv17_PMP22coord: 135..193
e-value: 2.2E-12
score: 47.0
IPR007248Mpv17/PMP22PANTHERPTHR11266PEROXISOMAL MEMBRANE PROTEIN 2, PXMP2 MPV17coord: 16..201
NoneNo IPR availablePANTHERPTHR11266:SF8MPV17-LIKE PROTEIN 2coord: 16..201
NoneNo IPR availableTMHMMTMhelixcoord: 78..96
NoneNo IPR availableTMHMMTMhelixcoord: 116..138
NoneNo IPR availableTMHMMTMhelixcoord: 36..58
NoneNo IPR availableTMHMMTMhelixcoord: 182..201
NoneNo IPR availableTMHMMTMhelixcoord: 153..175