Ectonucleotide pyrophosphatase/phosphodiesterase family member 5

Overview
NameEctonucleotide pyrophosphatase/phosphodiesterase family member 5
Smed IDSMED30026411
Length (bp)1600
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (SMED30026411) t-SNE clustered cells

Violin plots show distribution of expression levels for Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (SMED30026411) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (SMED30026411) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 (SMED30026411) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026411

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30026411SMESG000039606.1 SMESG000006670.1 Contig5060GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026411SMESG000023047.1 Contig5060GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30026411SMESG000023047.1 dd_Smed_v4_973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026411SMESG000023047.1 dd_Smed_v4_973_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026411SMESG000023047.1 dd_Smed_v6_973_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Human
Match: ENPP4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:HGNC Symbol;Acc:HGNC:3359])

HSP 1 Score: 270.011 bits (689), Expect = 3.716e-84
Identity = 148/384 (38.54%), Postives = 226/384 (58.85%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLE-KLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            ++LL+S DGFR DY++  +      P+    I++G  +   KN F T T PNH ++VTGL+ ESHGIV N+ YD        D N++    DP W+++   PIWVT + +  R +A+ +WP TD P+H  I     S F    N  +   F +R+ ++  WL+N+   + F+ LY+ EPD SGH YGP  +   + V+  +D ++G L+Q LK  GLW+ +N+I+T+DHGM++ S  R I LD  ++ S+YT   L+PV A+ P K     VYN LKN +PH+ V+ ++++P    Y   N RI P+IL+A+  W I       +   G+HGY+NS P + PF  A GP   + +     + VD+YP+MC++LG+ P+PNNG+ 
Sbjct:   27 KLLLVSFDGFRADYLKNYEF-----PHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDK----DPFWWNE-AVPIWVTNQLQENRSSAAAMWPGTDVPIHDTI----SSYFM---NYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILP-KINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQ-HNDRIQPIILVADEGWTIV--LNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTF 389          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Human
Match: ENPP5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5 [Source:HGNC Symbol;Acc:HGNC:13717])

HSP 1 Score: 270.011 bits (689), Expect = 5.542e-84
Identity = 147/391 (37.60%), Postives = 232/391 (59.34%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP------FMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            D+ +VLL+S DGFR DY+ KV      TP+F Y+++ G  + +  N F T T PNH TLVTGLF E+HGIV N  +D    N++F +++ N + D K++++   PIW+T ++ G  + + +WP TD  +H + P              +Y P      F  RV  ++ W + ++  I+  +LY+ +PD+ GH  GP+       +  +D  LG+LIQ+LK   LW+ +N+I+T+DHGM++ S+ R I LD+Y++   YT    +PV A+ P +GK   VY AL + +P+L V+ +++VP   +Y   N RI P+I +A+  W I    ++   + GNHGY+N+  D+ P F+A GP  R+NF+    +S D+YPL+C+LL I   P+NGS 
Sbjct:   26 DQQKVLLVSFDGFRWDYLYKVP-----TPHFHYIMKYGVHVKQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDP-IRNKSFSLDHMN-IYDSKFWEE-ATPIWITNQRAGHTSGAAMWPGTDVKIHKRFP-------------THYMPYNESVSFEDRVAKIIEWFT-SKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSEERLIELDQYLDKDHYTLIDQSPVAAILPKEGKFDEVYEALTHAHPNLTVYKKEDVPERWHYKY-NSRIQPIIAVADEGWHILQNKSDDF-LLGNHGYDNALADMHPIFLAHGPAFRKNFSKEAMNSTDLYPLLCHLLNITAMPHNGSF 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Human
Match: ENPP5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5 [Source:HGNC Symbol;Acc:HGNC:13717])

HSP 1 Score: 270.011 bits (689), Expect = 5.542e-84
Identity = 147/391 (37.60%), Postives = 232/391 (59.34%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP------FMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            D+ +VLL+S DGFR DY+ KV      TP+F Y+++ G  + +  N F T T PNH TLVTGLF E+HGIV N  +D    N++F +++ N + D K++++   PIW+T ++ G  + + +WP TD  +H + P              +Y P      F  RV  ++ W + ++  I+  +LY+ +PD+ GH  GP+       +  +D  LG+LIQ+LK   LW+ +N+I+T+DHGM++ S+ R I LD+Y++   YT    +PV A+ P +GK   VY AL + +P+L V+ +++VP   +Y   N RI P+I +A+  W I    ++   + GNHGY+N+  D+ P F+A GP  R+NF+    +S D+YPL+C+LL I   P+NGS 
Sbjct:   26 DQQKVLLVSFDGFRWDYLYKVP-----TPHFHYIMKYGVHVKQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDP-IRNKSFSLDHMN-IYDSKFWEE-ATPIWITNQRAGHTSGAAMWPGTDVKIHKRFP-------------THYMPYNESVSFEDRVAKIIEWFT-SKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSEERLIELDQYLDKDHYTLIDQSPVAAILPKEGKFDEVYEALTHAHPNLTVYKKEDVPERWHYKY-NSRIQPIIAVADEGWHILQNKSDDF-LLGNHGYDNALADMHPIFLAHGPAFRKNFSKEAMNSTDLYPLLCHLLNITAMPHNGSF 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Human
Match: ENPP7 (ectonucleotide pyrophosphatase/phosphodiesterase 7 [Source:HGNC Symbol;Acc:HGNC:23764])

HSP 1 Score: 197.593 bits (501), Expect = 1.330e-56
Identity = 128/398 (32.16%), Postives = 201/398 (50.50%), Query Frame = 2
Query:  116 PSQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLT-------PVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            P Q    +N++LL+S DGFR +Y + V      TPN D +   G +      AF T+T P H TLVTG + E+HG+V N +Y+ T       +     L   +W+D    PIW+T ++ G    S  +P  +    G +   +  +  +  N  N   +   ++ V+ W   T   +D   LYF EPD +GH YGP        V  +D  +G+L + +    L D++N+I+T+DHGM+   D R   L E+     +T+  +        P G L P +G+ + VY+ALK+ +P L V+ ++  P + +Y  +N R+ PL++ ++  + I H   N     G HG++N + D++  F A GP+ R    +    SV VY LMC LLGI P  N+G L
Sbjct:   23 PVQSQGSQNKLLLVSFDGFRWNYDQDVD-----TPNLDAMARDGVKARYMTPAFVTMTSPCHFTLVTGKYIENHGVVHNMYYNTT---SKVKLPYHATLGIQRWWDNGSVPIWITAQRQGLRAGSFFYPGGNVTYQG-VAVTRSRKEGIAHNYKNETEWRANIDTVMAWF--TEEDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLNLIITSDHGMT-TVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDALKDAHPKLHVYKKEAFPEAFHY-ANNPRVTPLLMYSDLGYVI-HGRINVQFNNGEHGFDNKDMDMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPEANDGHL 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Human
Match: ENPP3 (ectonucleotide pyrophosphatase/phosphodiesterase 3 [Source:HGNC Symbol;Acc:HGNC:3358])

HSP 1 Score: 184.882 bits (468), Expect = 1.916e-50
Identity = 123/391 (31.46%), Postives = 191/391 (48.85%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHI-DFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVK--------GKEQAVYNALKNRNP--HLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGS 1285
            V+L SMDGFR +Y+          PN + L   G      +  +PT T PNH T+VTGL+PESHGI+ N  YD    N+ F ++++   N+P W+    +P+W+T    G   A++ WP ++  ++G  P       ++        PF +R+  ++ WL   +     F  +YF EPD SGH+ GP       A+ ++D   G L++ LK + L + VNIIL ADHGM +   ++   + +Y     + Y    P   +              E+ V N L  R P  H + +   ++P  L+Y   N RI  + L  + +W      +N     GNHGYNN    ++  F+A GP+ +    +    +++VY LMC LL I P PNNG+
Sbjct:  161 VILFSMDGFRAEYLYTWDTL---MPNINKLKTCGIHSKYMRAMYPTKTFPNHYTIVTGLYPESHGIIDNNMYDVNL-NKNFSLSSKEQ-NNPAWWHG--QPMWLTAMYQGLKAATYFWPGSEVAINGSFP-------SIYMPYNGSVPFEERISTLLKWLDLPKAERPRFYTMYFEEPDSSGHAGGPVSARVIKALQVVDHAFGMLMEGLKQRNLHNCVNIILLADHGMDQTYCNKMEYMTDYFPRINFFYMYEGPAPRIRAHNIPHDFFSFNSEEIVRN-LSCRKPDQHFKPYLTPDLPKRLHY-AKNVRIDKVHLFVDQQWLAVRSKSNTNCGGGNHGYNNEFRSMEAIFLAHGPSFKEKTEVEPFENIEVYNLMCDLLRIQPAPNNGT 535          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Celegans
Match: C01B10.9 (pep chromosome:WBcel235:IV:6632222:6634986:1 gene:WBGene00015283.1 transcript:C01B10.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C01B10.9)

HSP 1 Score: 145.591 bits (366), Expect = 2.016e-37
Identity = 128/471 (27.18%), Postives = 218/471 (46.28%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMR-TKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQ-------NNLNDPKWFDKWPEPIWVTLEK--LGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPP----------NYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQI-PLDEYVNPSWYTYTLLTPVGALYPVK---GKE--QAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKAT----------NGTNVYGN--HGYNNSEPDVQPFFIAQGPNIRRNFTIP-FGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICK 1438
            ++LLIS DGFR+D +++V      TPN        +      K+ + T T PNH ++ TGLF E HGIV N F+D     + FD  N        N   +  W++   +PIW+T E+    R +A+  WP              ESQF  + + P          +   +MK  +DV+      +  ++F   Y  EPD + H  G + +     +  LD +  + I+      L   VNIILTADHG +E  D + +  + +YV+ + +          +YP     GK+    + +A+K     + + WR+EVP   +Y  ++ RI  ++   +   +I+   T          NGT  + +  HG +   P+++ F I +GP    N+TI     +VD+Y +MC++LGI P  NNG++E +K  ++      +    ++ + +     + I +  +C++I+F    CK
Sbjct:   24 KLLLISFDGFRYDLLDEVL-----TPNIHKWASMSTWFTSGVKSQYVTYTAPNHMSIATGLFEEEHGIVGNYFFDAD-TKKAFDYFNSTGKEGVVNASQESFWYNS--DPIWLTNERWESSRRSAAFYWPNG------------ESQFPYIPHKPKIARPWTIVGDLKSWMKDADDVIDAFIREKEPVNFLAWYVAEPDHTLHGNGFHNKEIEKTLKKLDDLFLYFIKKFDDNNLGADVNIILTADHGHAEIKDHKHVMCVKDYVSGAGFE----MGDHMIYPHSDEIGKQIYANLTSAVKEHGYDVNIHWREEVPERWHYR-NSSRIGKIVFEPQIGSSISFSCTKDLMEKQYGENGTLKFNSSTHGQDPDRPEMRAFLIMRGPAFSENYTIADIPSNVDLYNIMCHVLGITPTENNGTMEIVKRALKENRYLPMTHGFVFNQITDSWSFSLILIPSMCIVIIFFAYGCK 469          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Celegans
Match: C27A7.3 (Ectonucleotide pyrophosphatase/phosphodiesterase C27A7.3 [Source:UniProtKB/Swiss-Prot;Acc:P90755])

HSP 1 Score: 105.916 bits (263), Expect = 7.743e-24
Identity = 98/392 (25.00%), Postives = 175/392 (44.64%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKL-GRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNY---FPFMKRVEDVVYWLSNTRVHI-DFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKE-----QAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPN-PNNGSL 1288
            ++++S DGF  +Y+E+         + + + E G +  R   +FP+ T PNH T+VTGL+PESHGI  N  +D     E   M       + K F +  EPIW   ++L G       W      + G +P          D  P+Y    P  +R++ ++ WL             Y  EPD++GH      Q     +  +++ +  L++ L  + L + VN+++ +DHGM   ++S  I ++  VN       L+   G +  +   E       V   ++ +   ++V    ++P   +Y+  + R+  +I+  +   +     TN     G+HGY+    ++     A+GP+  +N T+P   +V    L  YLLG+     NNG++
Sbjct:   81 LVILSFDGFAKEYLER-----RIVKSLELIAECGVKADRVYPSFPSKTFPNHYTMVTGLYPESHGITDNYVFDPNLYPELLAMRKH----EAKEFYQ-AEPIWSAYKRLTGNRVHCLFWVGCYYNITGYMP----------DVSPDYNQELPLKERIDTLIGWLKLPETERPALITAYLHEPDQAGHMQKNVNQ----ELEEVNNYIDILMKALHDENLLECVNLVIVSDHGMQALNNS--IEVETIVNMD----GLVLSKGVVARIHLNETDRSIDEVAGEIRCKIDGVKVNTINDIPLRKHYS-KSKRVGDIIIEGKPGTSFYKSETN----LGDHGYDYHNENMHTVMFARGPSFLQNVTVPSFQNVQYMNLWLYLLGLEGTVDNNGTI 437          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Celegans
Match: C27A7.3 (Ectonucleotide pyrophosphatase/phosphodiesterase C27A7.3 [Source:UniProtKB/Swiss-Prot;Acc:P90755])

HSP 1 Score: 105.916 bits (263), Expect = 8.283e-24
Identity = 98/392 (25.00%), Postives = 175/392 (44.64%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKL-GRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNY---FPFMKRVEDVVYWLSNTRVHI-DFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKE-----QAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPN-PNNGSL 1288
            ++++S DGF  +Y+E+         + + + E G +  R   +FP+ T PNH T+VTGL+PESHGI  N  +D     E   M       + K F +  EPIW   ++L G       W      + G +P          D  P+Y    P  +R++ ++ WL             Y  EPD++GH      Q     +  +++ +  L++ L  + L + VN+++ +DHGM   ++S  I ++  VN       L+   G +  +   E       V   ++ +   ++V    ++P   +Y+  + R+  +I+  +   +     TN     G+HGY+    ++     A+GP+  +N T+P   +V    L  YLLG+     NNG++
Sbjct:   51 LVILSFDGFAKEYLER-----RIVKSLELIAECGVKADRVYPSFPSKTFPNHYTMVTGLYPESHGITDNYVFDPNLYPELLAMRKH----EAKEFYQ-AEPIWSAYKRLTGNRVHCLFWVGCYYNITGYMP----------DVSPDYNQELPLKERIDTLIGWLKLPETERPALITAYLHEPDQAGHMQKNVNQ----ELEEVNNYIDILMKALHDENLLECVNLVIVSDHGMQALNNS--IEVETIVNMD----GLVLSKGVVARIHLNETDRSIDEVAGEIRCKIDGVKVNTINDIPLRKHYS-KSKRVGDIIIEGKPGTSFYKSETN----LGDHGYDYHNENMHTVMFARGPSFLQNVTVPSFQNVQYMNLWLYLLGLEGTVDNNGTI 407          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Celegans
Match: C27A7.3 (Ectonucleotide pyrophosphatase/phosphodiesterase C27A7.3 [Source:UniProtKB/Swiss-Prot;Acc:P90755])

HSP 1 Score: 105.916 bits (263), Expect = 8.386e-24
Identity = 98/392 (25.00%), Postives = 175/392 (44.64%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKL-GRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNY---FPFMKRVEDVVYWLSNTRVHI-DFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKE-----QAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPN-PNNGSL 1288
            ++++S DGF  +Y+E+         + + + E G +  R   +FP+ T PNH T+VTGL+PESHGI  N  +D     E   M       + K F +  EPIW   ++L G       W      + G +P          D  P+Y    P  +R++ ++ WL             Y  EPD++GH      Q     +  +++ +  L++ L  + L + VN+++ +DHGM   ++S  I ++  VN       L+   G +  +   E       V   ++ +   ++V    ++P   +Y+  + R+  +I+  +   +     TN     G+HGY+    ++     A+GP+  +N T+P   +V    L  YLLG+     NNG++
Sbjct:   81 LVILSFDGFAKEYLER-----RIVKSLELIAECGVKADRVYPSFPSKTFPNHYTMVTGLYPESHGITDNYVFDPNLYPELLAMRKH----EAKEFYQ-AEPIWSAYKRLTGNRVHCLFWVGCYYNITGYMP----------DVSPDYNQELPLKERIDTLIGWLKLPETERPALITAYLHEPDQAGHMQKNVNQ----ELEEVNNYIDILMKALHDENLLECVNLVIVSDHGMQALNNS--IEVETIVNMD----GLVLSKGVVARIHLNETDRSIDEVAGEIRCKIDGVKVNTINDIPLRKHYS-KSKRVGDIIIEGKPGTSFYKSETN----LGDHGYDYHNENMHTVMFARGPSFLQNVTVPSFQNVQYMNLWLYLLGLEGTVDNNGTI 437          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Celegans
Match: C27A7.3 (Ectonucleotide pyrophosphatase/phosphodiesterase C27A7.3 [Source:UniProtKB/Swiss-Prot;Acc:P90755])

HSP 1 Score: 105.916 bits (263), Expect = 9.419e-24
Identity = 98/392 (25.00%), Postives = 175/392 (44.64%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKL-GRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNY---FPFMKRVEDVVYWLSNTRVHI-DFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKE-----QAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPN-PNNGSL 1288
            ++++S DGF  +Y+E+         + + + E G +  R   +FP+ T PNH T+VTGL+PESHGI  N  +D     E   M       + K F +  EPIW   ++L G       W      + G +P          D  P+Y    P  +R++ ++ WL             Y  EPD++GH      Q     +  +++ +  L++ L  + L + VN+++ +DHGM   ++S  I ++  VN       L+   G +  +   E       V   ++ +   ++V    ++P   +Y+  + R+  +I+  +   +     TN     G+HGY+    ++     A+GP+  +N T+P   +V    L  YLLG+     NNG++
Sbjct:   51 LVILSFDGFAKEYLER-----RIVKSLELIAECGVKADRVYPSFPSKTFPNHYTMVTGLYPESHGITDNYVFDPNLYPELLAMRKH----EAKEFYQ-AEPIWSAYKRLTGNRVHCLFWVGCYYNITGYMP----------DVSPDYNQELPLKERIDTLIGWLKLPETERPALITAYLHEPDQAGHMQKNVNQ----ELEEVNNYIDILMKALHDENLLECVNLVIVSDHGMQALNNS--IEVETIVNMD----GLVLSKGVVARIHLNETDRSIDEVAGEIRCKIDGVKVNTINDIPLRKHYS-KSKRVGDIIIEGKPGTSFYKSETN----LGDHGYDYHNENMHTVMFARGPSFLQNVTVPSFQNVQYMNLWLYLLGLEGTVDNNGTI 407          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Zebrafish
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase 5 [Source:ZFIN;Acc:ZDB-GENE-041014-10])

HSP 1 Score: 285.804 bits (730), Expect = 3.471e-90
Identity = 160/390 (41.03%), Postives = 233/390 (59.74%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKW----PEPIWVTLEKLGRLTASHLWPLTDSPVHGKIP-FFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            ++NQ+LL+S DGFR DYI +V      TPNF  L+++G  + + +N + T T PNH TLVTGL  ESHG+V N  YD    N +F      ++  P+ +D W     EP+WVT +K GR + + +WP +D  + G  P  +     ++L        F  RV+ ++ W S     I+F +LY+ EPDESGH+ GP        +  +D  LG L + LK+ GL+DKVN+I+T+DHGM++ S  + I LD YV+   YT+   +PV  + P +GK + VY  LKN NP++ V+ ++E+P   +Y   N RI PLI+  +  W +     NG+ + GNHGYNNS P++ P F+A+GP  RR++T     SVD+YPLMC +L + P PNNGSL
Sbjct:   28 EQNQLLLVSFDGFRWDYINRVP-----TPNFHALMDEGVLVEKVENTYITKTYPNHYTLVTGLHAESHGVVANEMYDPIH-NRSF------SIEGPEVYDAWWWEEAEPLWVTNQKAGRKSGAAMWPGSDVAIGGTFPTHYLRYNASML--------FETRVQKLIDWFSGPEA-INFGVLYWEEPDESGHNLGPESPLMDVVLADIDEKLGFLREKLKSAGLYDKVNLIVTSDHGMTQLSHDKIIELDTYVSRDLYTWIDKSPVVGILPKEGKLEEVYGLLKNANPNMVVYKKEEIPDHYHYR-HNARIMPLIIEVKEGWTVMQN-RNGSFMLGNHGYNNSLPNMHPVFVARGPAFRRDYTKTSMRSVDLYPLMCSILALKPLPNNGSL 394          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Zebrafish
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase 5 [Source:ZFIN;Acc:ZDB-GENE-041014-10])

HSP 1 Score: 286.189 bits (731), Expect = 9.741e-90
Identity = 159/390 (40.77%), Postives = 231/390 (59.23%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKW----PEPIWVTLEKLGRLTASHLWPLTDSPVHGKIP-FFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            ++NQ+LL+S DGFR DYI +V      TPNF  L+++G  + + +N + T T PNH TLVTGL  ESHG+V N  YD          N   ++  P+ +D W     EP+WVT +K GR + + +WP +D  + G  P  +     ++L        F  RV+ ++ W S     I+F +LY+ EPDESGH+ GP        +  +D  LG L + LK+ GL+DKVN+I+T+DHGM++ S  + I LD YV+   YT+   +PV  + P +GK + VY  LKN NP++ V+ ++E+P   +Y   N RI PLI+  +  W +     NG+ + GNHGYNNS P++ P F+A+GP  RR++T     SVD+YPLMC +L + P PNNGSL
Sbjct:   80 EQNQLLLVSFDGFRWDYINRVP-----TPNFHALMDEGVLVEKVENTYITKTYPNHYTLVTGLHAESHGVVANEMYDPIH-------NRSFSIEGPEVYDAWWWEEAEPLWVTNQKAGRKSGAAMWPGSDVAIGGTFPTHYLRYNASML--------FETRVQKLIDWFSGPEA-INFGVLYWEEPDESGHNLGPESPLMDVVLADIDEKLGFLREKLKSAGLYDKVNLIVTSDHGMTQLSHDKIIELDTYVSRDLYTWIDKSPVVGILPKEGKLEEVYGLLKNANPNMVVYKKEEIPDHYHYR-HNARIMPLIIEVKEGWTVMQN-RNGSFMLGNHGYNNSLPNMHPVFVARGPAFRRDYTKTSMRSVDLYPLMCSILALKPLPNNGSL 446          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Zebrafish
Match: enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:NCBI gene;Acc:550586])

HSP 1 Score: 254.988 bits (650), Expect = 1.652e-78
Identity = 147/386 (38.08%), Postives = 223/386 (57.77%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHG---KIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGT-NVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +LL+S DGFR DY+ K        PN +     G  +    N F T T PNH +LVTGL+ ESHG++ +  YD     + F + N +   DP W+D+   PIWV++E+ G   AS +WP +D  +     K  F  +S+ +          F +R+ ++  W++  +  + F+ LY+ EPD SGH+YGP+       V+  +D  +G+L++ L    LW K+N+I+T+DHGM++ S+ R I LD+ V+PS YT   LTPV A+ P++ K   VYN L + + HL+ + + +VP  L+Y  +N RI P+IL+A+  W I     NG     G+HGY+N+ P + PF  A GP  R+ + +   +SVD+YPLMC+L+GI P  NNGS 
Sbjct:   34 LLLVSFDGFRADYLNKYSF-----PNLEKFFSDGVLVHELTNVFTTKTFPNHYSLVTGLYAESHGMLASIMYDPV-AKKHFSIKNDS---DPFWWDE-ATPIWVSVEESGYHAASAMWPGSDVNIQNHTLKYTFKYDSRVS----------FKERLGNITQWMTTDK-SLKFASLYWEEPDFSGHTYGPDNTTEMARVLKEVDGHVGYLMEELDRMELWGKINVIITSDHGMAQCSEERIIRLDDCVSPSSYTLVDLTPVAAIIPLEDK-TTVYNNLSSCHVHLKAYMKNDVPDRLHYK-NNERIQPIILVADEGWTIV---KNGRLPRLGDHGYDNTLPSMHPFLAAHGPAFRKGYKMSSFNSVDLYPLMCHLIGIPPKANNGSF 393          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Zebrafish
Match: enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:NCBI gene;Acc:550586])

HSP 1 Score: 254.988 bits (650), Expect = 1.652e-78
Identity = 147/386 (38.08%), Postives = 223/386 (57.77%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHG---KIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGT-NVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +LL+S DGFR DY+ K        PN +     G  +    N F T T PNH +LVTGL+ ESHG++ +  YD     + F + N +   DP W+D+   PIWV++E+ G   AS +WP +D  +     K  F  +S+ +          F +R+ ++  W++  +  + F+ LY+ EPD SGH+YGP+       V+  +D  +G+L++ L    LW K+N+I+T+DHGM++ S+ R I LD+ V+PS YT   LTPV A+ P++ K   VYN L + + HL+ + + +VP  L+Y  +N RI P+IL+A+  W I     NG     G+HGY+N+ P + PF  A GP  R+ + +   +SVD+YPLMC+L+GI P  NNGS 
Sbjct:   34 LLLVSFDGFRADYLNKYSF-----PNLEKFFSDGVLVHELTNVFTTKTFPNHYSLVTGLYAESHGMLASIMYDPV-AKKHFSIKNDS---DPFWWDE-ATPIWVSVEESGYHAASAMWPGSDVNIQNHTLKYTFKYDSRVS----------FKERLGNITQWMTTDK-SLKFASLYWEEPDFSGHTYGPDNTTEMARVLKEVDGHVGYLMEELDRMELWGKINVIITSDHGMAQCSEERIIRLDDCVSPSSYTLVDLTPVAAIIPLEDK-TTVYNNLSSCHVHLKAYMKNDVPDRLHYK-NNERIQPIILVADEGWTIV---KNGRLPRLGDHGYDNTLPSMHPFLAAHGPAFRKGYKMSSFNSVDLYPLMCHLIGIPPKANNGSF 393          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Zebrafish
Match: enpp7.1 (ectonucleotide pyrophosphatase/phosphodiesterase 7, tandem duplicate 1 [Source:NCBI gene;Acc:557756])

HSP 1 Score: 211.46 bits (537), Expect = 8.787e-62
Identity = 150/473 (31.71%), Postives = 236/473 (49.89%), Query Frame = 2
Query:  137 RNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP------FMKRVEDVVY-WLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLT-------PVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVY----GNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNK-----KKDVEENMKPTYA 1486
            +N++LLIS DGFR DY   V      TPN D +   G +       F TIT P H TL++G + E+HG++ N +++ T   E         +ND  ++D    PIW+T ++ G  T S  +P       G    +Q  +  + +  P ++       +M++V+ V+  W  +    +DF  LYF +PD +GH YGP+      AV  +D  +G++ +  K  GL D +NII+TADHGMS      Q+      +   ++   L        P G L P +G    VYNALK  +PHL V+ ++++PA L+Y+  + R+ P+IL A+  + I     NG  V+    G HGY+N   D++PFF A GP+  RN  +    +V+VYPLMC+L+GI P  N+GSL   + +++        S    ++N F  L        L  +++ S  + K  K       D+ E+  P + 
Sbjct:   27 KNKLLLISFDGFRWDYDRDVD-----TPNLDKMAVDGVKAAYVTPPFLTITSPTHFTLLSGRYIENHGVIHNNWFNTT-TQEKKQYYMTQFVND--YWDNGSLPIWITAQRQGLKTGSLHFP-------GTAAKYQNEKIKVGEVEPRFYDHTNETLWMEKVDKVMKDWFKDQD--LDFVTLYFGDPDSTGHKYGPDSPERREAVKKVDRTVGYIRETAKKHGLSDHLNIIITADHGMSTVFKGDQVKEIVLTDIPGFSLKDLKFHMVDYGPFGMLLPKEGMLDKVYNALKGGHPHLNVYKKEDMPARLHYS-KHPRLLPIILYADPGYVI-----NGFYVFQNNKGEHGYDNEVMDMKPFFRAVGPDFHRNLLVGPFETVNVYPLMCHLIGIRPEINDGSLVNTRHMLKSNGETCESS----LRNVFIGLGAVAGFLLLAFVVITSYKVHKRRKVNQRYSLDMHEDKSPVHT 472          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Xenopus
Match: arfip1 (ADP ribosylation factor interacting protein 1 [Source:Xenbase;Acc:XB-GENE-951005])

HSP 1 Score: 266.544 bits (680), Expect = 6.688e-83
Identity = 147/386 (38.08%), Postives = 223/386 (57.77%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP---FMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +++++S DGFR DY+ +        PN D  +++G ++   KN F T T PNH +LVTGL+ ESHGIV N  YD     + F MN+ N+    KW+D+   PIWVT +K G  +   +WP  + P+H             L+   NY P   F +RV +V  WL+     I+F+ +Y+ EPD SGH +GP+       V+  +D  +G+L+  LK   LWD VN+I+T+DHGM++ S  R I L++ + P  YT     PV A+ P+    Q VY+ L+N +PH++V+ ++E+P   +Y   N RI PL+L+A+  W I     +  ++ G+HGY+N    + PF  A GP  R+ + +   +SVD+YPLMC++LGI   PNNG+L
Sbjct:   29 RLIILSFDGFRADYLTRFPM-----PNLDEFMKEGVQVEEVKNVFITKTFPNHYSLVTGLYAESHGIVANHMYDND-TRQVFHMNDSNS----KWWDE-ATPIWVTNQKQGHKSGCAMWPGCNVPMHN----------VTLNASLNYNPNVTFTERVNNVTMWLTRPNDPINFATIYWEEPDASGHRFGPDDHDNMAKVLKEVDEHVGYLMSELKKAKLWDTVNVIITSDHGMAQCSKDRIIKLNDCIGPGNYTLVDDNPVAAILPL-SDTQLVYDLLRNCHPHMKVYRKEEIPERWHYK-HNSRIQPLLLVADEGWMITQN--HSISMLGDHGYDNDLHSMHPFLAAHGPAFRKGYRMRTINSVDIYPLMCHILGITGLPNNGTL 389          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Xenopus
Match: enpp7 (ectonucleotide pyrophosphatase/phosphodiesterase 7 [Source:NCBI gene;Acc:100422804])

HSP 1 Score: 210.69 bits (535), Expect = 1.966e-61
Identity = 143/451 (31.71%), Postives = 236/451 (52.33%), Query Frame = 2
Query:  140 NQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQ--ESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGM-SENSDSRQIPLDEYVNPSW----YTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDVEENM 1471
            +++LLIS DGFR DY + V      TPN + +   G +      AF TIT P H TL+TG + E+HG++ N ++D T   +      Q       W+D    PIW+T ++ G  T S  +P  ++    +    +  ES+  +  N   +    + V+ V+ WL  T   +DF  LYF EPD +GH YGP+ +     V  +D  +G++ + +K  GL D++NII+TADHGM + +    +I L+   N S     +      P G L P +G  + VYNALKN +P L VF ++EVPA L+Y+ +N RI PL++  +  + +   A    N  G HG++N + +++  F A GP+ +++  +    SV VY LMC LLG+ P PN+GSL+  + ++  K     C     +  +  L      +    +I + ++++ +  K+K  ++++
Sbjct:   30 HKLLLISFDGFRWDYDQDVD-----TPNMNIMARDGVKAKYMTPAFITITSPCHFTLLTGKYIENHGVIHNMYFDVTTGQKIPYHGTQGV---SMWWDNGSLPIWITAQRQGLNTGSLFFPGGNATYRDENVNVKKVESRTHIWGNETEW---RENVDTVMRWL--TEQDLDFVALYFGEPDSTGHKYGPDSEERKQMVSQVDRTVGYIRKRVKDHGLEDRLNIIITADHGMRTVHKGPDEIILNNLPNFSLSDLQFHLVDYGPSGLLIPKEGNLEKVYNALKNAHPKLNVFKKEEVPARLHYS-NNARITPLVVYGDPGYVVHGFAKLQFN-KGEHGFDNDDMEMKTIFRAVGPSFKQDLVVEPFESVHVYALMCELLGVKPEPNDGSLDVTRNMLVDKDPNPACFPASILHATIGLSAVLGVLLLSFIITMITVSVKRHKKRKRAQKSL 465          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Xenopus
Match: ENSXETT00000030581.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:36543347:36556401:1 gene:ENSXETG00000003476.1 transcript:ENSXETT00000030581.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.282 bits (495), Expect = 4.483e-56
Identity = 122/394 (30.96%), Postives = 212/394 (53.81%), Query Frame = 2
Query:  140 NQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPP-----NYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMS---ENSDSRQIPLDEYVN-PSWYTYTLLT--PVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            N++L+IS DGFR +Y E V      TPN DYL E G +       F T+T P+H T +TG + E HG++ N  ++   P     ++ +      +W+D    P+W+T +  G  T S  +P       G   + +++ F  L   P     N   + + ++ V+ W +    ++DF  LY+ EPD++GH  GP  +     +  +D  +G+L+  ++   L D++N+I+T+DHGM+   +  D  +I L +Y+N      + +L     G + P +GKE+ +Y  LKN +PHL V+ ++E P   +++    R+ P++L  +  +++  +     N  G+HG++N+E D++  F A GP+ ++N+      S+ +YPLMC LLG+ P P+NGSL
Sbjct:   32 NKLLVISFDGFRWNYDEDVY-----TPNLDYLTEIGVKAKYISPPFVTMTSPSHFTTITGRWIEDHGVIHNLMFN---PETLEKLSFKKTQTMSEWWDNGVLPLWITAQNQGLKTGSFHYP------GGGAKYGEQAVFKSLVEEPDHPDSNETEWRENIDIVMKWFNEE--NLDFVTLYYGEPDKTGHLIGPETEKRKEIIQQIDRTIGYLLDAIQKNNLKDQLNVIITSDHGMTNVKKQPDVTEIKLADYINFKDLVKFDILDYGGFGMVLPKEGKEEEIYQKLKNAHPHLNVYKKEEFPEHFHFS-KFKRVLPILLYGDLGYSVNGRLILYVN-KGDHGFDNNEMDMKMIFRAFGPDFKKNYISNPFDSIHIYPLMCKLLGVIPEPHNGSL 407          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Xenopus
Match: ENPP1 (ectonucleotide pyrophosphatase/phosphodiesterase 1 [Source:NCBI gene;Acc:100422807])

HSP 1 Score: 182.185 bits (461), Expect = 7.158e-49
Identity = 121/392 (30.87%), Postives = 182/392 (46.43%), Query Frame = 2
Query:  122 QWFLDRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWL---SNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNG-TNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGS 1285
            QW   +  +LL S+DGFR +Y+      G   P    L + G+     +  +P+ T PNH ++VTGL+PESHG+V N  YD    N  F + N    + P W+    EP+W+T    G   A+  WP +D  + G  P        +     +  PF +RV  ++ WL      R H  F  LY  EPD SGH +GP       A++ +D ++G L+  LK   L   +N+IL +DHGM E        L  Y+ PS     +  P   L P K  ++           +   +++Q +P   ++   N RI  L    + KW +A   ++  T V G HG +N    +Q  FI  GP  +    +    ++++Y LMC LL I P  NNG+
Sbjct:  129 QWRFSKPPLLLFSLDGFRSEYLH---TWGELLPVISKLQKCGTYTPNLRPVYPSKTFPNHYSIVTGLYPESHGLVDNKMYDPK-RNALFTLRNTEKFH-PSWYQG--EPVWITAMNQGLKAATFFWPGSDVRIKGTYP-------NIYKIYNSTVPFEERVMSILRWLRLPEQERPH--FYTLYLEEPDHSGHGHGPVSSAVIKALMGVDRIVGMLMDGLKQMQLDKCINLILASDHGMEEARCENVAFLSSYLEPSDSYLVIPGPAARLRPTKLPDE-----------YFSSYFKQNLPKRFHF-AKNDRIELLNFYTDPKWQVAKTRSDAKTCVGGFHGSDNRFESMQALFIGFGPGFKFKTEVELFENIEIYNLMCDLLEIVPANNNGT 492          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Xenopus
Match: ENPP1 (ectonucleotide pyrophosphatase/phosphodiesterase 1 [Source:NCBI gene;Acc:100422807])

HSP 1 Score: 181.8 bits (460), Expect = 1.047e-48
Identity = 121/392 (30.87%), Postives = 183/392 (46.68%), Query Frame = 2
Query:  122 QWFLDRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWL---SNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNG-TNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGS 1285
            QW   +  +LL S+DGFR +Y+      G   P    L + G+     +  +P+ T PNH ++VTGL+PESHG+V N  YD    N  F + N    + P W+    EP+W+T    G   A+  WP +D  + G  P   +   + +       PF +RV  ++ WL      R H  F  LY  EPD SGH +GP       A++ +D ++G L+  LK   L   +N+IL +DHGM E        L  Y+ PS     +  P   L P K  ++           +   +++Q +P   ++   N RI  L    + KW +A   ++  T V G HG +N    +Q  FI  GP  +    +    ++++Y LMC LL I P  NNG+
Sbjct:  145 QWRFSKPPLLLFSLDGFRSEYLH---TWGELLPVISKLQKCGTYTPNLRPVYPSKTFPNHYSIVTGLYPESHGLVDNKMYDPK-RNALFTLRNTEKFH-PSWYQG--EPVWITAMNQGLKAATFFWPGSDVRIKGTYPNIYKIYNSTV-------PFEERVMSILRWLRLPEQERPH--FYTLYLEEPDHSGHGHGPVSSAVIKALMGVDRIVGMLMDGLKQMQLDKCINLILASDHGMEEARCENVAFLSSYLEPSDSYLVIPGPAARLRPTKLPDE-----------YFSSYFKQNLPKRFHF-AKNDRIELLNFYTDPKWQVAKTRSDAKTCVGGFHGSDNRFESMQALFIGFGPGFKFKTEVELFENIEIYNLMCDLLEIVPANNNGT 508          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Mouse
Match: Enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:MGI Symbol;Acc:MGI:2682634])

HSP 1 Score: 265.774 bits (678), Expect = 1.108e-82
Identity = 149/384 (38.80%), Postives = 225/384 (58.59%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLE-KLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            ++LL+S DGFR DY++         P+    I++G  +   KN F T T PNH ++VTGL+ ESHGIV N+ YD      T    +++N  DP W++   EPIWVT + +  R +A+ +WP TD P+H        S F    N  +   F +R+ +V  WLS++   + F+ LY+ EPD SGH YGP  +     V+  +D ++G ++  LK  GLWD +N+I+T+DHGM++ S +R I LD  ++ S Y+   LTPV A+ P K     VY+ LK  NPH+ V+ ++ +P    Y   + RI P+IL+AE  W I    ++     G+HGY+NS P + PF  A GP  R+ +     ++VD+YP+MC++LG+ P+PNNG+L
Sbjct:   30 RLLLVSFDGFRADYLKSYD-----LPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDSV----TKKHFSESNDKDPFWWNG-AEPIWVTNQLQENRSSAAAMWPGTDVPIHN----ITASYFM---NYSSSVSFKERLGNVTTWLSSSNPPVTFAALYWEEPDVSGHKYGPEDKENMRRVLKEVDDLIGDIVLKLKVLGLWDSLNVIITSDHGMAQCSKNRLIDLDSCIDRSNYSVIDLTPVAAILP-KINVTEVYDKLKRCNPHMNVYLKEAIPNRFYYQ-HSSRIQPIILVAEEGWTITLNKSSFK--LGDHGYDNSLPSMHPFLAAHGPAFRKGYRQSTINTVDIYPMMCHILGLKPHPNNGTL 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Mouse
Match: Enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:MGI Symbol;Acc:MGI:2682634])

HSP 1 Score: 265.774 bits (678), Expect = 1.108e-82
Identity = 149/384 (38.80%), Postives = 225/384 (58.59%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLE-KLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            ++LL+S DGFR DY++         P+    I++G  +   KN F T T PNH ++VTGL+ ESHGIV N+ YD      T    +++N  DP W++   EPIWVT + +  R +A+ +WP TD P+H        S F    N  +   F +R+ +V  WLS++   + F+ LY+ EPD SGH YGP  +     V+  +D ++G ++  LK  GLWD +N+I+T+DHGM++ S +R I LD  ++ S Y+   LTPV A+ P K     VY+ LK  NPH+ V+ ++ +P    Y   + RI P+IL+AE  W I    ++     G+HGY+NS P + PF  A GP  R+ +     ++VD+YP+MC++LG+ P+PNNG+L
Sbjct:   30 RLLLVSFDGFRADYLKSYD-----LPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDSV----TKKHFSESNDKDPFWWNG-AEPIWVTNQLQENRSSAAAMWPGTDVPIHN----ITASYFM---NYSSSVSFKERLGNVTTWLSSSNPPVTFAALYWEEPDVSGHKYGPEDKENMRRVLKEVDDLIGDIVLKLKVLGLWDSLNVIITSDHGMAQCSKNRLIDLDSCIDRSNYSVIDLTPVAAILP-KINVTEVYDKLKRCNPHMNVYLKEAIPNRFYYQ-HSSRIQPIILVAEEGWTITLNKSSFK--LGDHGYDNSLPSMHPFLAAHGPAFRKGYRQSTINTVDIYPMMCHILGLKPHPNNGTL 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Mouse
Match: Enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase 5 [Source:MGI Symbol;Acc:MGI:1933830])

HSP 1 Score: 257.684 bits (657), Expect = 2.360e-79
Identity = 140/391 (35.81%), Postives = 225/391 (57.54%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP------FMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +  +VL++S DGFR DY+ KV      TP+F Y+++ G  + +  N F T T PNH TLVTGLF E+HGIV N  +D    N++F + + + + D K++++   PIW+T ++ G  + + +WP  D  +H   P +             Y P      F  RV  ++ W +  +  I+   LY+ EPD++GH  GP+     + +  +D  LG+LI++LK   LW+ VN+I+T+DHGM++ S  R I LD Y++   YT    +PV A+ P +GK   VY+AL   +P+L V+ ++E+P   +Y   N R+ P++ +A+  W I    ++   + GNHGY+N+  ++ P F+A GP  R+NFT    +S D+Y L+C+LL +   P+NGS 
Sbjct:   26 EEQKVLVVSFDGFRWDYLYKVP-----TPHFHYIMKNGVHVNQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDPIL-NKSFSLEHMD-IYDSKFWEE-ATPIWITNQRAGHASGAAMWPGADVKIHDSFPTY-------------YLPYNESVSFEDRVAKIIEWFT-AKDPINLGFLYWEEPDDTGHDVGPDSPLMGSVISDVDHKLGYLIKMLKRAKLWNNVNLIVTSDHGMTQCSKQRVIELDRYLDKEHYTLIDHSPVAAILPKEGKFDEVYDALAGAHPNLTVYKKEEIPERWHYK-HNDRVQPIVAVADEGWYILQNKSDDF-LLGNHGYDNALAEMHPIFLAHGPAFRKNFTKEAMNSTDLYSLLCHLLNLTALPHNGSF 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Mouse
Match: Enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase 5 [Source:MGI Symbol;Acc:MGI:1933830])

HSP 1 Score: 257.684 bits (657), Expect = 2.360e-79
Identity = 140/391 (35.81%), Postives = 225/391 (57.54%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP------FMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +  +VL++S DGFR DY+ KV      TP+F Y+++ G  + +  N F T T PNH TLVTGLF E+HGIV N  +D    N++F + + + + D K++++   PIW+T ++ G  + + +WP  D  +H   P +             Y P      F  RV  ++ W +  +  I+   LY+ EPD++GH  GP+     + +  +D  LG+LI++LK   LW+ VN+I+T+DHGM++ S  R I LD Y++   YT    +PV A+ P +GK   VY+AL   +P+L V+ ++E+P   +Y   N R+ P++ +A+  W I    ++   + GNHGY+N+  ++ P F+A GP  R+NFT    +S D+Y L+C+LL +   P+NGS 
Sbjct:   26 EEQKVLVVSFDGFRWDYLYKVP-----TPHFHYIMKNGVHVNQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDPIL-NKSFSLEHMD-IYDSKFWEE-ATPIWITNQRAGHASGAAMWPGADVKIHDSFPTY-------------YLPYNESVSFEDRVAKIIEWFT-AKDPINLGFLYWEEPDDTGHDVGPDSPLMGSVISDVDHKLGYLIKMLKRAKLWNNVNLIVTSDHGMTQCSKQRVIELDRYLDKEHYTLIDHSPVAAILPKEGKFDEVYDALAGAHPNLTVYKKEEIPERWHYK-HNDRVQPIVAVADEGWYILQNKSDDF-LLGNHGYDNALAEMHPIFLAHGPAFRKNFTKEAMNSTDLYSLLCHLLNLTALPHNGSF 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Mouse
Match: Enpp7 (ectonucleotide pyrophosphatase/phosphodiesterase 7 [Source:MGI Symbol;Acc:MGI:3027917])

HSP 1 Score: 204.912 bits (520), Expect = 9.729e-60
Identity = 130/389 (33.42%), Postives = 203/389 (52.19%), Query Frame = 2
Query:  137 RNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLT-------PVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNG 1282
            ++++LL+S DGFR +Y + V      TPN D + ++G +      AF T+T P H TLVTG + E+HG+V N FY+ T    T  +     L   +W+D    PIW+T ++ G  T S  +P  +    G+       +  +L N  N   +   V+ V+ W     V      LYF EPD +GH YGP  Q   + V  +D  +G+L   +K   L D +N+I+T+DHGM+   + +   L E+   S +T+  +        P+G L P +G  + VY+ LK+ +P L V+ +++ P + +Y  +N RI PL++ ++  + I H   N     G HG+NN + D++  F A GP+ +    +    SV VY LMC LLGI P PN+G
Sbjct:   27 QHKLLLVSFDGFRWNYDQDVD-----TPNLDSMAQEGVKAQYMTPAFVTMTSPCHFTLVTGKYIENHGVVHNMFYNTT---STVRLPYHATLGIQRWWDNGSIPIWITAQRQGLKTGSFFYPGGNVTYQGEAVTMSRKE-GVLHNYKNETEWRGNVDTVMKWFLEEDV--SLVTLYFGEPDSTGHKYGPESQERKDMVKQVDRTVGYLRDSIKRHHLSDSLNLIITSDHGMT-TVNKKASDLVEFHKFSNFTFQDIQFELLDYGPIGMLIPKEGMLEKVYSVLKDAHPRLHVYKKEDFPKNFHY-ANNPRITPLLMYSDLGYVI-HGRVNVQFNNGEHGFNNQDMDMKTIFRAVGPSFKAGLEVEPFESVHVYELMCQLLGIVPEPNDG 401          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. UniProt/SwissProt
Match: sp|Q9Y6X5|ENPP4_HUMAN (Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3)

HSP 1 Score: 270.011 bits (689), Expect = 1.784e-83
Identity = 148/384 (38.54%), Postives = 226/384 (58.85%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLE-KLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            ++LL+S DGFR DY++  +      P+    I++G  +   KN F T T PNH ++VTGL+ ESHGIV N+ YD        D N++    DP W+++   PIWVT + +  R +A+ +WP TD P+H  I     S F    N  +   F +R+ ++  WL+N+   + F+ LY+ EPD SGH YGP  +   + V+  +D ++G L+Q LK  GLW+ +N+I+T+DHGM++ S  R I LD  ++ S+YT   L+PV A+ P K     VYN LKN +PH+ V+ ++++P    Y   N RI P+IL+A+  W I       +   G+HGY+NS P + PF  A GP   + +     + VD+YP+MC++LG+ P+PNNG+ 
Sbjct:   27 KLLLVSFDGFRADYLKNYEF-----PHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSNDK----DPFWWNE-AVPIWVTNQLQENRSSAAAMWPGTDVPIHDTI----SSYFM---NYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLIGDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHSYYTLIDLSPVAAILP-KINRTEVYNKLKNCSPHMNVYLKEDIPNRFYYQ-HNDRIQPIILVADEGWTIV--LNESSQKLGDHGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGTF 389          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. UniProt/SwissProt
Match: sp|Q9UJA9|ENPP5_HUMAN (Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Homo sapiens OX=9606 GN=ENPP5 PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 2.661e-83
Identity = 147/391 (37.60%), Postives = 232/391 (59.34%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP------FMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            D+ +VLL+S DGFR DY+ KV      TP+F Y+++ G  + +  N F T T PNH TLVTGLF E+HGIV N  +D    N++F +++ N + D K++++   PIW+T ++ G  + + +WP TD  +H + P              +Y P      F  RV  ++ W + ++  I+  +LY+ +PD+ GH  GP+       +  +D  LG+LIQ+LK   LW+ +N+I+T+DHGM++ S+ R I LD+Y++   YT    +PV A+ P +GK   VY AL + +P+L V+ +++VP   +Y   N RI P+I +A+  W I    ++   + GNHGY+N+  D+ P F+A GP  R+NF+    +S D+YPL+C+LL I   P+NGS 
Sbjct:   26 DQQKVLLVSFDGFRWDYLYKVP-----TPHFHYIMKYGVHVKQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDP-IRNKSFSLDHMN-IYDSKFWEE-ATPIWITNQRAGHTSGAAMWPGTDVKIHKRFP-------------THYMPYNESVSFEDRVAKIIEWFT-SKEPINLGLLYWEDPDDMGHHLGPDSPLMGPVISDIDKKLGYLIQMLKKAKLWNTLNLIITSDHGMTQCSEERLIELDQYLDKDHYTLIDQSPVAAILPKEGKFDEVYEALTHAHPNLTVYKKEDVPERWHYKY-NSRIQPIIAVADEGWHILQNKSDDF-LLGNHGYDNALADMHPIFLAHGPAFRKNFSKEAMNSTDLYPLLCHLLNITAMPHNGSF 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. UniProt/SwissProt
Match: sp|A2VDP5|ENPP4_BOVIN (Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Bos taurus OX=9913 GN=ENPP4 PE=2 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 1.621e-82
Identity = 150/387 (38.76%), Postives = 229/387 (59.17%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLE-KLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP---FMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            ++LL+S DGFR DY++  +      P+    I++G  + + KN F T T PNH ++VTGL+ ESHGIV N+ YD        D N++    DP W+++   PIWVT + +  R +A+ +WP TD P+H   P    S F       NY P   F +R+ +V  WLS++   + F+ LY+ EPD SGH YGP  +     V+  +D  +G L+  LK  GLW+ +N+I+T+DHGM++ S  R I LD  ++PS+YT   LTPV A+ P K  +  VY+ LK  +PH+ V+ ++++PA  +Y   + RI P+IL+A+  W I       +   G+HGY+NS P + PF  A GP   + +     ++VD+YP+MC++LG+ P+PNNG+ 
Sbjct:   27 KLLLVSFDGFRADYLQNYEF-----PHLQNFIKEGVLVEQVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDVNTKKHFSDHNDK----DPFWWNE-AVPIWVTNQLQDNRSSAAAMWPGTDVPIHNSTP----SYFM------NYSPSVSFRERLGNVTTWLSSSNPPVTFATLYWEEPDASGHKYGPEDKENMRRVLEEIDEHIGELVHRLKVLGLWESLNVIITSDHGMTQCSKDRVINLDGCLDPSYYTLIDLTPVAAILP-KINKTKVYSKLKVCDPHMNVYLKEDIPARFHYQ-HSDRIQPIILVADEGWTIV--LNKSSLKLGDHGYDNSLPSMNPFLAAHGPAFHKGYKHSSINTVDIYPMMCHILGLKPHPNNGTF 389          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. UniProt/SwissProt
Match: sp|Q0VA77|ENPP4_XENTR (Bis(5'-adenosyl)-triphosphatase enpp4 OS=Xenopus tropicalis OX=8364 GN=enpp4 PE=2 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 3.543e-82
Identity = 147/386 (38.08%), Postives = 223/386 (57.77%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP---FMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +++++S DGFR DY+ +        PN D  +++G ++   KN F T T PNH +LVTGL+ ESHGIV N  YD     + F MN+ N+    KW+D+   PIWVT +K G  +   +WP  + P+H             L+   NY P   F +RV +V  WL+     I+F+ +Y+ EPD SGH +GP+       V+  +D  +G+L+  LK   LWD VN+I+T+DHGM++ S  R I L++ + P  YT     PV A+ P+    Q VY+ L+N +PH++V+ ++E+P   +Y   N RI PL+L+A+  W I     +  ++ G+HGY+N    + PF  A GP  R+ + +   +SVD+YPLMC++LGI   PNNG+L
Sbjct:   29 RLIILSFDGFRADYLTRFPM-----PNLDEFMKEGVQVEEVKNVFITKTFPNHYSLVTGLYAESHGIVANHMYDND-TRQVFHMNDSNS----KWWDE-ATPIWVTNQKQGHKSGCAMWPGCNVPMHN----------VTLNASLNYNPNVTFTERVNNVTMWLTRPNDPINFATIYWEEPDASGHRFGPDDHDNMAKVLKEVDEHVGYLMSELKKAKLWDTVNVIITSDHGMAQCSKDRIIKLNDCIGPGNYTLVDDNPVAAILPL-SDTQLVYDLLRNCHPHMKVYRKEEIPERWHYK-HNSRIQPLLLVADEGWMITQN--HSISMLGDHGYDNDLHSMHPFLAAHGPAFRKGYRMRTINSVDIYPLMCHILGITGLPNNGTL 389          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. UniProt/SwissProt
Match: sp|Q6AX80|ENPP4_XENLA (Bis(5'-adenosyl)-triphosphatase enpp4 OS=Xenopus laevis OX=8355 GN=enpp4 PE=2 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 6.101e-82
Identity = 142/383 (37.08%), Postives = 223/383 (58.22%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +++L+S DGFR DY+ +        PN    +++G  +   KN F T T PNH +LVTGL+ ESHGIV N  YD     + F MN+ ++    KW+D+   PIW+T +K G  +   +WP +D  +H   P    S F   ++      F +RV  +  WL+     I+F+ +Y+ EPD SGH YGP+  G  + V+  +D  +G+L+  LK   LWD VN+I+T+DHGM++ S+ R I L++ + P  YT     PV ++ P+   +  VY+ L+N +PH++V+ ++E+P   +Y   N RI PL+L+A+  W I    +   ++ G+HGY+N    + PF  A GP  R+++ +   ++VDVYP+MC +LGI   PNNG+L
Sbjct:   29 KLILLSFDGFRADYLTRFPM-----PNLQEFMKEGVEVEEVKNVFITKTFPNHYSLVTGLYAESHGIVANRMYDAD-TKQVFHMNDSHS----KWWDE-ATPIWLTNQKQGHRSGCAMWPGSDVSIHNTTP----SDFLYYNHT---VSFAQRVNHITTWLTRPNDSINFAAIYWEEPDASGHRYGPDDYGNMSGVLKEVDKNVGYLMSELKKANLWDTVNVIITSDHGMAQCSNDRIIKLNDCIGPGNYTLVDDNPVASILPISDTKN-VYDLLRNCHPHMKVYMKEEIPDRWHYK-HNSRIQPLLLVADEGWMITQNES--ISMLGDHGYDNDLHSMHPFLAAHGPAFRKSYKMRTINNVDVYPMMCLILGITGQPNNGTL 389          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. TrEMBL
Match: A0A183P0K0 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS7886 PE=4 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 4.484e-136
Identity = 206/393 (52.42%), Postives = 268/393 (68.19%), Query Frame = 2
Query:  119 SQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKT--PNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNG-TNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            S++F     VLLISMDGFRHDYIE  K   G    PNFD LI +G R M + N +PTITLPNH+TL+TGL+PE+HG+V N+  DK +PN+ F + +Q +LN   W   WPEPIWVTL+K GR T S LWPLTD  V   +PF + SQ+ LL++  + + + +R+ D+++WL N R H++  + YF EPDE+GHSYGPN +     V  LD  LGHL+  +K +GL DKV+IILTADHGMSE S++R IPLD+Y++ S Y YT L+ +G LYP  GK + VY  LKN +P L V+ R EVP  LN+NI N R+ PLILIA+  W I    ++   NV G+HGY     ++ PFFIA GP+ +   ++P  H+VDVYPLMC LL I PNPNNGSL
Sbjct:   74 SRFFNHDKTVLLISMDGFRHDYIELTKTHLGSNALPNFDRLISEGVRAMESINVYPTITLPNHRTLITGLYPENHGVVGNSLLDKKWPNKIFSIYDQESLNHAPWLTDWPEPIWVTLQKNGRYTGSLLWPLTDQFVSDDLPFQRVSQYALLNDYEHRYAYDQRIRDILWWLKNPRYHLNLILAYFEEPDETGHSYGPNSKHVAKVVQTLDETLGHLLDGIKKRGLSDKVDIILTADHGMSETSNTRLIPLDKYIDNSLYNYTQLSTMGFLYPAPGKFEEVYKRLKNAHPKLDVYRRDEVPTYLNFNITNSRMPPLILIAKPSWKIVKNTSHPYANVSGDHGYATDFSEMYPFFIASGPSFKIAESVPTVHAVDVYPLMCALLNIQPNPNNGSL 466          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. TrEMBL
Match: A0A183K6X1 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10747 PE=4 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.680e-135
Identity = 206/393 (52.42%), Postives = 268/393 (68.19%), Query Frame = 2
Query:  119 SQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKT--PNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNG-TNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            S++F     VLLISMDGFRHDYIE  K   G    PNFD LI +G R M + N +PTITLPNH+TL+TGL+PE+HG+V N+  DK +PN+TF + +Q +LN   W   WPEPIWVTL+K G  T S LWPLTD  V   +PF + SQ+ LL++  + + + +R+ D+++WL N R H++  + YF EPDE+GHSYGPN +     V  LD  LGHL+  +K +GL DKV+IILTADHGMSE S++R IPLD+Y++ S Y YT L+ +G LYP  GK + VY  LKN +P L V+ R EVP  LN+NI N R+ PLILIA+  W I    ++   NV G+HGY     ++ PFFIA GP+ +   ++P  H+VDVYPLMC LL I PNPNNGSL
Sbjct:   74 SRFFNHDKTVLLISMDGFRHDYIELTKTHLGSNALPNFDRLISEGVRAMESINVYPTITLPNHRTLITGLYPENHGVVGNSLLDKKWPNKTFSIYDQESLNHAPWLTDWPEPIWVTLQKNGGYTGSLLWPLTDQFVSDDLPFQRVSQYALLNDYEHRYAYDQRIRDILWWLKNPRYHLNLILAYFEEPDETGHSYGPNSKHVAKVVQTLDETLGHLLDGIKKRGLSDKVDIILTADHGMSETSNTRLIPLDKYIDHSSYNYTQLSTMGFLYPAPGKFEEVYKRLKNAHPKLDVYRRDEVPTYLNFNITNSRMPPLILIAKPSWKIVKNTSHPYANVSGDHGYATDFSEMYPFFIASGPSFKIAESVPTVHAVDVYPLMCALLNIEPNPNNGSL 466          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. TrEMBL
Match: A0A094ZUJ8 (Bis(5'-adenosyl)-triphosphatase enpp4 OS=Schistosoma haematobium OX=6185 GN=MS3_06274 PE=4 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.852e-135
Identity = 219/457 (47.92%), Postives = 299/457 (65.43%), Query Frame = 2
Query:  119 SQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKT--PNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNG-TNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLLCTSIAVFWLCVI-ILFSLNICKCNKKKDVEENMKP 1477
            S++F     VLLISMDGFRHDYIE  K   G    PNFD LI +G R M + N +PTITLPNH+TL+TGL+PE+HG+V N+  DK +PN+TF + +Q +LN   W   WPEPIWVTL+K G  T S LWPLTD  V   +PF + SQ+ LL++  + + + +R+ D+++WL N R H++  + YF EPDE+GHSYGPN +     V  LD  LGHL+  +K +GL DKV+IILTADHGMSE S++R IPLD+Y++ S Y YT L+ +G LYP  GK + VY  LKN +P L V+ R EVP  LN+NI N R+ PLILIA+  W I    ++   NV G+HGY     ++ PFFIA GP+ +   ++P  H+VDVYPLMC LL I PNPNNGSLERI  I++P    +L ++  +     W++     + ++ +I +LF + +C      + +E  +P
Sbjct:   74 SRFFNHDKTVLLISMDGFRHDYIELTKTHLGSNALPNFDRLISEGVRAMESINVYPTITLPNHRTLITGLYPENHGVVGNSLLDKKWPNKTFSIYDQESLNHAPWLTDWPEPIWVTLQKNGGYTGSLLWPLTDQFVSDDLPFQRVSQYALLNDYEHRYAYDQRIRDILWWLKNPRYHLNLILAYFEEPDETGHSYGPNSKHVAKVVQTLDETLGHLLDGIKKRGLSDKVDIILTADHGMSETSNTRLIPLDKYIDHSSYNYTQLSTMGFLYPAPGKFEEVYKRLKNAHPKLDVYRRDEVPTYLNFNITNSRMPPLILIAKPSWKIVKNTSHPYANVSGDHGYATDFSEMYPFFIASGPSFKIAESVPTVHAVDVYPLMCALLNIQPNPNNGSLERISNILKPDVANRLLNLNSWSYLWKWIIFDLRFILFISIICVLFMILLCSIVVVMNRKETNEP 530          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. TrEMBL
Match: A0A183LHG9 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS3244 PE=4 SV=1)

HSP 1 Score: 411.379 bits (1056), Expect = 1.093e-134
Identity = 205/393 (52.16%), Postives = 267/393 (67.94%), Query Frame = 2
Query:  119 SQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKT--PNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNG-TNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            S++F     VLLISMDGFRHDYIE  K   G    PNFD LI +G R M + N +PTITLPNH+TL+TGL+PE+HG+V N+  DK +PN+ F + +Q +LN   W   WPEPIWVTL+K G  T S LWPLTD  V   +PF + SQ+ LL++  + + + +R+ D+++WL N R H++  + YF EPDE+GHSYGPN +     V  LD  LGHL+  +K +GL DKV+IILTADHGMSE S++R IPLD+Y++ S Y YT L+ +G LYP  GK + VY  LKN +P L V+ R EVP  LN+NI N R+ PLILIA+  W I    ++   NV G+HGY     ++ PFFIA GP+ +   ++P  H+VDVYPLMC LL I PNPNNGSL
Sbjct:   74 SRFFNHDKTVLLISMDGFRHDYIELTKTHLGSNALPNFDRLISEGVRAMESINVYPTITLPNHRTLITGLYPENHGVVGNSLLDKKWPNKIFSIYDQESLNHAPWLTDWPEPIWVTLQKNGGYTGSLLWPLTDQFVSDDLPFQRVSQYALLNDYEHRYAYDQRIRDILWWLKNPRYHLNLILAYFEEPDETGHSYGPNSKHVAKVVQTLDETLGHLLDGIKKRGLSDKVDIILTADHGMSETSNTRLIPLDKYIDDSLYNYTQLSTMGFLYPAPGKFEEVYKRLKNAHPKLDVYRRDEVPTYLNFNITNSRMPPLILIAKPSWKIVKNTSHPYANVSGDHGYATDFSEMYPFFIASGPSFKIAESVPNVHAVDVYPLMCALLNIQPNPNNGSL 466          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. TrEMBL
Match: A0A430Q1W0 (Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 OS=Schistosoma bovis OX=6184 GN=DC041_0012215 PE=4 SV=1)

HSP 1 Score: 410.609 bits (1054), Expect = 4.093e-133
Identity = 204/393 (51.91%), Postives = 266/393 (67.68%), Query Frame = 2
Query:  119 SQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKT--PNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNG-TNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            S++F     VLLISMDGFRHDYIE  K   G    PNFD LI +G R M + N +PTITLPNH+TL+TGL+PE+HG+V N+  DK +PN+ F + +Q +LN   W   WPEPIWVTL+K G    S LWPLTD  V   +PF + SQ+ LL++  + + + +R+ D+++WL N R H++  + YF EPDE+GHSYGPN +     V  LD  LGHL+  +K +GL DKV+IILTADHGMSE S++R IPLD+Y++ S Y YT L+ +G LYP  GK + VY  LKN +P L V+ R EVP  LN+NI N R+ PLILIA+  W I    ++   NV G+HGY     ++ PFFIA GP+ +   ++P  H+VDVYPLMC LL I PNPNNGSL
Sbjct:  177 SRFFNHDKTVLLISMDGFRHDYIELTKTHLGSNALPNFDRLISEGVRAMESINVYPTITLPNHRTLITGLYPENHGVVGNSLLDKKWPNKIFSIYDQESLNHAPWLTDWPEPIWVTLQKNGGYAGSLLWPLTDQFVSDDLPFQRVSQYALLNDYEHRYAYDQRIRDILWWLKNPRYHLNLILAYFEEPDETGHSYGPNSKHVAKVVQTLDKALGHLLDGIKKRGLSDKVDIILTADHGMSETSNTRLIPLDKYIDNSLYNYTQLSTMGFLYPAPGKFEEVYKRLKNAHPKLNVYRRDEVPTYLNFNITNSRMPPLILIAKPSWKIVKNTSHPYANVSGDHGYATDFSEMHPFFIASGPSFKIAESVPTVHAVDVYPLMCALLNIQPNPNNGSL 569          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Cavefish
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5-like [Source:NCBI gene;Acc:103037326])

HSP 1 Score: 285.034 bits (728), Expect = 7.336e-90
Identity = 155/385 (40.26%), Postives = 234/385 (60.78%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            + +++LL+S DGFR DY+++V      TPNF  L+E+G ++ + +N + T TLPNH TLVTGL  ESHG+V N  YD    N +F M     + D +W+++   P+WVT +K GR + + +WP +D  + G  P    + +   +      PF  RVE ++ W   T   IDF +LY+ EPDE+GH+ GP        +  +D  LG L + LK  GL+DK+N+I+T+DHGM++ S ++ I LD YV+   YT+   +PV  + P +GK + VYN+L+N NP++ V+ ++++P   +Y   N RI P+I+ A+  W I    T    + GNHGY+N    + P F+A+GP+ R  +T     SVD+YPLMCY+LG+ P PNNGSL
Sbjct:   28 EHSKLLLVSFDGFRWDYVDRVP-----TPNFHALMEEGVQVEKVENTYITKTLPNHYTLVTGLHAESHGVVANEMYDPVL-NRSFSMEGPE-VYDSRWWEE-AVPLWVTTQKAGRRSGAAMWPGSDVAIRGVYP----THYVPYNAS---MPFEMRVEKLISWFLGTEA-IDFGVLYWEEPDETGHNVGPESPLMDVVIEDIDRKLGFLREKLKISGLYDKINLIVTSDHGMTQLSRNKIIELDAYVSQDLYTWIDKSPVVGILPKEGKFEEVYNSLENANPNMVVYKKEDIPDYFHYK-HNARIMPIIIEAKEGWTIVKNRTE-PFMMGNHGYDNHLHSMHPVFVARGPSFRTGYTKTAMRSVDLYPLMCYILGVQPLPNNGSL 394          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Cavefish
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5-like [Source:NCBI gene;Acc:111189957])

HSP 1 Score: 283.108 bits (723), Expect = 3.382e-89
Identity = 154/385 (40.00%), Postives = 233/385 (60.52%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            + +++LL+S DGFR DY+++V      TPNF  L+E+G ++ + +N + T TLPNH TLVTGL  ESHG+V N  YD    N +F M     + D +W+++   P+WVT +K GR + + +WP +D  + G  P    + +   +      PF  RVE ++ W   T   IDF +LY+ EPDE+GH+ GP        +  +D  LG L + LK  GL+DK+N+I+T+DHGM++ S ++ I LD YV+   YT+   +PV  + P +GK + VYN+L+N NP++ V+ ++++P   +Y   N RI P+I+ A+  W I    T    + GNHGY+N    + P F+A+GP+ R  +      SVD+YPLMCY+LG+ P PNNGSL
Sbjct:   28 EHSKLLLVSFDGFRWDYVDRVP-----TPNFHALMEEGVQVEKVENTYITKTLPNHYTLVTGLHAESHGVVANEMYDPVL-NRSFSMEGPE-VYDSRWWEE-AVPLWVTTQKAGRRSGAAMWPGSDVAIRGVYP----THYVPYNAS---MPFEMRVEKLISWFLGTEA-IDFGVLYWEEPDETGHNVGPESPLMDVVIEDIDRKLGFLREKLKISGLYDKINLIVTSDHGMTQLSRNKIIELDAYVSQDLYTWIDKSPVVGILPKEGKFEEVYNSLENANPNMVVYKKEDIPDYFHYK-HNARIMPIIIEAKEGWTIVKNRTE-PFMLGNHGYDNHLRSMHPVFVARGPSFRTGYNKTAMRSVDLYPLMCYILGVQPLPNNGSL 394          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Cavefish
Match: enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:NCBI gene;Acc:103041977])

HSP 1 Score: 240.736 bits (613), Expect = 3.935e-73
Identity = 142/383 (37.08%), Postives = 212/383 (55.35%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGP-NGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGT-NVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +LLIS DGFR DY++K        PN       G  I    N F T T PNH +L TGL+ ESHGI+ +  +D     + F + +     DP W+++   PIWV+++K G  +A+ +WP TD  +         + F   D+      F +R+ ++  W++     + F+ LY+ EPD +GH +GP N      A+  +D  +G +++ L   GLW K+N+I+T+DHGM + S  R I LD+ ++ S YT   LTPV AL P+      +Y  L N +PH++ + +  VP  L+Y  +N RI P+IL+A+  W I     NG+    G+HGY+NS   + PF  A GP  R+ + +   +SVD+YPLMC+LLGI   PNNGS 
Sbjct:   33 LLLISFDGFRADYLKKYSF-----PNLQKFFSAGVLIDHLTNVFVTKTFPNHYSLATGLYAESHGILASHMFDPV-TKKKFSLEDDT---DPFWWNE-ATPIWVSVQKWGYKSAAAMWPGTDVMIQNHT----STNFMKYDSK---VSFRERLGNITTWMTEDN-SVKFAALYWEEPDHTGHIFGPENTTEMTRALKEVDDDVGFMMEHLNNSGLWGKINVIITSDHGMVQCSKDRLIKLDQCISRSSYTLVDLTPVAALVPINDATD-LYKNLSNCHPHMKAYLKDAVPDKLHYR-NNERIQPIILVADEGWTIVQ---NGSLPRLGDHGYDNSLSSMHPFLAANGPAFRKGYRMETINSVDLYPLMCHLLGIPEMPNNGSF 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Cavefish
Match: zgc:153896 (zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119])

HSP 1 Score: 218.394 bits (555), Expect = 6.671e-65
Identity = 132/390 (33.85%), Postives = 214/390 (54.87%), Query Frame = 2
Query:  140 NQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPP-NYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMS---ENSDSRQIPLDEYVNPSWYTYTLLTPVGA---LYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            N++LLIS DGFR +Y E V      TPN D L+++G +         T+T P+H T +TG + E HG+V N  ++ T       + ++  L   +W+D    P+W+T +  G  TAS  +P   +   G+      S     D+P  N   + + ++ V+ W   T+   DF  LY+ EPD  GH  GP        +  +D  +G+L + ++   L + +N+I+T+DHGM+   +N D ++I L EY+N    T+  L   G    + P KG+EQAVY+ALKN +P+L V+ ++E+P + ++   N RI  ++LI +  + +  +     N  G+HG++N E D++  F A GP+ ++N+     +S+ +YPLMC LLG+ P PNNGSL
Sbjct:   29 NKLLLISFDGFRWNYDEDVD-----TPNMDALVKEGVKAKYITPPMITMTSPSHFTTITGRWIEDHGVVHNMMFNST---SLLKLTHKATLKRSEWWDNGALPLWITAQNQGLKTASFFYPGGGANYSGQA--VDRSLVEAFDHPDDNETEWRQNIDTVMDWF--TKEDFDFVTLYYGEPDNVGHMVGPETNERRKIIAQIDRTIGYLREAIQKNSLANSLNVIITSDHGMTTIKKNPDVKEIKLSEYMNFLTLTHFDLLDYGGFGMIRPRKGQEQAVYDALKNAHPNLTVYKKEEIPENFHF-AKNSRIQDIVLIGDLGFNLNSRFIFYVN-KGDHGFSNEEMDMKTIFRAFGPDFKKNYLSEPFNSISIYPLMCKLLGVKPAPNNGSL 404          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Cavefish
Match: ENPP7 (ectonucleotide pyrophosphatase/phosphodiesterase family member 7-like [Source:NCBI gene;Acc:103023145])

HSP 1 Score: 211.846 bits (538), Expect = 4.756e-62
Identity = 146/456 (32.02%), Postives = 228/456 (50.00%), Query Frame = 2
Query:  137 RNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVY-WLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMS---ENSDSRQIPLDEYVNPSWYTYTL----LTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDVEENMKPT 1480
            R++VLL+S DGFR DY   V      TP+ D +   G +      AF T+T P H T++TG + E+HG++ N +++ T  +E         +ND  W+D    PIW++ ++ G  T S  +P T S   G+     E +     N  N   +   V+ V+  W       +DF  LYF EPD +GH YGP+       V  +D  +G+L    +  GL + +NII+TADHGM+    N    +I L +    S+           P G L P +G+ + VYNALK  +PHL V+ ++E+P+ L++  +N RI P+IL ++  + I        N  G HG++N   D++PFF A GP  R+N  +    +V++YPLMC+LL I P PN+G L+  + ++     +   SV       F  L     V +   + +F  N+ K  + +   +N   T
Sbjct:   30 RSKVLLVSFDGFRWDYDRDVD-----TPHLDAMARDGVKAPYVTPAFFTMTSPTHFTILTGKYIENHGVIHNMWFN-TITSEKKPYYQTQFVND--WWDNGTVPIWISAQRQGLTTGSLHFPGTASTYQGESAEVSEVEPRFY-NYSNETAWRNNVDKVMGDWFREK--DLDFVSLYFGEPDSTGHKYGPDSPQRREMVKQVDRTVGYLRSSAERNGLTNHLNIIITADHGMTTIFRNGLVEEITLSKIKGFSFQDLVFHLVDYGPTGMLLPKEGRLEKVYNALKGAHPHLHVYKKEEMPSRLHFK-NNDRILPIILWSDPGYVINGYFPVQVN-KGEHGFDNENMDMKPFFRAVGPAFRKNLEVEPFETVNIYPLMCHLLDITPEPNDGHLDATRAMLISSVPEDKNSVRDVHTGVFIGLAAVAGVIFSTFVFIFISNVIKRRRSEQRNDNKGKT 472          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Sea Lamprey
Match: zgc:153896 (zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119])

HSP 1 Score: 206.453 bits (524), Expect = 2.509e-61
Identity = 134/400 (33.50%), Postives = 208/400 (52.00%), Query Frame = 2
Query:  137 RNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKW---PEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLL--DNP-PNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENS---DSRQIPLDEYVNPSWYTYTLLTPVGA---LYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVY----GNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            R ++LL+S DGFR DY E V      TPN D+L   G+        F T+T P+H TLVTG   ESHG+V N  ++        D   +    + +   +W     P+W+T +  G  T S  +P       G   +F +S +  +  D+P  N   + + ++ V+ W   T+  +DF  +Y  EPD +GH +GP  +     V  +D  +G L+  ++ +GL D +N+I+T+DHGM+      D  +I L ++++        L   GA   L P +GKE+ VYNALK+ +PHL+V+ R+E P   +   D  R+ P+++  +  + +     NG  ++    G HG++N+EPD+   F A GP  RR +      SV VY LMC LLG+ P P+NGSL
Sbjct:   24 RQKLLLVSFDGFRWDYDEDVD-----TPNLDHLRTVGATARYMVPPFVTMTSPSHFTLVTGKHVESHGVVHNMLFNP-------DTGEKQGFQETQLRSEWWNGTIPLWITAQNQGLKTGSIRFP------GGAASYFNQSVYKTVGRDHPNSNKEDWFRNIQLVMDWF--TKDDLDFVTMYHSEPDSTGHKFGPETEERRAMVRQVDETIGFLVDAIEKRGLKDTLNVIITSDHGMTTTRKAPDINEIVLSKFIDFKEDLKFELVDYGAFGMLLPKEGKEEQVYNALKSAHPHLKVYKREEFPEYFHLR-DQSRLLPIMMYGDLGYLV-----NGRLIFQFNKGEHGFDNAEPDMWTIFRAFGPRFRRGYAAEPFASVHVYALMCELLGVQPEPHNGSL 397          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Sea Lamprey
Match: zgc:153896 (zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119])

HSP 1 Score: 201.06 bits (510), Expect = 2.502e-59
Identity = 134/391 (34.27%), Postives = 203/391 (51.92%), Query Frame = 2
Query:  137 RNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNP-PNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGM---SENSDSRQIPLDEYVN-PSWYTYTLLT--PVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            R ++LL+S DGFR DY E V      TPN D+L   G         F TIT P+H TLVTG  PESHG++ N  ++   P      N Q      +W+++   PIW+T +  G  T S  +P       G+ PF   ++ T  D+   N   +   +  V+ W  N    ++F  LY+ EPD +GH  GP  +     V  +D  +G L+  ++ +GL D +N+I+T+DHGM    +  D  +I L ++++      + L+   P G L P +GKE+ VY ALK  +PHL V+ ++E P   +Y  ++ RI P+++  +  + +     +     G+HGY+N  P ++  F A GP  RR +      SV VY LMC LLG+ P P+NGSL
Sbjct:   28 RQKLLLVSFDGFRWDYDEDVD-----TPNLDHLRTVGVAARYMVPPFVTITSPSHFTLVTGRHPESHGVIHNMLFN---PETGEKANFQKTTLRSEWWNQ-TLPIWITAQNQGLKTGSLHFPGGAVNYSGQTPFKSVAEET--DHQYNNVTEWRINIGVVMDWFVND--DLEFVALYYGEPDLTGHLSGPETEERRAMVRQVDETIGFLVDAIEKRGLKDTLNVIITSDHGMITTRKAPDIDEIVLSKFIDFKEDLKFDLVDYGPSGMLLPKEGKEEEVYQALKGAHPHLHVYKKEEFPERFHYR-NHERILPILVYGDPGYVVNGGYASDKFNKGDHGYDNEVPGMRTIFRAFGPRFRRGYAAEPFASVHVYALMCELLGVQPEPHNGSL 404          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Sea Lamprey
Match: enpp7.1 (ectonucleotide pyrophosphatase/phosphodiesterase 7, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040724-13])

HSP 1 Score: 196.052 bits (497), Expect = 4.537e-57
Identity = 130/401 (32.42%), Postives = 208/401 (51.87%), Query Frame = 2
Query:  137 RNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYD-KTFPNETFDMNNQNNLNDPKWFDKWPE--PIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLD----NPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDS---RQIPLDEYVNPSWYTYTLLT---PVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVY----GNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            R ++LL+S DGFR DY E V      TPN D+L   G         F TIT P+H TLVTG   ESHG V N  Y+   +  +++    + +    +W   W E  PIW++ +  G  T S  +P   +   G+  +      +LL+    N  N   +   V+ V+ W    +  +DF  LYF EPD +GH +GP+ +     V  +D  +G+L++ ++ +GL   +N+I+T+DHGM+    +    +I L +++N +      +    P   + P +G+E+AVY ALK  +P L V+ ++E P    Y  ++ R+ P+++  +  + +     NG  ++    G HG++N+E D++  F A GP  RR +      SV VY LMC LLG+ P P+NGSL
Sbjct:   30 RQKLLLVSFDGFRWDYDEDVD-----TPNLDHLRTIGVAAQHMVPPFITITSPSHFTLVTGKHIESHGAVHNQLYNVDPWEKQSYHAAQKRS----EW---WNETLPIWISAQNQGLKTGSLHFPGGAATYQGQTVYR-----SLLEKATYNYSNETEWRLNVDTVMDWFVMDK--LDFVALYFGEPDVTGHKFGPHSEERQEKVRQVDRTVGYLLRSMEERGLTGNMNVIITSDHGMTPTQKAPAVEEIVLSKFINFTKDVKLAIVDYGPFAMIQPKQGREEAVYRALKGAHPKLNVYRKEEFPERFRYR-EHRRLLPIMMYGDLGYVV-----NGRMIFQFNKGEHGFDNAEADMRTIFRAFGPRFRRGYVAEPFASVHVYALMCELLGVQPEPHNGSL 405          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Sea Lamprey
Match: ENPP3 (ectonucleotide pyrophosphatase/phosphodiesterase 3 [Source:HGNC Symbol;Acc:HGNC:3358])

HSP 1 Score: 181.415 bits (459), Expect = 1.968e-49
Identity = 123/394 (31.22%), Postives = 194/394 (49.24%), Query Frame = 2
Query:  137 RNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLS-NTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGAL--------YPVKGKEQAVYN-ALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHK-ATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGS 1285
            R  ++L S+DGFR +Y++   A     PN   L   G+     +  +PT T PNH T+ TG++PESHGIV N  YD  F N  F + N+ +    KW+    +PIW T+   G  + ++ WP +D  ++   P +  +++   D      P+  R++ V  WL        DF  LY  +PD  GH++GP       A+  +D ++G L+  LK + L   VNI++ ADHGM + S  R   L+EY++ +   Y    P G +        Y     E  V N   K    H + + +  +P  L+Y  D+ RI  + L  E +W +A + +  G    GNHG++N    +Q  FI  GP  +    +    ++++Y LMC +L I P+ NNG+
Sbjct:  134 RQPLILFSLDGFRAEYLQTWSAL---VPNLQKLRSCGTHAPYMRAMYPTKTFPNHYTITTGMYPESHGIVDNNIYDVIF-NANFSLGNEESATS-KWWGG--QPIWNTVTYQGLKSGTYFWPGSDVAINNTYPDYW-AKYNTND------PYENRIKVVFKWLDLPEDQRPDFYTLYLDQPDGQGHNFGPVSGQVIEALQDVDRIIGMLMDGLKQRALHQCVNIMIVADHGMDKISCDRVELLNEYMSLN-NIYVYEGPYGRIRARNIPQDYHKLDNEGIVRNLTCKKEGQHFKPYLKWHLPKRLHYG-DSHRIETIHLFMERQWQVARQYSATGRCNGGNHGFDNEFISMQAIFIGYGPKFKNQTEVEAFENIELYNLMCDILEITPSKNNGT 511          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005881.1 (pep scaffold:Pmarinus_7.0:GL493670:46:2788:1 gene:ENSPMAG00000005321.1 transcript:ENSPMAT00000005881.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.852e-9
Identity = 27/72 (37.50%), Postives = 43/72 (59.72%), Query Frame = 2
Query:  659 LYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYV 874
            LY  +PD +GH YGPN     + ++ +D ++G L+  LK + L   V+I+  +DHGM++ S SR   L  Y+
Sbjct:   27 LYVEQPDLNGHLYGPNSFKVKSILVYVDELVGKLMDGLKQRNLHKCVDIMFVSDHGMADVSRSRVEFLSSYL 98          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Yeast
Match: NPP1 (Nucleotide pyrophosphatase/phosphodiesterase; mediates extracellular nucleotide phosphate hydrolysis along with Npp2p and Pho5p; activity and expression enhanced during conditions of phosphate starvation; involved in spore wall assembly; NPP1 has a paralog, NPP2, that arose from the whole genome duplication, and an npp1 npp2 double mutant exhibits reduced dityrosine fluorescence relative to the single mutants [Source:SGD;Acc:S000000621])

HSP 1 Score: 110.153 bits (274), Expect = 6.803e-26
Identity = 126/446 (28.25%), Postives = 193/446 (43.27%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIE----QGSRIMRTK---NAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPK-WFDKWPEPIWVTLEKL--GRL---TASHLWPLTD-----------SPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSML---------YFPEPDESGHSYGPNGQGTF------NAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSE-----NSDSRQIPLDEYVNPSWYTYTLLT-PVGAL-YPVKGKEQAVYNALKNR--NPHLQVFWRQEVPASLNYNI-DNGRIAPLILIAENKWAIA------------HKATNGTNVY--GNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGI---NPNPNNGS 1285
             ++IS+DGF    I K       TP    L E     G  I  T     +FPT T PNH TLVTG +P  HGIV N F+D    NE F       + DP+ W +   EPIW T++    G +    A+H+WP +D            P H K P  +E         P YF      E +   LS    ++D S L         Y P  D  GH +G   +  +        +  +D+ L  L++ L+ + L    N+++ +DHGMS+     N    +  LDE +   + ++  L  P+ A+     G    VY+ LK         V+     P   N+N   N  +A + ++ E  +A+             HK  N  NV+  G+HGY+N+  D++  FI  GP   + +  PF  + ++Y L+C + G+   + N N+G+
Sbjct:  170 TIVISLDGFHPSLISK-----RNTPFLHDLYELKYDGGMNITSTPFMVPSFPTETFPNHWTLVTGQYPIHHGIVSNVFWDPDL-NEEF----HPGVLDPRIWNNNDTEPIWQTVQSAFDGDIPFKAATHMWPGSDVNYTKYNEEKLQPEH-KNPIARERT-------PFYFDEFNAKEPLSQKLSKIIEYVDMSTLNERPQLILGYVPNVDAFGHKHGYPSESEYYYEDFTETLGEVDTFLKQLVESLQERNLTSFTNLVIVSDHGMSDIVVPSNVIIWEDLLDEKLRKDYVSHAYLEGPMMAISLKDSGNINEVYHNLKTSIDEDKYTVYVNGNFPKEWNFNDGKNHHMASIWIVPEPGYAVMKKEQLKKVAKGDHKDKNEDNVFTIGSHGYDNNAIDMRSVFIGMGPYFPQGYIEPF-QNTEIYNLLCDICGVAEKDRNSNDGT 596          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Yeast
Match: NPP2 (Nucleotide pyrophosphatase/phosphodiesterase; mediates extracellular nucleotide phosphate hydrolysis along with Npp1p and Pho5p; activity and expression enhanced during conditions of phosphate starvation; involved in spore wall assembly; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum; NPP2 has a paralog, NPP1, that arose from the whole genome duplication; npp1 npp2 double mutant exhibits reduced dityrosine fluorescence relative to single mutants [Source:SGD;Acc:S000000742])

HSP 1 Score: 85.1149 bits (209), Expect = 4.368e-18
Identity = 97/387 (25.06%), Postives = 162/387 (41.86%), Query Frame = 2
Query:  272 AFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGR---LTASHLWPLTDSPV--HGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSML---------YFPEPDESGHSYGPNGQGTFNAVIM--LDSVLGHLIQLLKAKGLWDKVNIILTADHGMS--ENSDSRQIPLDEYVNPSWYTYTLLTPVGALYP------------------VKGKEQAVYNALKNRNPHLQVFWRQEVPASLNY-NIDN------GRIAPLILIAENKWAIAHKATN-GTNVYGNHGYN-NSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLM---CYLLGINPNPNNGSL 1288
            +FPT T PNH ++VTG +P  HGIV N F+D  F +  F  NN     D + +    +PIW  L+   +     A+H+WP ++     HG +P          +  P YF    + E +   L+    +ID   L         Y P  D  GHS+G + +      ++  +D     LI+ L+ + L    N+++ +DHGMS    +D   + + E V P+      ++ +    P                  ++ + +  Y    +R  H  V  +++   S  Y   DN       R+  + ++A+  +AI  +  +    + G HGYN N+  D+   FI  GP        PF  +++VY ++     LLG        SL
Sbjct:  122 SFPTQTFPNHWSMVTGKYPIEHGIVSNIFWD-NFTSSEFRPNNL----DARIWSNTADPIWQLLQTESQGEYKVATHMWPGSEVVYEDHGDVP---------RERMPFYFGKFNQWEKLQDKLAQIFRYIDMPQLKDRPELVISYIPNVDSYGHSFGYDLRDKRLQKLIGEVDGFFLDLIEGLQKRNLLKISNVMIVSDHGMSNVNANDGEHVVVWERVFPADAMSAFISHLYNEGPMMMVCLKNPRDKQWICDLIEAQLEKAYGDEISRKFH--VILKEDFDPSWKYFQYDNRKHRYDDRVGDIWILADEYYAIVKEMGDVPIGIMGTHGYNFNNCSDMASIFIGMGPMFNNEVVPPF-ENIEVYNMLIKASALLGEEKTKKEKSL 491          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Nematostella
Match: EDO35535 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL99])

HSP 1 Score: 237.269 bits (604), Expect = 3.904e-73
Identity = 140/390 (35.90%), Postives = 208/390 (53.33%), Query Frame = 2
Query:  137 RNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQ----ESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAH--KATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +  VLLIS+DGFR DY+ K       TPN D+L++ GS+    ++ FPT T PNH +LVTGL+PE+HGIV N  YD  +        N +  N   W +   +PIW + E+ G  +    WP  +    G+ P            + +       F KRV+ VV W S+ R   +F  LYF EPDE+GH +GP+ +   + +  LD ++G LI  L +K L DK+NII+T DHGM+  S  + I L++Y++P  Y     +    + P KGK Q +Y   K + PH  ++ ++++P  L++   N RI  L L+ E  W +             GNHGY+    D+  F +A+GP  R   T+    +V +YPL+C +LGI P P+NGS+
Sbjct:   12 KQTVLLISLDGFRWDYMSKAS-----TPNLDFLVKTGSKAKFIRSVFPTTTYPNHFSLVTGLYPENHGIVANYMYDPVYRGRF----NISVTNTTWWSEFGAKPIWTSNEEQGGKSGVLYWPGYNVKFGGRYPTLDVLTPSGNIDIGNQTGRVMSFDKRVQTVVKWFSDERPP-NFVALYFEEPDETGHKFGPDSEEVRDEIARLDGIIGKLITKLSSKELLDKINIIVTTDHGMTNTSTDKLINLNDYLDPDEYDIWDASTNIMISPRKGKLQELYTKAK-KIPHSTIYKKKDIPPYLHFG-HNRRIPELFLLIEEGWTVKRWPIGIKPKVPRGNHGYDTQYRDMGGFLVARGPVFRTGHTVGGFDNVHLYPLLCSVLGIQPRPSNGSI 389          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Nematostella
Match: EDO43842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXG6])

HSP 1 Score: 233.802 bits (595), Expect = 8.323e-72
Identity = 145/399 (36.34%), Postives = 219/399 (54.89%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPP-----NYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNAL--------KNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAI-AHKATNGT----NVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            VLL+S+DGFR+DY+EK K +    PN  +L  QG+++   KN +PT+T PNH ++VTGL+PESHGIV N  YD  F +E F+M+      DPKW++   EPIWVT +K G  +    WP  D  + G +  ++    +   N P     N  P+  RV+ VV WL+ T+    F  LYF EPDE GH YG +   T   +  +D  +G+L++ LK   ++ +VNII+T+DHGM     +  I +D+YVNP    Y + +  G  +       +  + L        K     ++++ + E+P  L++  +N RIA L    +  + I A   TN T       G HGY+    ++ PF IA GP  ++++       +D+Y LMC+++GI+P PNNGSL
Sbjct:    3 VLLVSLDGFRYDYMEKHKDS---VPNLRHLASQGTQVEYVKNVYPTVTFPNHYSIVTGLYPESHGIVDNNMYDPVF-DEHFNMST----TDPKWWED-AEPIWVTNQKQGYPSGMCYWPGYDVKIKGYLAHYRPLNASF--NKPFVTDENVLPWPDRVDMVVGWLNQTKDIPSFVTLYFEEPDEVGHRYGADAIETAKKLQEVDKTIGYLMEQLKKLTIYPQVNIIITSDHGMMNYYANTVINIDDYVNPD--KYVMWSSAGTEFQFTNSSLSTLDELYKDFKKMEKGTKGKIKIYKKSEIPDRLHFR-NNRRIADLAGFVQGGYYINASGYTNFTMRDNETRGTHGYDPINAEMHPFLIAFGPAFKQHYKSGPIDMLDIYSLMCHIIGIHPRPNNGSL 387          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Nematostella
Match: EDO48960 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI34])

HSP 1 Score: 230.335 bits (586), Expect = 7.672e-70
Identity = 148/387 (38.24%), Postives = 218/387 (56.33%), Query Frame = 2
Query:  137 RNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGA---LYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +  V+L+S DGFR DY+EK       TPN D++ + G R    K+ FPT T PNH T+VTGL+ ESHGIV NT YD    +  F MNN     + KW+D   EP+WVT +  G  +A   WP +++ + G     Q + F   D    Y     RV+ ++  L + R    F   YF EPD SGH YGP  +    A+  +D++ G+L++ L+ + L +KVNII+T+DHGMS  S  + + L++Y+ P  Y +  +   GA   + P+KG    +   LK+ + HL V+ +  +P   +Y   N RIAP+I+IA+  W++    T      GNHGY+N    +  FF+A+GP  +RN+     ++VD+YPL+C +L I   PNNGSL
Sbjct:   31 KATVILLSFDGFRWDYMEKTA-----TPNLDFIAKTGVRAKYVKSIFPTQTFPNHFTIVTGLYAESHGIVANTMYDPELKSWFF-MNN----TETKWWDG-GEPVWVTNQHQGGTSAVVFWPGSETVIRG----VQPTYFMKYDERVTY---QSRVDRLMKAL-DIRKPATFLAAYFEEPDHSGHMYGPESEEVVIAIRKVDTITGYLVKQLQKRHLLEKVNIIITSDHGMSSISSKKLVFLEDYIPPQSYKWINVLQWGAFAQILPMKGWSNQILLVLKDVD-HLNVYKKSSIPKQYHYT-KNRRIAPIIIIADEGWSVVKNRTVDFKGMGNHGYSNKYQSMGAFFVARGPYFKRNYISKPLNNVDIYPLVCDILQIKAAPNNGSL 396          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Nematostella
Match: EDO38395 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCY3])

HSP 1 Score: 215.698 bits (548), Expect = 4.699e-65
Identity = 138/393 (35.11%), Postives = 214/393 (54.45%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNY-FPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDS-VLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALK----NRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKAT----NGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRN--FTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            V+L+S DG    + E+       TPN D++ + G +    K   P++T PNHQT +TGL+PESHGIV N F+D  +  E F  ++  +  DPK++++  EPIW+TL+K+G+ +  H WP           FF+   +      PNY  PF KR+E ++ WL++ +    F   Y  +PD  GHSYGP+       V  +D  V+G +I  L+  GL +KVN+I  +DH  +  + SR I  D++++P+ Y  T  T  G ++P  GK   +Y  L      + P ++V+ ++E+P + +Y  +N R+ P+ + A   +    +      +   VYG HGY + E  +   F A+GP  +    F  P   SVD+YP+MC LLGI P+PNNGSL
Sbjct:    1 VILVSTDGLGWQFPERFN-----TPNLDFMAQTGVKAKYMKVVTPSVTWPNHQTYMTGLYPESHGIVSNRFWDPAY-KEKFIFDHDCSNGDPKFWNE-SEPIWLTLQKMGKDSGLHFWP----------GFFKWPPYEHCY--PNYTIPFSKRIEKIMSWLTSKKP-PQFVGFYADQPDWVGHSYGPDSDKFRRMVEHVDKVVVGGMIDSLRNAGLLEKVNLIFVSDHSFTTVNKSRVIFFDDFIDPATYMLTEATAFGHIWPKPGKFDEIYTNLTTHMIQKYPQVKVYKKEEIPEAFHYK-NNRRVPPIYVSAGFGYGFKPRRAWFNVSDDWVYGYHGYPSDE-RMGAIFYARGPAFKTGYYFDGPL-RSVDIYPMMCELLGIQPHPNNGSL 370          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Nematostella
Match: EDO49840 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RES2])

HSP 1 Score: 199.134 bits (505), Expect = 7.988e-59
Identity = 134/387 (34.63%), Postives = 212/387 (54.78%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLD-SVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKN-RNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIA---HKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFG-HSVDVYPLMCYLLGINPNPNNGSL 1288
            V+L+S  G    +   V +    TPNFD++++ G +        PT T P H T +TGL+PESHGIV N F+D  +       ++ +N  DPK++++  EPIW+T++K G  TAS+ WP + S  + + P      F   D      PF  RV+ V+ W+S+       ++LY  EPD  GH+YGP+       + M+D  V+G L+  L    L +KVNIIL +DH + E S+ RQI L++Y+  + Y Y        L+P  G+ + V NAL    N HL+++ +++ P + ++  +N RI PL L  E  W +      A  G  + G+H ++ S+ +    F A+GP  + N++ P    +VD+YPL+C++LG+ P  +NGSL
Sbjct:    1 VILVSFAGLGWQF---VGSDLTHTPNFDFIVQSGVKAKNMVPVHPTRTAPIHTTFLTGLYPESHGIVDNMFWDPIYEERFIHSDDCSNF-DPKFYNE-SEPIWLTMQKQGEKTASYFWPGSYS--YKEKPTVH-CTFDWSD------PFSNRVDKVLEWVSSNEP-PKLALLYIDEPDWKGHAYGPHSPQYRQMIEMIDRDVVGRLLDGLYTAKLLNKVNIILVSDHSLIETSNKRQIRLNDYITSNDY-YENRGTTEQLWPKPGQMEKVLNALSTANNSHLKIYKKRDFPDNWHWK-NNRRIPPLYLDVEEGWLMRTDYDAAGEGEWIEGSHVWSPSQ-NSAGIFYARGPFFKANYSSPRSLRAVDLYPLLCHILGVKPRSHNGSL 369          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Medaka
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5 [Source:NCBI gene;Acc:101174878])

HSP 1 Score: 273.478 bits (698), Expect = 2.133e-85
Identity = 149/383 (38.90%), Postives = 233/383 (60.84%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVH-IDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            ++LL+S DGFR DYI++V      TPNF  ++++G ++   +N + T TLPNH TLVTGL+ E+HGIV N  YD    N++F M   +++ D +W+++   P+WV+++K G  + + +WP +D  +HG  P    SQ+   ++      F  RV+ ++ W S      +DF +LY+ EPDESGH+ GP        +  +D  LG L+  LK  GL +KVN+I+T+DHGM++    + I LDEYV    Y++   +PV  + P +GK + VY+ L + NP++  + ++ +P  L+Y   N RI P++L A+  W I    T    + GNHGY+N+  ++QP F+A+GP  ++N+      SVD+YPLMC++L I P PNNGSL
Sbjct:   40 KLLLVSFDGFRWDYIDRVP-----TPNFRSIMDEGVKVENVENIYITKTLPNHLTLVTGLYAETHGIVANEMYDPIL-NQSFSMET-DSIYDSRWWEQ-AVPLWVSVQKAGGRSGAAMWPGSDVKIHGTYP----SQYLEYNSS---VSFETRVQKIIEWFSAPEEEAVDFGVLYWEEPDESGHTLGPQSPLMDAVIAGIDEKLGFLLNELKRSGLDEKVNLIVTSDHGMAQLYPEKIIELDEYVERDTYSWVDKSPVVGILPKEGKLEEVYSLLVDANPNMVAYRKEHIPERLHYQ-HNVRIMPILLEAKEGWTIMQNRTEHF-MLGNHGYDNTLRNMQPIFVARGPGFQQNYVKSSMRSVDLYPLMCHILSIRPLPNNGSL 405          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Medaka
Match: enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:NCBI gene;Acc:101168684])

HSP 1 Score: 245.358 bits (625), Expect = 2.467e-74
Identity = 146/390 (37.44%), Postives = 215/390 (55.13%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP------FMKRVEDVVYWL--SNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +LL+S DGFR DY+ +         N   L  +G  +    N F T T PNH +LVTGLF ESHGI+ +  +D    ++ F++ N     DP W+ +  EP+W+T    G  TA+ +WP +D  +  +                ++FP      F +R+ +V  W+  + T   + F+ LY+ EPD SGH +GP+       V+  +D  +G L+  LK  GLW  VN+I+T+DHGM++ S+ R I LD+ ++P  YT   LTPV AL P  G  +AV++ LK  +PH+  + ++ +P  L+Y  +N RI PL+LIA+  W I  +  N     G+HGY+NS   + PF  A GP+  +   +    SVDVYPLMC LL + P PNNGSL
Sbjct:   90 LLLVSFDGFRADYLNRFPMQ-----NLKLLYSEGVLVEELTNVFITKTFPNHYSLVTGLFAESHGILASNMFDP-ISHKHFNIKNDT---DPAWWSE-AEPLWLTALDSGYKTAAVMWPGSDVLIGNR-------------TATHFFPYNSDITFQERLGNVTSWMLGNGTEPGVMFTALYWEEPDRSGHFFGPDNTTAMAKVLKEVDDNIGLLVSELKRTGLWGHVNLIITSDHGMAQCSNDRLIRLDDCLHPDNYTLVDLTPVAALIP-NGDPEAVFDLLKKCHPHMTAYLKKAIPDRLHYR-NNERIQPLLLIADEGWTIVQRG-NKLPRMGDHGYDNSLHSMHPFLAAVGPSFHKGVQMKSLQSVDVYPLMCSLLSVPPGPNNGSL 453          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Medaka
Match: enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:NCBI gene;Acc:101168684])

HSP 1 Score: 245.358 bits (625), Expect = 5.638e-74
Identity = 146/390 (37.44%), Postives = 215/390 (55.13%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFP------FMKRVEDVVYWL--SNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIM-LDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            +LL+S DGFR DY+ +         N   L  +G  +    N F T T PNH +LVTGLF ESHGI+ +  +D    ++ F++ N     DP W+ +  EP+W+T    G  TA+ +WP +D  +  +                ++FP      F +R+ +V  W+  + T   + F+ LY+ EPD SGH +GP+       V+  +D  +G L+  LK  GLW  VN+I+T+DHGM++ S+ R I LD+ ++P  YT   LTPV AL P  G  +AV++ LK  +PH+  + ++ +P  L+Y  +N RI PL+LIA+  W I  +  N     G+HGY+NS   + PF  A GP+  +   +    SVDVYPLMC LL + P PNNGSL
Sbjct:   90 LLLVSFDGFRADYLNRFPMQ-----NLKLLYSEGVLVEELTNVFITKTFPNHYSLVTGLFAESHGILASNMFDP-ISHKHFNIKNDT---DPAWWSE-AEPLWLTALDSGYKTAAVMWPGSDVLIGNR-------------TATHFFPYNSDITFQERLGNVTSWMLGNGTEPGVMFTALYWEEPDRSGHFFGPDNTTAMAKVLKEVDDNIGLLVSELKRTGLWGHVNLIITSDHGMAQCSNDRLIRLDDCLHPDNYTLVDLTPVAALIP-NGDPEAVFDLLKKCHPHMTAYLKKAIPDRLHYR-NNERIQPLLLIADEGWTIVQRG-NKLPRMGDHGYDNSLHSMHPFLAAVGPSFHKGVQMKSLQSVDVYPLMCSLLSVPPGPNNGSL 453          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Medaka
Match: ENPP7 (ectonucleotide pyrophosphatase/phosphodiesterase family member 7 [Source:NCBI gene;Acc:101173468])

HSP 1 Score: 213.001 bits (541), Expect = 1.684e-62
Identity = 138/395 (34.94%), Postives = 209/395 (52.91%), Query Frame = 2
Query:  134 DRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQ--NNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQ--------IPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSL 1288
            DR ++LLIS DGFR DY   V      TPN D + + G + +     + TIT P H TL+TG + E+HG++ N +++ T   +      Q  NN     W+D    PIW+T ++ G    S  +P T S   G+    QE +    D   N   + +  + V+ W  +    +DF  +YF EPD +GH YGP+       V  +D  +G++    +  GL D++NII+TADHGM+      Q        IP   + + S++      P G L P  G+ + VYNALK  +PHL V+ ++E+PA L ++ ++ RI P++L A+  + I        N  G HG++N E D++PFF A GP  R+N  +    +V++YPLMC+LLGI P  N+G L
Sbjct:   23 DRQKLLLISFDGFRWDYDLDVD-----TPNLDQMAKDGVKALYVTPPYLTITSPTHFTLLTGRYIENHGVIHNMWFNTTTQEKKQYYMTQFVNN-----WWDNGSLPIWITAQRQGLKAGSLHFPGTASSYQGEKALVQEVEPRFHDYK-NETTWKENTDKVMGWFRDQ--DLDFVSMYFGEPDGTGHKYGPDSPERREMVKQVDRAVGYIRASAQQHGLIDRLNIIITADHGMTTVQRGAQVDEIILSKIPGFSFQDISFHLVDY-GPSGMLLPKPGRLEKVYNALKGAHPHLHVYKKEEMPAHLRFS-NHERILPIVLWADLGYVINGYFPVQFN-KGEHGFDNKELDMKPFFRAVGPAFRQNLVVGPFETVNIYPLMCHLLGIEPEVNDGHL 401          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Medaka
Match: enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6 [Source:NCBI gene;Acc:101154765])

HSP 1 Score: 182.57 bits (462), Expect = 2.725e-51
Identity = 123/393 (31.30%), Postives = 211/393 (53.69%), Query Frame = 2
Query:  146 VLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSE-NSDSRQIPLDEYVNPSWYTYTL-LTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGR-IAPLILIAENKWAIAHKAT------NGTNVYGN----HGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGS 1285
            +L+  +DGFR+DY++ ++A     P F  L+E+G ++      FP+++ PN+ TL+TG    SH +  N  +D++   E F +   ++   P W+D   EP+WVTL+KLG+    + WP  +  + G  P F + ++       N    + +  DV   L + R   D + +Y+ + D  GH +GP+ Q   + V  LD V+    + +K   + +++N++L +DHGM++     + I LD+++        +    V +L+P   K Q V+ AL +R P+++V+ +QEVP   +Y    GR ++PL L+A+  W I+          NG+   G     HGY+N   D++ FF+A GP+ +++       +VDVY LMC+ LG+ P PNNGS
Sbjct:   46 LLVFLIDGFRYDYLDDLQA----LPGFRALVERGVKVDYMTPDFPSLSYPNYYTLMTGRHCNSHQMTGNYMWDQSSQKE-FLIGTNDDSRLPLWWDG-SEPLWVTLQKLGKKVFMYYWPGCEVEILGVRPAFCK-EYIYNPTEENLSESITQALDV---LRSGRA--DMAAVYYEKVDVEGHHFGPDSQQIRSTVQQLDVVMQMFNRKMKELNMEEQLNVLLFSDHGMTKIQWMEKVIELDKFIAMEDILKMMDRGAVVSLWPKNSKYQEVHAAL-SRVPNMRVYGQQEVPERFHYR--GGRFVSPLTLVADPGWFISENKAKLPFWKNGSESSGWQNGWHGYDNELVDMRGFFLAAGPDFKQHVQAAPIRAVDVYNLMCWTLGVKPLPNNGS 423          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Planmine SMEST
Match: SMESG000023047.1 (SMESG000023047.1)

HSP 1 Score: 935.636 bits (2417), Expect = 0.000e+0
Identity = 489/491 (99.59%), Postives = 491/491 (100.00%), Query Frame = 2
Query:   35 MKMKNXXXXXXXXXXXXXXXXXXXQFLPSQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDVEENMKPTYAYSKINSF 1507
            MKMKNLFSFIFSILCSISIIIVLFQFLPSQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWF+KWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLERIKEIIEPKSIKKLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDV+ENMKPTYAYSKINSF
Sbjct:    1 MKMKNLFSFIFSILCSISIIIVLFQFLPSQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFEKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLERIKEIIEPKSIKKLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDVDENMKPTYAYSKINSF 491          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Planmine SMEST
Match: SMESG000023047.1 (SMESG000023047.1)

HSP 1 Score: 933.71 bits (2412), Expect = 0.000e+0
Identity = 465/467 (99.57%), Postives = 467/467 (100.00%), Query Frame = 2
Query:  107 QFLPSQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDVEENMKPTYAYSKINSF 1507
            QFLPSQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWF+KWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLERIKEIIEPKSIKKLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDV+ENMKPTYAYSKINSF
Sbjct:   23 QFLPSQWFLDRNQVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFEKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLERIKEIIEPKSIKKLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDVDENMKPTYAYSKINSF 489          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Planmine SMEST
Match: SMESG000023047.1 (SMESG000023047.1)

HSP 1 Score: 896.73 bits (2316), Expect = 0.000e+0
Identity = 447/449 (99.55%), Postives = 449/449 (100.00%), Query Frame = 2
Query:  161 MDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDVEENMKPTYAYSKINSF 1507
            MDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWF+KWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLERIKEIIEPKSIKKLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDV+ENMKPTYAYSKINSF
Sbjct:    1 MDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFEKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLERIKEIIEPKSIKKLCSVLIYMKNSFWLLCTSIAVFWLCVIILFSLNICKCNKKKDVDENMKPTYAYSKINSF 449          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Planmine SMEST
Match: SMESG000023049.1 (SMESG000023049.1)

HSP 1 Score: 555.444 bits (1430), Expect = 0.000e+0
Identity = 266/427 (62.30%), Postives = 338/427 (79.16%), Query Frame = 2
Query:  143 QVLLISMDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLL--CTSIAVFWLCVIIL 1417
             VL+ISMDGFRHDYIE VK +G K PNFDYLI++G+RIMR K+ FPT+TLPNHQTL+TGL+PE+HG+V N F DK+FPNE FDMN+Q+ LND KWF+ WPEPIWVTLE LG LTASHLWPLTDS ++GK+PFFQESQ+ LL+ P   F + KRVEDVV WLS TR+HIDFSMLYFPEPDE+GH  GPN Q   N +  LDSVLG+LI+LL ++ +W+K+NIILTADHGMS+ S+SR + LD+YV+   YTY  LTPV  +YP+ GK+Q +Y +LKN+N +++VFWR EVP SLN+N+DNGRI P+++IA+N+W+IA   ++   + G+HGY++ E D Q FFIAQGPNIRRN TIPFGHSVDVYPL+CYL+GINP  NNGS +RIK++I+ + I     ++  +K + WLL  C  IA   L V ++
Sbjct:   34 SVLIISMDGFRHDYIELVKKSGTKLPNFDYLIKEGTRIMRLKSNFPTVTLPNHQTLLTGLYPENHGVVFNRFVDKSFPNENFDMNDQDTLNDKKWFENWPEPIWVTLEHLGYLTASHLWPLTDSSINGKLPFFQESQYLLLNYPNISFNYYKRVEDVVRWLSETRIHIDFSMLYFPEPDETGHFSGPNSQQVINIIKKLDSVLGNLIKLLTSENIWNKINIILTADHGMSDVSESRYVYLDDYVDSKLYTYVTLTPVAGIYPILGKDQEIYKSLKNKNSNMEVFWRYEVPKSLNFNLDNGRIPPIVIIAKNQWSIAQNRSSIELLKGDHGYDHDELDSQSFFIAQGPNIRRNVTIPFGHSVDVYPLLCYLMGINPRANNGSFDRIKDVIQFRLIDNFTHLIFSLKLNLWLLDSCCIIAFVILLVAVV 460          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Planmine SMEST
Match: SMESG000023049.1 (SMESG000023049.1)

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 262/421 (62.23%), Postives = 333/421 (79.10%), Query Frame = 2
Query:  161 MDGFRHDYIEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPESHGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLTASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNTRVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKGLWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVKGKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWAIAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVYPLMCYLLGINPNPNNGSLXXXXXXXXXXXXXXLCSVLIYMKNSFWLL--CTSIAVFWLCVIIL 1417
            MDGFRHDYIE VK +G K PNFDYLI++G+RIMR K+ FPT+TLPNHQTL+TGL+PE+HG+V N F DK+FPNE FDMN+Q+ LND KWF+ WPEPIWVTLE LG LTASHLWPLTDS ++GK+PFFQESQ+ LL+ P   F + KRVEDVV WLS TR+HIDFSMLYFPEPDE+GH  GPN Q   N +  LDSVLG+LI+LL ++ +W+K+NIILTADHGMS+ S+SR + LD+YV+   YTY  LTPV  +YP+ GK+Q +Y +LKN+N +++VFWR EVP SLN+N+DNGRI P+++IA+N+W+IA   ++   + G+HGY++ E D Q FFIAQGPNIRRN TIPFGHSVDVYPL+CYL+GINP  NNGS +RIK++I+ + I     ++  +K + WLL  C  IA   L V ++
Sbjct:    1 MDGFRHDYIELVKKSGTKLPNFDYLIKEGTRIMRLKSNFPTVTLPNHQTLLTGLYPENHGVVFNRFVDKSFPNENFDMNDQDTLNDKKWFENWPEPIWVTLEHLGYLTASHLWPLTDSSINGKLPFFQESQYLLLNYPNISFNYYKRVEDVVRWLSETRIHIDFSMLYFPEPDETGHFSGPNSQQVINIIKKLDSVLGNLIKLLTSENIWNKINIILTADHGMSDVSESRYVYLDDYVDSKLYTYVTLTPVAGIYPILGKDQEIYKSLKNKNSNMEVFWRYEVPKSLNFNLDNGRIPPIVIIAKNQWSIAQNRSSIELLKGDHGYDHDELDSQSFFIAQGPNIRRNVTIPFGHSVDVYPLLCYLMGINPRANNGSFDRIKDVIQFRLIDNFTHLIFSLKLNLWLLDSCCIIAFVILLVAVV 421          
The following BLAST results are available for this feature:
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENPP43.716e-8438.54ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
ENPP55.542e-8437.60ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP55.542e-8437.60ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP71.330e-5632.16ectonucleotide pyrophosphatase/phosphodiesterase 7... [more]
ENPP31.916e-5031.46ectonucleotide pyrophosphatase/phosphodiesterase 3... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C01B10.92.016e-3727.18pep chromosome:WBcel235:IV:6632222:6634986:1 gene:... [more]
C27A7.37.743e-2425.00Ectonucleotide pyrophosphatase/phosphodiesterase C... [more]
C27A7.38.283e-2425.00Ectonucleotide pyrophosphatase/phosphodiesterase C... [more]
C27A7.38.386e-2425.00Ectonucleotide pyrophosphatase/phosphodiesterase C... [more]
C27A7.39.419e-2425.00Ectonucleotide pyrophosphatase/phosphodiesterase C... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enpp53.471e-9041.03ectonucleotide pyrophosphatase/phosphodiesterase 5... [more]
enpp59.741e-9040.77ectonucleotide pyrophosphatase/phosphodiesterase 5... [more]
enpp41.652e-7838.08ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
enpp41.652e-7838.08ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
enpp7.18.787e-6231.71ectonucleotide pyrophosphatase/phosphodiesterase 7... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arfip16.688e-8338.08ADP ribosylation factor interacting protein 1 [Sou... [more]
enpp71.966e-6131.71ectonucleotide pyrophosphatase/phosphodiesterase 7... [more]
ENSXETT00000030581.14.483e-5630.96pep primary_assembly:Xenopus_tropicalis_v9.1:9:365... [more]
ENPP17.158e-4930.87ectonucleotide pyrophosphatase/phosphodiesterase 1... [more]
ENPP11.047e-4830.87ectonucleotide pyrophosphatase/phosphodiesterase 1... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Enpp41.108e-8238.80ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
Enpp41.108e-8238.80ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
Enpp52.360e-7935.81ectonucleotide pyrophosphatase/phosphodiesterase 5... [more]
Enpp52.360e-7935.81ectonucleotide pyrophosphatase/phosphodiesterase 5... [more]
Enpp79.729e-6033.42ectonucleotide pyrophosphatase/phosphodiesterase 7... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y6X5|ENPP4_HUMAN1.784e-8338.54Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapi... [more]
sp|Q9UJA9|ENPP5_HUMAN2.661e-8337.60Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
sp|A2VDP5|ENPP4_BOVIN1.621e-8238.76Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Bos tauru... [more]
sp|Q0VA77|ENPP4_XENTR3.543e-8238.08Bis(5'-adenosyl)-triphosphatase enpp4 OS=Xenopus t... [more]
sp|Q6AX80|ENPP4_XENLA6.101e-8237.08Bis(5'-adenosyl)-triphosphatase enpp4 OS=Xenopus l... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183P0K04.484e-13652.42Uncharacterized protein OS=Schistosoma mattheei OX... [more]
A0A183K6X11.680e-13552.42Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A094ZUJ81.852e-13547.92Bis(5'-adenosyl)-triphosphatase enpp4 OS=Schistoso... [more]
A0A183LHG91.093e-13452.16Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A430Q1W04.093e-13351.91Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enpp57.336e-9040.26ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
enpp53.382e-8940.00ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
enpp43.935e-7337.08ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
zgc:1538966.671e-6533.85zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119][more]
ENPP74.756e-6232.02ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1538962.509e-6133.50zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119][more]
zgc:1538962.502e-5934.27zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119][more]
enpp7.14.537e-5732.42ectonucleotide pyrophosphatase/phosphodiesterase 7... [more]
ENPP31.968e-4931.22ectonucleotide pyrophosphatase/phosphodiesterase 3... [more]
ENSPMAT00000005881.11.852e-937.50pep scaffold:Pmarinus_7.0:GL493670:46:2788:1 gene:... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NPP16.803e-2628.25Nucleotide pyrophosphatase/phosphodiesterase; medi... [more]
NPP24.368e-1825.06Nucleotide pyrophosphatase/phosphodiesterase; medi... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355353.904e-7335.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438428.323e-7236.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489607.672e-7038.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383954.699e-6535.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498407.988e-5934.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enpp52.133e-8538.90ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
enpp42.467e-7437.44ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
enpp45.638e-7437.44ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
ENPP71.684e-6234.94ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
enpp62.725e-5131.30ectonucleotide pyrophosphatase/phosphodiesterase 6... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023047.10.000e+099.59SMESG000023047.1[more]
SMESG000023047.10.000e+099.57SMESG000023047.1[more]
SMESG000023047.10.000e+099.55SMESG000023047.1[more]
SMESG000023049.10.000e+062.30SMESG000023049.1[more]
SMESG000023049.10.000e+062.23SMESG000023049.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026411 ID=SMED30026411|Name=Ectonucleotide pyrophosphatase/phosphodiesterase family member 5|organism=Schmidtea mediterranea sexual|type=transcript|length=1600bp
TTGTTGAATGATAACTTAATTATATTTTAGATTAATGAAAATGAAAAATT
TATTTTCATTTATTTTCTCCATTTTGTGTTCGATTTCTATAATTATTGTT
CTGTTCCAATTTTTACCGAGTCAATGGTTTTTGGATAGAAATCAAGTCTT
GCTAATTAGCATGGATGGGTTTAGACATGATTACATTGAAAAAGTCAAAG
CAGCAGGTGGCAAAACTCCAAATTTCGATTACCTTATTGAACAAGGTTCA
CGAATAATGCGTACGAAAAATGCATTTCCCACAATTACTTTACCCAACCA
CCAGACCTTGGTCACAGGATTATTTCCAGAAAGTCATGGAATAGTTCTTA
ATACTTTCTATGACAAAACTTTCCCAAATGAAACATTTGACATGAACAAT
CAAAACAATTTGAACGATCCAAAATGGTTTGACAAATGGCCAGAGCCGAT
TTGGGTAACGTTGGAAAAATTAGGCCGTCTGACAGCCAGCCATCTCTGGC
CATTGACAGATTCACCAGTTCATGGAAAGATACCGTTTTTCCAAGAATCT
CAATTCACTTTGCTTGATAATCCTCCAAATTATTTTCCATTCATGAAACG
AGTTGAAGATGTCGTGTATTGGTTGAGTAATACTCGTGTTCACATAGACT
TTTCAATGTTGTACTTTCCTGAACCCGACGAATCTGGTCATAGTTATGGA
CCAAATGGTCAAGGTACATTCAATGCTGTAATTATGCTGGATTCTGTTTT
GGGTCACTTGATACAATTACTAAAAGCTAAAGGTTTATGGGACAAAGTGA
ATATCATACTCACTGCTGATCATGGTATGTCAGAAAATTCTGATTCTAGA
CAAATTCCTTTGGACGAATATGTCAATCCAAGCTGGTATACGTATACTCT
ATTGACCCCGGTAGGAGCACTATATCCTGTAAAAGGCAAAGAACAAGCAG
TTTATAATGCTTTGAAAAATCGAAATCCACATTTACAGGTATTCTGGAGA
CAGGAAGTTCCAGCATCGTTAAATTACAACATTGATAATGGAAGAATAGC
GCCTCTAATACTAATTGCAGAAAATAAATGGGCCATCGCTCATAAAGCAA
CAAATGGAACAAATGTTTATGGCAATCATGGATATAACAACAGTGAGCCT
GACGTCCAACCGTTTTTCATAGCTCAAGGTCCTAATATTCGTAGGAATTT
CACTATTCCATTTGGCCACAGTGTTGACGTGTATCCGCTAATGTGTTATC
TGCTTGGAATTAATCCCAACCCAAATAACGGTTCTCTCGAACGTATAAAA
GAAATAATTGAACCGAAATCAATAAAAAAATTATGTTCTGTATTGATATA
CATGAAAAACAGTTTTTGGTTACTGTGCACCTCTATAGCCGTATTCTGGT
TATGTGTCATCATTCTGTTTTCACTCAACATATGCAAATGCAATAAAAAG
AAAGATGTGGAAGAGAATATGAAACCAACCTATGCATATTCCAAAATAAA
CAGTTTCTAGATGATTTTACACAACTTGAATATGACTGTTGATTTTTAAA
ACTTATTTTTGAAATTTTTTAAAAATAATAAATTTTCAGTATAAAAAAAA
back to top

protein sequence of SMED30026411-orf-1

>SMED30026411-orf-1 ID=SMED30026411-orf-1|Name=SMED30026411-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=492bp
MKMKNLFSFIFSILCSISIIIVLFQFLPSQWFLDRNQVLLISMDGFRHDY
IEKVKAAGGKTPNFDYLIEQGSRIMRTKNAFPTITLPNHQTLVTGLFPES
HGIVLNTFYDKTFPNETFDMNNQNNLNDPKWFDKWPEPIWVTLEKLGRLT
ASHLWPLTDSPVHGKIPFFQESQFTLLDNPPNYFPFMKRVEDVVYWLSNT
RVHIDFSMLYFPEPDESGHSYGPNGQGTFNAVIMLDSVLGHLIQLLKAKG
LWDKVNIILTADHGMSENSDSRQIPLDEYVNPSWYTYTLLTPVGALYPVK
GKEQAVYNALKNRNPHLQVFWRQEVPASLNYNIDNGRIAPLILIAENKWA
IAHKATNGTNVYGNHGYNNSEPDVQPFFIAQGPNIRRNFTIPFGHSVDVY
PLMCYLLGINPNPNNGSLERIKEIIEPKSIKKLCSVLIYMKNSFWLLCTS
IAVFWLCVIILFSLNICKCNKKKDVEENMKPTYAYSKINSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017849Alkaline_Pase-like_a/b/a
IPR002591Phosphodiest/P_Trfase
IPR017850Alkaline_phosphatase_core_sf
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017850Alkaline-phosphatase-like, core domain superfamilyGENE3DG3DSA:3.40.720.10coord: 38..417
e-value: 5.6E-117
score: 392.7
IPR017850Alkaline-phosphatase-like, core domain superfamilySUPERFAMILYSSF53649Alkaline phosphatase-likecoord: 34..408
IPR002591Type I phosphodiesterase/nucleotide pyrophosphatase/phosphate transferasePFAMPF01663Phosphodiestcoord: 38..367
e-value: 4.6E-68
score: 230.4
NoneNo IPR availableGENE3DG3DSA:3.30.1360.180coord: 266..365
e-value: 5.6E-117
score: 392.7
NoneNo IPR availablePANTHERPTHR10151ECTONUCLEOTIDE PYROPHOSPHATASE/PHOSPHODIESTERASEcoord: 30..429
NoneNo IPR availableCDDcd16018Enppcoord: 38..408
e-value: 8.07464E-90
score: 273.307
NoneNo IPR availableTMHMMTMhelixcoord: 443..465
NoneNo IPR availableTMHMMTMhelixcoord: 5..27