Glutamine synthetase

Overview
NameGlutamine synthetase
Smed IDSMED30026405
Length (bp)1628
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamine synthetase (SMED30026405) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamine synthetase (SMED30026405) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamine synthetase (SMED30026405) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamine synthetase (SMED30026405) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026405

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026405SMESG000003832.1 SmedASXL_019304SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026405SMESG000003832.1 SmedASXL_007407SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30026405SMESG000003832.1 dd_Smed_v4_25996_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026405SMESG000003832.1 dd_Smed_v6_25996_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30026405SMESG000003832.1 OX_Smed_1.0.09244ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamine synthetase vs. Ensembl Human
Match: LGSN (lengsin, lens protein with glutamine synthetase domain [Source:HGNC Symbol;Acc:HGNC:21016])

HSP 1 Score: 147.902 bits (372), Expect = 5.481e-38
Identity = 118/440 (26.82%), Postives = 203/440 (46.14%), Query Frame = 2
Query:  194 EEIKNGLSQ-KIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEV---PKSIVQS---SNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDK----NSKEPFISRFCF----DEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRI---RAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLEL--PPINNTN-----SEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSK 1438
            + I+  +++ ++QF++    D++G+ R K             +E++++ + +     EV   PK    +   +   N +++++P+  T ++ PW   +    V CD +   TG P   +PR I K +L  L   G+ +L    ++F +F      NSK        F    D+ FMQ  +   Y         + G   ESF+     GQ+E      +GI + D  +  +   K VA     IAS+    +     +   ++HSLW        N+F  +S   +L+  GK WLAGLLKHS ALS + +P+V+C +R    R  +  +    W Y D      +K     EK   IEN+L S+ +N YL +A  + AG+DG+ +  E+   P  +T+       ++P  L +AL   + D+ L + LG+ F+ +F+  K
Sbjct:   74 KHIRQAMAKNRLQFVRFEATDLHGVSRSKTIPAHFF------QEKVSHGVCMPRGYLEVIPNPKDNEMNNIRATCFNSDIVLMPELSTFRVLPWADRT--ARVICDTF-TVTGEPLLTSPRYIAKRQLSHLQASGFSLLSAFIYDFCIFGVPEILNSKIISFPALTFLNNHDQPFMQELVDGLY---------HTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFF---IETGFCDSGILSHSLWDVDRKK--NMFCSTSGTEQLTITGKKWLAGLLKHSAALSCLMAPSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCHG--EKGTRIENKLGSATANPYLVLAATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETFIRYFVAMK 488          
BLAST of Glutamine synthetase vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 56.225 bits (134), Expect = 8.224e-8
Identity = 76/364 (20.88%), Postives = 140/364 (38.46%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + I+G G G       L       EE+  +  D S T           S G+N ++ ++P    +   P+ K+ N  +V C+++ K    P   N R  CK  +  +         G+E E+ L   +              + P+      D  + +  +   Y        L AG++    N E    Q EF +    GI   D +W+ + +   V  D G+IA++   P+  N    G H N S     + + L    E+             +  L K  Q     + P   ++  RR+    +T+   +++ G  +R  ++R+  +  +EK  + E+R PS+  + +     +I
Sbjct:   26 VQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSST---------LQSEGSNSDMYLVP--AAMFRDPFRKDPNK-LVLCEVF-KYNRRPAETNLRHTCKRIMDMVSNQ--HPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY-----RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEA-------------IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 56.225 bits (134), Expect = 8.224e-8
Identity = 76/364 (20.88%), Postives = 140/364 (38.46%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + I+G G G       L       EE+  +  D S T           S G+N ++ ++P    +   P+ K+ N  +V C+++ K    P   N R  CK  +  +         G+E E+ L   +              + P+      D  + +  +   Y        L AG++    N E    Q EF +    GI   D +W+ + +   V  D G+IA++   P+  N    G H N S     + + L    E+             +  L K  Q     + P   ++  RR+    +T+   +++ G  +R  ++R+  +  +EK  + E+R PS+  + +     +I
Sbjct:   26 VQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSST---------LQSEGSNSDMYLVP--AAMFRDPFRKDPNK-LVLCEVF-KYNRRPAETNLRHTCKRIMDMVSNQ--HPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY-----RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEA-------------IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 56.225 bits (134), Expect = 8.224e-8
Identity = 76/364 (20.88%), Postives = 140/364 (38.46%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + I+G G G       L       EE+  +  D S T           S G+N ++ ++P    +   P+ K+ N  +V C+++ K    P   N R  CK  +  +         G+E E+ L   +              + P+      D  + +  +   Y        L AG++    N E    Q EF +    GI   D +W+ + +   V  D G+IA++   P+  N    G H N S     + + L    E+             +  L K  Q     + P   ++  RR+    +T+   +++ G  +R  ++R+  +  +EK  + E+R PS+  + +     +I
Sbjct:   26 VQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSST---------LQSEGSNSDMYLVP--AAMFRDPFRKDPNK-LVLCEVF-KYNRRPAETNLRHTCKRIMDMVSNQ--HPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY-----RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEA-------------IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Human
Match: GLUL (glutamate-ammonia ligase [Source:HGNC Symbol;Acc:HGNC:4341])

HSP 1 Score: 56.225 bits (134), Expect = 8.224e-8
Identity = 76/364 (20.88%), Postives = 140/364 (38.46%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + I+G G G       L       EE+  +  D S T           S G+N ++ ++P    +   P+ K+ N  +V C+++ K    P   N R  CK  +  +         G+E E+ L   +              + P+      D  + +  +   Y        L AG++    N E    Q EF +    GI   D +W+ + +   V  D G+IA++   P+  N    G H N S     + + L    E+             +  L K  Q     + P   ++  RR+    +T+   +++ G  +R  ++R+  +  +EK  + E+R PS+  + +     +I
Sbjct:   26 VQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSST---------LQSEGSNSDMYLVP--AAMFRDPFRKDPNK-LVLCEVF-KYNRRPAETNLRHTCKRIMDMVSNQ--HPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY-----RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEA-------------IEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-5 (GLutamiNe synthetase (Glutamate-ammonia ligase) [Source:UniProtKB/TrEMBL;Acc:Q9XVU2])

HSP 1 Score: 68.5514 bits (166), Expect = 2.990e-12
Identity = 72/294 (24.49%), Postives = 126/294 (42.86%), Query Frame = 2
Query:  449 PWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSK----------EPFISRFC---FDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAP---LANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTK--EINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIV 1270
            P+++  NV +V C+  D+ T  P   N R  C   ++++ +  +    G+E E+ + D++             P    +C    D  F +  +   Y        L+AGI     N E   GQ EF +    GI+  D++W+ + +   VA   G+  S    P   + +    G H N S  +    + LN   E+ K  E +            HS+A+SV + P    +  RR+    +T++  + +W   +R  ++R+     +E   ++E+R PSS  + YL  A MIV
Sbjct:   92 PFLQGHNV-LVMCETLDE-TMKPTATNHRQNCAAIMKKVAE--HHPWFGMEQEYLIVDRDEHPLGWPKHGYPAPQGKYYCGVGADRAFGREVVETHY-----RACLHAGINIFGTNAEVTPGQWEFQIGTCEGIDMGDQLWMARYILHRVAEQFGVCVSLDPKPKVTMGDWNGAGCHTNFSTIEMRRPNGLNAIFEAMKGLERT------------HSEAMSV-YDPNGGRDNLRRLTGRHETSQADKFSWGIANRACSIRIPRQVADETKGYLEDRRPSSNCDPYLVTA-MIV 362          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-6 (GLutamiNe synthetase (Glutamate-ammonia ligase) [Source:UniProtKB/TrEMBL;Acc:O02225])

HSP 1 Score: 63.5438 bits (153), Expect = 1.204e-10
Identity = 69/287 (24.04%), Postives = 119/287 (41.46%), Query Frame = 2
Query:  473 VMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSK----------EPFISRFC---FDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAP---LANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLK-HSQALSVIFSPTV--NCYRRIRAAVDTTK--EINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIV 1270
            V+V CD  D     P   N R +C   ++++     +   G+E E+ + D++             P    +C    D  F +  +   Y        L+AGI     N E   GQ EF +    GIE  D++W+ + +   VA   G+  S    P   + +    G H N S         +++      E  ++      + GL K HS+A+ V + P    +  RR+    +T++  + +W   +R  ++R+     +E   ++E+R PSS  + YL  A MIV
Sbjct:   99 VLVMCDTLDHEM-KPTATNHRQMCAELMKKVSD--QQPWFGMEQEYLIVDRDEHPLGWPKHGYPAPQGKYYCGIGADRAFGREVVETHY-----RACLHAGITIFGSNAEVTPGQWEFQIGTCLGIEMGDQLWMARYILHRVAEQFGVCVSLDPKPRVTMGDWNGAGCHTNFST--------IDMRRPDGLETIIAA-----MEGLKKTHSEAMKV-YDPNGGHDNLRRLTGRHETSQADQFSWGIANRACSVRIPRQVADEGRGYLEDRRPSSNCDPYLVTA-MIV 362          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-6 (GLutamiNe synthetase (Glutamate-ammonia ligase) [Source:UniProtKB/TrEMBL;Acc:O02225])

HSP 1 Score: 63.5438 bits (153), Expect = 1.204e-10
Identity = 69/287 (24.04%), Postives = 119/287 (41.46%), Query Frame = 2
Query:  473 VMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSK----------EPFISRFC---FDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAP---LANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLK-HSQALSVIFSPTV--NCYRRIRAAVDTTK--EINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIV 1270
            V+V CD  D     P   N R +C   ++++     +   G+E E+ + D++             P    +C    D  F +  +   Y        L+AGI     N E   GQ EF +    GIE  D++W+ + +   VA   G+  S    P   + +    G H N S         +++      E  ++      + GL K HS+A+ V + P    +  RR+    +T++  + +W   +R  ++R+     +E   ++E+R PSS  + YL  A MIV
Sbjct:   99 VLVMCDTLDHEM-KPTATNHRQMCAELMKKVSD--QQPWFGMEQEYLIVDRDEHPLGWPKHGYPAPQGKYYCGIGADRAFGREVVETHY-----RACLHAGITIFGSNAEVTPGQWEFQIGTCLGIEMGDQLWMARYILHRVAEQFGVCVSLDPKPRVTMGDWNGAGCHTNFST--------IDMRRPDGLETIIAA-----MEGLKKTHSEAMKV-YDPNGGHDNLRRLTGRHETSQADQFSWGIANRACSVRIPRQVADEGRGYLEDRRPSSNCDPYLVTA-MIV 362          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 63.5438 bits (153), Expect = 1.245e-10
Identity = 68/282 (24.11%), Postives = 117/282 (41.49%), Query Frame = 2
Query:  476 MVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFD---------KNS----KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSP--TVNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +V C+ YD     P   N R  CK  +++          G+E E+ L D         KN     + P+      ++ + +  +   Y        L AGI+    N E   GQ EF +    GI+  D++W+ + L + VA + G+IAS+   P+  +    G H N S  K  +   ++     S  N+LS          L H Q ++  + P    +  RR+    +T     ++YG   R  ++R+  S D++   + E+R PSS  + Y     ++
Sbjct:   98 LVMCETYDNKK-KPTATNYRQRCKEVMEKAADQ--HPWFGMEQEYTLLDIDGHPFGWPKNGFPGPQGPYYCGVGANKVYGRDIVEAHY-----RACLYAGIQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEI--MSAINKLS----------LVHPQHIAY-YDPHGGKDNERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALV 358          
BLAST of Glutamine synthetase vs. Ensembl Celegans
Match: gln-3 (Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc:H8ESF5])

HSP 1 Score: 63.5438 bits (153), Expect = 1.416e-10
Identity = 68/282 (24.11%), Postives = 117/282 (41.49%), Query Frame = 2
Query:  476 MVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFD---------KNS----KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSP--TVNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +V C+ YD     P   N R  CK  +++          G+E E+ L D         KN     + P+      ++ + +  +   Y        L AGI+    N E   GQ EF +    GI+  D++W+ + L + VA + G+IAS+   P+  +    G H N S  K  +   ++     S  N+LS          L H Q ++  + P    +  RR+    +T     ++YG   R  ++R+  S D++   + E+R PSS  + Y     ++
Sbjct:  101 LVMCETYDNKK-KPTATNYRQRCKEVMEKAADQ--HPWFGMEQEYTLLDIDGHPFGWPKNGFPGPQGPYYCGVGANKVYGRDIVEAHY-----RACLYAGIQISGTNAEVMPGQWEFQVGPCEGIQMGDQLWVARYLLQRVAEEFGVIASFDCKPIKGDWNGAGCHTNFSTDKMRNPGGIDEI--MSAINKLS----------LVHPQHIAY-YDPHGGKDNERRLTGLHETASIDKFSYGVASRASSIRIPRSTDDDGYGYFEDRRPSSNCDPYTVTGALV 361          
BLAST of Glutamine synthetase vs. Ensembl Fly
Match: Gs1 (gene:FBgn0001142 transcript:FBtr0078115)

HSP 1 Score: 66.2402 bits (160), Expect = 2.565e-11
Identity = 85/390 (21.79%), Postives = 158/390 (40.51%), Query Frame = 2
Query:  155 ARENSVMRKYRNCEEIKNGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDE---------HFMQTTMALPYAIRMREQ----ALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQ-PANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTK--EINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIV 1270
            A + S++++YRN E   N        +QA  + I+G G         L  + ++ E++         + +   S    ++G N +  + P    +   P+    N V+V CD Y  + G P   N R   +  +  +         G+E E+ L D + +      F + E         ++        YA  + E      L AGI+F   N E    Q EF +    GI+A D +W+ + + + +A + G++ ++   P+  Q    G H N S  +   +  +    E+     + +L K       +H + +   + P    +  RR+   ++T+   + +W   +R V++RV          ++E+R PSS  + Y AV   IV
Sbjct:   43 ALDKSILQRYRNLETPAN-------RVQATYLWIDGTGENIRLKDRVLDKVPSSVEDLP--------DWQYDGSSTYQAHGENSDTTLKP--RAIYRDPFKPGKNDVIVLCDTY-SADGKPTASNKRAAFQAAIDLISD--QEPWFGIEQEYTLLDVDGRP-----FGWPENGFPAPQGPYYCGVGADRVYARDLVEAHVVACLYAGIDFAGTNAEVMPAQWEFQIGPA-GIKACDDLWVSRYILQRIAEEYGVVVTFDPKPMEGQWNGAGAHTNFSTKEMRADGGIKAIEEA-----IEKLSK-------RHERHIKA-YDPKEGKDNERRLVGRLETSSIDKFSWGVANRAVSVRVPRGVATAGKGYLEDRRPSSNCDPY-AVCNAIV 392          
BLAST of Glutamine synthetase vs. Ensembl Fly
Match: Gs1 (gene:FBgn0001142 transcript:FBtr0078114)

HSP 1 Score: 66.2402 bits (160), Expect = 2.565e-11
Identity = 85/390 (21.79%), Postives = 158/390 (40.51%), Query Frame = 2
Query:  155 ARENSVMRKYRNCEEIKNGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDE---------HFMQTTMALPYAIRMREQ----ALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQ-PANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTK--EINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIV 1270
            A + S++++YRN E   N        +QA  + I+G G         L  + ++ E++         + +   S    ++G N +  + P    +   P+    N V+V CD Y  + G P   N R   +  +  +         G+E E+ L D + +      F + E         ++        YA  + E      L AGI+F   N E    Q EF +    GI+A D +W+ + + + +A + G++ ++   P+  Q    G H N S  +   +  +    E+     + +L K       +H + +   + P    +  RR+   ++T+   + +W   +R V++RV          ++E+R PSS  + Y AV   IV
Sbjct:   43 ALDKSILQRYRNLETPAN-------RVQATYLWIDGTGENIRLKDRVLDKVPSSVEDLP--------DWQYDGSSTYQAHGENSDTTLKP--RAIYRDPFKPGKNDVIVLCDTY-SADGKPTASNKRAAFQAAIDLISD--QEPWFGIEQEYTLLDVDGRP-----FGWPENGFPAPQGPYYCGVGADRVYARDLVEAHVVACLYAGIDFAGTNAEVMPAQWEFQIGPA-GIKACDDLWVSRYILQRIAEEYGVVVTFDPKPMEGQWNGAGAHTNFSTKEMRADGGIKAIEEA-----IEKLSK-------RHERHIKA-YDPKEGKDNERRLVGRLETSSIDKFSWGVANRAVSVRVPRGVATAGKGYLEDRRPSSNCDPY-AVCNAIV 392          
BLAST of Glutamine synthetase vs. Ensembl Fly
Match: Gs1 (gene:FBgn0001142 transcript:FBtr0300568)

HSP 1 Score: 66.2402 bits (160), Expect = 2.565e-11
Identity = 85/390 (21.79%), Postives = 158/390 (40.51%), Query Frame = 2
Query:  155 ARENSVMRKYRNCEEIKNGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDE---------HFMQTTMALPYAIRMREQ----ALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQ-PANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTK--EINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIV 1270
            A + S++++YRN E   N        +QA  + I+G G         L  + ++ E++         + +   S    ++G N +  + P    +   P+    N V+V CD Y  + G P   N R   +  +  +         G+E E+ L D + +      F + E         ++        YA  + E      L AGI+F   N E    Q EF +    GI+A D +W+ + + + +A + G++ ++   P+  Q    G H N S  +   +  +    E+     + +L K       +H + +   + P    +  RR+   ++T+   + +W   +R V++RV          ++E+R PSS  + Y AV   IV
Sbjct:   43 ALDKSILQRYRNLETPAN-------RVQATYLWIDGTGENIRLKDRVLDKVPSSVEDLP--------DWQYDGSSTYQAHGENSDTTLKP--RAIYRDPFKPGKNDVIVLCDTY-SADGKPTASNKRAAFQAAIDLISD--QEPWFGIEQEYTLLDVDGRP-----FGWPENGFPAPQGPYYCGVGADRVYARDLVEAHVVACLYAGIDFAGTNAEVMPAQWEFQIGPA-GIKACDDLWVSRYILQRIAEEYGVVVTFDPKPMEGQWNGAGAHTNFSTKEMRADGGIKAIEEA-----IEKLSK-------RHERHIKA-YDPKEGKDNERRLVGRLETSSIDKFSWGVANRAVSVRVPRGVATAGKGYLEDRRPSSNCDPY-AVCNAIV 392          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:ZFIN;Acc:ZDB-GENE-060312-26])

HSP 1 Score: 151.754 bits (382), Expect = 8.510e-39
Identity = 129/451 (28.60%), Postives = 214/451 (47.45%), Query Frame = 2
Query:  188 NCEEIKNGLSQK-IQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSI----VQSSNGTN--GNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMA----LPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRI-RAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPI--NNTNSEK---LPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDIND 1483
            + E IK  ++++ + F++    D++G+ R K              E+  Y I +  +  E+  S     V  ++  N   +V+++PD  T +I PW   +    + CD     TG+P   +PRLI K  L +L  +G+ +     +E  +F   S E    +  F   F  TT+      P+  ++ +   N G++ ESF+   G GQ+E      +G++A D  + F+   K +A     IA++ T    N   +G+ ++HSLW  +    L  FH  S   ELSE+G+ WL+GLL HS ALS + +P ++C  +I +   D+   +    G  D      VK+    E    I+N+L S+ +N Y+ +A  I AG+DGIK  L    +     N +K   +P  L +AL     D V+   LG+ FV +FI  K   ++   +D D N+
Sbjct:  236 DVERIKQQIARENLSFVRFEATDLHGVSRSKTVPARFF------HEKAVYGIPMPRSYLELTLSPQINEVDHASAVNFSSDVLLVPDLSTFQILPWADQT--ARLICDPC-TITGVPLRTSPRLIAKMMLGQLQSMGFSLHSSFTYECCIF--GSPEHVGPKAVF---FPATTLLSNNDQPFLQQLVKGMYNMGVDVESFSSANGPGQMEICFKPRFGMDAADNAYTFRTGIKEMARKYDYIATFFT--YENIQNSGL-LSHSLWDASGRRSL--FH--SGNGELSEIGRKWLSGLLHHSAALSCLLAPGISCRTQISKGKKDSKNHVYATCGCNDNSCDFNVKIHGGRE--THIDNKLASAMANPYIVLAATIAAGLDGIKRNLNAEQVLSRAPNQQKQFVIPVKLDDALLALAEDSVICGALGEPFVQYFIAMK-QIEMESQEDADRNE 662          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 63.1586 bits (152), Expect = 2.667e-10
Identity = 82/364 (22.53%), Postives = 146/364 (40.11%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTT--KEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +Q + + I+G G G       L     + EE+  +  D S T           + G+N ++ + P  + +   P+ K+ N  +V CD+  K    P   N R  CK K+ ++ +       G+E E+ L   +              + P+      D+ + +  +   Y        L AG++    N E    Q EF +    GIE  D +W+ + L   V  D G++AS+   P+  N    G H N S  +  +   L    ES     + +LGK       +H   +   + P   ++  RR+    +T+   E +    +R  ++R+  S  +EK  + E+R PS+  + Y     +I
Sbjct:   26 VQVMYIWIDGTGEGLRCKTRTLDSEPKSVEELPEWNFDGSST---------YQAEGSNSDMYLFP--QAMFRDPFRKDPNK-LVLCDVL-KYNHKPAETNLRQSCK-KIMDMVQ-NQHPWFGMEQEYTLLGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDVVEAHY-----RACLYAGVKICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHIEES-----IEKLGK-------RHQYHIRA-YDPKGGLDNARRLTGHHETSNINEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 63.1586 bits (152), Expect = 3.203e-10
Identity = 84/362 (23.20%), Postives = 143/362 (39.50%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICK-------NKLQELGKLGYRMLIGVE-HEFHLFDKNSKEPFISRFC---FDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTT--KEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +Q + + I+G G G       L     + EE+  +  D S T           + G+N ++ + P  + +   P+ K+ N  +V CD+  K    P   N R  CK       N+    G      L+G + H F         P    +C    D+ + +  +   Y        L AG++    N E    Q EF +    GIE  D +W+ + L   V  D G++AS+   P+  N    G H N S  +  +   L    ES     + +LGK       +H   +   + P   ++  RR+    +T+   E +    +R  ++R+  S  +EK  + E+R PS+  + Y     +I
Sbjct:   26 VQVMYIWIDGTGEGLRCKTRTLDSEPKSVEELPEWNFDGSST---------YQAEGSNSDMYLFP--QAMFRDPFRKDPNK-LVLCDVL-KYNHKPAETNLRQSCKKIMDMVQNQHPWFGMEQEYTLLGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDVVEAHY-----RACLYAGVKICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHIEES-----IEKLGK-------RHQYHIRA-YDPKGGLDNARRLTGHHETSNINEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 63.1586 bits (152), Expect = 3.203e-10
Identity = 84/362 (23.20%), Postives = 143/362 (39.50%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICK-------NKLQELGKLGYRMLIGVE-HEFHLFDKNSKEPFISRFC---FDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTT--KEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +Q + + I+G G G       L     + EE+  +  D S T           + G+N ++ + P  + +   P+ K+ N  +V CD+  K    P   N R  CK       N+    G      L+G + H F         P    +C    D+ + +  +   Y        L AG++    N E    Q EF +    GIE  D +W+ + L   V  D G++AS+   P+  N    G H N S  +  +   L    ES     + +LGK       +H   +   + P   ++  RR+    +T+   E +    +R  ++R+  S  +EK  + E+R PS+  + Y     +I
Sbjct:   26 VQVMYIWIDGTGEGLRCKTRTLDSEPKSVEELPEWNFDGSST---------YQAEGSNSDMYLFP--QAMFRDPFRKDPNK-LVLCDVL-KYNHKPAETNLRQSCKKIMDMVQNQHPWFGMEQEYTLLGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDVVEAHY-----RACLYAGVKICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHIEES-----IEKLGK-------RHQYHIRA-YDPKGGLDNARRLTGHHETSNINEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Match: glulb (glutamate-ammonia ligase (glutamine synthase) b [Source:ZFIN;Acc:ZDB-GENE-030131-8417])

HSP 1 Score: 63.1586 bits (152), Expect = 3.203e-10
Identity = 84/362 (23.20%), Postives = 143/362 (39.50%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICK-------NKLQELGKLGYRMLIGVE-HEFHLFDKNSKEPFISRFC---FDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTT--KEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +Q + + I+G G G       L     + EE+  +  D S T           + G+N ++ + P  + +   P+ K+ N  +V CD+  K    P   N R  CK       N+    G      L+G + H F         P    +C    D+ + +  +   Y        L AG++    N E    Q EF +    GIE  D +W+ + L   V  D G++AS+   P+  N    G H N S  +  +   L    ES     + +LGK       +H   +   + P   ++  RR+    +T+   E +    +R  ++R+  S  +EK  + E+R PS+  + Y     +I
Sbjct:   26 VQVMYIWIDGTGEGLRCKTRTLDSEPKSVEELPEWNFDGSST---------YQAEGSNSDMYLFP--QAMFRDPFRKDPNK-LVLCDVL-KYNHKPAETNLRQSCKKIMDMVQNQHPWFGMEQEYTLLGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDVVEAHY-----RACLYAGVKICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFLLHRVCEDFGVVASFDPKPIPGNWNGAGCHTNFSTKEMREEGGLKHIEES-----IEKLGK-------RHQYHIRA-YDPKGGLDNARRLTGHHETSNINEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: pkn2 (protein kinase N2 [Source:Xenbase;Acc:XB-GENE-995298])

HSP 1 Score: 146.362 bits (368), Expect = 1.050e-37
Identity = 120/441 (27.21%), Postives = 204/441 (46.26%), Query Frame = 2
Query:  188 NCEEIKNGLSQK-IQFIQAVVVDINGIGRGKM-----FSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLF----DKNSKEPFISRFCF----DEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRI-RAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSE---------KLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSK 1438
            N E IK  ++++ I FI+  V D++G  R K+     F  + ++ +  +R  +   ++   + ++  K+I       N ++++ PD  T ++ PW + +  V+  CD Y    G      PR + K  L +L + G+ +     +EF +F      +SK+            D+ F+Q      Y I         G   ESF   +  GQ+E      YG+ A D  + F+   K VA   G I+S+          N    +HSLW  +     N+F + ++  EL+++G+ WL+GLL HS ALS + +P V+C +   + A D  + I   YG    +    V        +IEN+L S+A+N YL +A  + AG+DGI+ GL+L    +TN +          +P  + +AL   + D+ +   LG  F+ +FI  K
Sbjct:   30 NIEMIKQQIAREDIHFIRFEVADLHGFPRSKIIPERFFHEKAVSGIHVSRSYLEPNMNPIDSEADHKKAIY-----FNSDIVLKPDLSTFRVLPWAEKTGKVI--CDAY-TIMGDSLLTYPRYLAKQLLMQLQESGFSLHASFNYEFCIFGVAETVDSKKVVFPAATLVTDNDQLFLQELFDGMYYI---------GGNIESFCSSSTPGQMEISFQPEYGLTAADNAFTFRAALKEVAKKYGYISSFCND--VGGIYNSGVFSHSLWDSSGTK--NLFIDGNQIQELTDIGRKWLSGLLFHSAALSCLVAPGVSCRKHFAKGAKDPQESIGATYGFNDNSCSYNVKCHCSSGTYIENKLCSAAANPYLVLAATVAAGLDGIRRGLDL--FIDTNRKFSPHQFKMHSVPMKMEDALSALKEDRYIRAALGDVFIHYFIAVK 447          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: avpr1b (arginine vasopressin receptor 1B [Source:Xenbase;Acc:XB-GENE-481094])

HSP 1 Score: 144.821 bits (364), Expect = 3.292e-37
Identity = 120/441 (27.21%), Postives = 203/441 (46.03%), Query Frame = 2
Query:  188 NCEEIKNGLSQK-IQFIQAVVVDINGIGRGKM-----FSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLF----DKNSKEPFISRFCF----DEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRI-RAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSE---------KLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSK 1438
            N E IK  ++++ I FI+  V D+ G  R K+     F  + ++ +  +R  +   ++   + ++  K+I       N ++++ PD  T ++ PW + +  V+  CD Y    G     +PR + K  L +L + G+ +     +EF +F      +SK+            D+ F+Q      Y I         G   ESF   +  GQ+E      YG+ A D  + F+   K VA   G I+S+          N    +HSLW  +     N+F + ++  EL ++G+ WL+GLL HS ALS + +P V+C +   + A D  + I   YG    +    V        +IEN+L S+A+N YL +A  + AG+DGI+ GL+L    +TN +          +P  + +AL   + D+ +   LG  F+ +FI  K
Sbjct:   30 NIEMIKQQIAREDIHFIRFEVADLYGFPRSKIIPERFFHEKAVSGIHVSRSYLEPNMNPIDSEADHKKAIY-----FNSDIVLKPDLSTFRVLPWAEKTGKVI--CDAY-TIMGDSLLTSPRYLAKQLLMQLQESGFSLHASFNYEFCIFGVAETVDSKKVVFPAATLVTDNDQLFLQELFDGMYYI---------GGNIESFCSSSTPGQMEISFQPEYGLTAADNAFTFRAALKEVAKKYGYISSFCND--VGGIYNSGVFSHSLWDSSGTK--NLFIDGNQIQELPDIGRKWLSGLLFHSAALSCLVAPGVSCRKHFAKGAKDPQESIGATYGFNDNSCSYNVKCHCSSGTYIENKLCSAAANPYLVLAATVAAGLDGIRRGLDL--FIDTNRKFSPHQFKMHSVPMKMEDALSALKEDRYIRAALGDVFIHYFIAVK 447          
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Match: c8a (complement component 8, alpha polypeptide [Source:Xenbase;Acc:XB-GENE-980231])

HSP 1 Score: 54.6842 bits (130), Expect = 2.439e-7
Identity = 78/366 (21.31%), Postives = 140/366 (38.25%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDL--YDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTK--EINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + ++G G G       L       E++  +  D S T           S G+N ++ +IP    +   P+ ++ N  +V C++  Y++ T      N R  C   +  +         G+E E+ L   +              + P+      D+ + +  +   Y        L AG++    N E    Q EF +    GIE  D +WI + +   +  D G+I S+   P+  N    G H N S     +   L    ES     +  L K       +H   +  ++ P    +  RR+    +T+   E +    +R  ++R+  S  +EK  + E+R PS+  + Y     MI
Sbjct:   26 VQAMYIWVDGTGEGLRCKTRTLDSEPKTIEDLPEWNFDGSST---------YQSEGSNSDMYLIP--VAMFRDPFRRDPNK-LVLCEVLKYNRKTA---ETNLRHTCNQIMDMMANE--HPWFGMEQEYTLLGMDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY-----RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGIEMGDHLWIARFILHRICEDFGIIVSFDPKPITGNWNGAGCHTNFSTKSMREEGGLKDIEES-----IERLSK-------RHDYHIR-MYDPRGGKDNARRLTGFHETSSIHEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYAVTEAMI 356          
BLAST of Glutamine synthetase vs. Ensembl Mouse
Match: Lgsn (lengsin, lens protein with glutamine synthetase domain [Source:MGI Symbol;Acc:MGI:2672844])

HSP 1 Score: 146.747 bits (369), Expect = 1.991e-37
Identity = 103/364 (28.30%), Postives = 171/364 (46.98%), Query Frame = 2
Query:  401 NGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDK----NSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRR-------IRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKN-------GLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSK 1438
            N +++++P+  T ++ PW + +    V CD +   TG P   +PR I K +L++L   G+ +L    ++F +F      NSK        F    + +    P+   + E     G   ESF+     GQ+E      +GI + D  +  +   + VA     IAS +   +     N   ++HS+W     +  N+F   S    L+  GK WLAGLLKHS ALS + +P VNC +R       ++ +V TT    W Y D   A+ +K     EK   IEN+L S+ +N YL +A  + AG+DG+++         E   +      ++P  + +AL   + D+ L + LG+ F+ +F+  K
Sbjct:  198 NSDIVLMPELSTFRVLPWAERT--ARVICDTF-TVTGEPLLTSPRYIAKRQLRQLQDAGFCLLSAFIYDFCIFGVPEVINSKT-----ISFPASTLLSNHDQPFMQELVEGLYQTGANVESFSSSTRPGQMEICFLPEFGISSADNAFTLRTGLQEVARRYNYIASLV---IETGFCNSGILSHSIWDVGGKT--NMFCSGSGVERLTLTGKKWLAGLLKHSAALSCLMAPAVNCRKRYCKDSRDLKDSVPTT----WGYNDNSCALNIKCHG--EKGTQIENKLGSATANPYLVLAATVAAGLDGLQSSDGAAAGSDESQDLYQPEPSEIPLKMEDALAALEQDECLKQALGETFIRYFVAMK 542          
BLAST of Glutamine synthetase vs. Ensembl Mouse
Match: Glul (glutamate-ammonia ligase (glutamine synthetase) [Source:MGI Symbol;Acc:MGI:95739])

HSP 1 Score: 55.0694 bits (131), Expect = 1.230e-7
Identity = 77/364 (21.15%), Postives = 141/364 (38.74%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + ++G G G       L       EE+  +  D S T           S G+N ++ + P    +   P+ K+ N  +V C+++ K    P   N R ICK  +  +         G+E E+ L   +              + P+      D+ + +  +   Y        L AG++    N E    Q EF +    GI   D +WI + +   V  D G+IA++   P+  N    G H N S     + + L    E+             +  L K  Q     + P   ++  RR+    +T+   +++ G  +R  ++R+  +  +EK  + E+R PS+  + Y     ++
Sbjct:   26 VQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQ---------SEGSNSDMYLHP--VAMFRDPFRKDPNK-LVLCEVF-KYNRKPAETNLRHICKRIMDMVSNQ--HPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY-----RACLYAGVKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKCIEEA-------------IDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIV 356          
BLAST of Glutamine synthetase vs. Ensembl Mouse
Match: Glul (glutamate-ammonia ligase (glutamine synthetase) [Source:MGI Symbol;Acc:MGI:95739])

HSP 1 Score: 55.0694 bits (131), Expect = 1.230e-7
Identity = 77/364 (21.15%), Postives = 141/364 (38.74%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + ++G G G       L       EE+  +  D S T           S G+N ++ + P    +   P+ K+ N  +V C+++ K    P   N R ICK  +  +         G+E E+ L   +              + P+      D+ + +  +   Y        L AG++    N E    Q EF +    GI   D +WI + +   V  D G+IA++   P+  N    G H N S     + + L    E+             +  L K  Q     + P   ++  RR+    +T+   +++ G  +R  ++R+  +  +EK  + E+R PS+  + Y     ++
Sbjct:   26 VQAMYIWVDGTGEGLRCKTRTLDCEPKCVEELPEWNFDGSSTFQ---------SEGSNSDMYLHP--VAMFRDPFRKDPNK-LVLCEVF-KYNRKPAETNLRHICKRIMDMVSNQ--HPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY-----RACLYAGVKITGTNAEVMPAQWEFQIGPCEGIRMGDHLWIARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKCIEEA-------------IDKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIV 356          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|Q05907|GLN1A_PYRFU (Glutamine synthetase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) OX=186497 GN=glnA PE=3 SV=2)

HSP 1 Score: 181.8 bits (460), Expect = 3.334e-50
Identity = 144/462 (31.17%), Postives = 222/462 (48.05%), Query Frame = 2
Query:  206 NGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKE----PFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNS-------------EKLPESLSEALEIFQADKVLVEGLG---KDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            N    KI+F+Q V VDING+ +G      +L       E +T  I   G+      S+       + +++   D +T    PW    NV  V+  +Y  +   P   +PR I K  L+EL K GY+  IG E EF+LF KN       P +  + FD   +    A      + E   + G+  E  + E G  Q E        ++  D +  FK ++K VA   GL A++M  PL   P NGMH++ SLWK  +N F+        E  LSE+  H++ G+LKH++AL+ + +PTVN Y+R+  + +    I+W Y +R   +RV       K   IE R P  ++N Y A A ++ AG+DGIK+ ++       N              E LP SL EALE  + DKV+ E LG   K+F+++  K ++++ +  L++  +   T    + E E+YF L
Sbjct:    8 NKFDSKIKFVQLVFVDINGMPKGMEIPASRL------EEAVTDGISFDGS------SVPGFQGIEDSDLVFKADPDTYVEVPW---DNVARVYGFIYKDNK--PYGADPRGILKRALEELEKEGYKAYIGPEPEFYLFKKNGTWELEIPDVGGY-FD--ILTLDKARDIRREIAEYMPSFGLIPEVLHHEVGKAQHEIDFRYDEALKTADNIVSFKYITKAVAEMHGLYATFMPKPLFGFPGNGMHLHISLWKDGENVFMG-------EEGLSEIALHFIGGILKHAKALTAVTNPTVNSYKRLVPSYEAPVYISWGYRNRSALIRVPAFWG--KGARIEYRCPDPSANPYFAFAAVLKAGLDGIKHKIDPFAYVEENVYEMSEEKRKELGIETLPGSLGEALEELEKDKVVKEALGDAYKNFINYKWK-EWESYLEYLEEKHMPKDTKKVTEWELERYFFL 439          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|Q9UY99|GLN1A_PYRAB (Glutamine synthetase OS=Pyrococcus abyssi (strain GE5 / Orsay) OX=272844 GN=glnA PE=3 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 2.469e-49
Identity = 137/467 (29.34%), Postives = 222/467 (47.54%), Query Frame = 2
Query:  188 NCEEIKNGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKE----PFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNS-------------EKLPESLSEALEIFQADKVLVEGLGKDFVDF--FIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            N  E+K+G ++  +F+Q + VDING+ +G      +L + + +         IS   S VP          + ++I   D +T    PW    NV  V+  +Y    G P   +PR + K  +++L ++G +  IG E EF+LF KN       P +  + FD   +    A      + E   + G+  E  + E G  Q E        ++  D +  FK + K VA   GL A++M  P+   P NGMH++ SLWK+ +N F         E  LSE   H++ GLLKH++AL+ I +PTVN Y+R+    +    I+W Y +R   +RV           IE R P  ++N Y A A +++AG+DGIK+ +E       N              + LP SL EAL+  + DKV+ E LG+ + +F  + + ++++ +  L+   +   T    + E E+YF +
Sbjct:    2 NVSEVKSGATRSPKFVQLIFVDINGMPKGMEIPASRLQEAIED--------GISFDGSSVP----GFQGIEDSDLIFKADPDTYVEVPW---DNVARVYGYIY--KDGKPYGADPRGVLKRVIEKLAEMGIKAYIGPEPEFYLFKKNGSWELEIPDVGGY-FD--ILTLDKAKDIKREIAEYMPSFGLVPEVLHHEVGKAQHEIDFRYDEALKTADNIISFKYIVKAVAEVHGLYATFMPKPIYGMPGNGMHLHISLWKEGENIF-------KGEEGLSETALHFIGGLLKHAKALTAITNPTVNSYKRLVPGYEAPVYISWGYKNRSALIRVPAFWGNGAR--IEYRCPDPSANPYFAFAAILMAGLDGIKHKVEPFAYVEENVYEMDEGKRKELGIDTLPGSLGEALDELEKDKVVREALGEAYKNFIEYKRKEWESYLEYLEAKHLPKDTKRVTEWELERYFFI 439          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|O58097|GLN1A_PYRHO (Glutamine synthetase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=glnA PE=3 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 3.377e-48
Identity = 136/460 (29.57%), Postives = 221/460 (48.04%), Query Frame = 2
Query:  209 GLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKE----PFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLE--------LPPINNTNSEK-----LPESLSEALEIFQADKVLVEGLGKDFVDF--FIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            G  ++I+F+Q + VDING+ +G    I +L + +           I+   S VP          + +++   D  T    PW    NV  V+  +Y    G P   +PR + +  L+ L KLG ++ IG E EF+LF KN       P +  + FD   +    A      + E     G+  E  + E G  Q E        ++  D +  FK + K VA   GL A++M  P+   P NGMH++ SLWK  +N F         E  LSE   +++ GLLKH++AL+ + +PTVN Y+R+    +    I+W Y +R   +RV           IE R P  ++N YLA A +++AG+DGIK+ +E        +  ++    E+     LPE+L EAL+  + DKV+ E LG  + +F  + + +++  ++ L+  ++   T N  + E E+YF +
Sbjct:   13 GQGKRIKFVQLIFVDINGMPKGMEVPITRLEEAIEE--------GIAFDGSSVP----GFQGIEDSDLVFKADPSTYVEVPW---DNVARVYGYIY--KDGKPYEADPRGVLRRTLERLEKLGIKVYIGPEPEFYLFKKNGSWELEIPDVGGY-FD--ILTLDKAKDIKREIAEYMPYFGLTPEVLHHEVGKAQHEIDFRHDEALKTADNIVSFKYIVKAVAEMHGLYATFMPKPIYGMPGNGMHLHISLWKDGENIF-------KGEEGLSETALYFIGGLLKHAKALAAVTNPTVNSYKRLVPGYEAPVYISWGYKNRSALIRVPAFWGNGAR--IEYRCPDPSANSYLAFAAILMAGLDGIKHKIEPFAYVEENVYEMDEKRREEIGIDMLPENLGEALDELERDKVVKEALGGAYRNFVGYKRKEWEEYLDYLEAKNLPKDTKNVTEWELERYFFI 443          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|P36687|GLN1A_PYRWO (Glutamine synthetase OS=Pyrococcus woesei OX=2262 GN=glnA PE=3 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 2.685e-47
Identity = 144/462 (31.17%), Postives = 221/462 (47.84%), Query Frame = 2
Query:  206 NGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS----KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNS-------------EKLPESLSEALEIFQADKVLVEGLG---KDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            N    KI+F+Q V VDING+ +G      +L       E +T  I   G++    + I  S      +++   D +T    PW    NV  V+  +Y  +   P   +PR I K  L+EL K GY+  IG E EF+LF KN     + P +  + FD   +    A      + E   + G+  E  + E G  Q E        ++  D +  FK ++K VA   GL A++M  PL   P NGMH++ SL K  +N F+        E  LSE+  H++ G+LKH++AL  + +PTVN Y+R+    +    I+W Y +R   +RV       K   IE R P  ++N Y A A ++ AG+DGIK+ ++       N              E LP SL EALE  + DKV+ E LG   K+F+++  K ++++ +  L++  +   T    + E E+YF L
Sbjct:    8 NKFDSKIKFVQLVFVDINGMPKGMEIPASRL------EEAVTDGISFDGSSVPGFQGIEDS------DLVFKADPDTYVEVPW---DNVARVYGFIYKDNK--PYGADPRGILKRALEELEKEGYKAYIGPEPEFYLFKKNGTWELEIPDVGGY-FD--ILTLDKARDIRREIAEYMPSFGLIPEVLHHEVGKAQHEIDFRYDEALKTADNIVSFKYITKAVAEMHGLYATFMPKPLFGFPGNGMHLHISLSKDGENVFMG-------EEGLSEIALHFIGGILKHAKALIAVTNPTVNSYKRLVPGYEAPVYISWGYRNRSALIRVPAFWG--KGARIEYRCPDPSANPYFAFAAVLKAGLDGIKHKIDPFAYVEENVYEMSEEKRKELGIETLPGSLGEALEELEKDKVVKEALGDAYKNFINYKWK-EWESYLEYLEEKHMPKDTKKVTEWELERYFFL 439          
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Match: sp|O08467|GLN1A_THEKO (Glutamine synthetase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=glnA PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 2.393e-42
Identity = 133/454 (29.30%), Postives = 209/454 (46.04%), Query Frame = 2
Query:  227 QFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSK-EPFI--SRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNS-------------EKLPESLSEALEIFQADKVLVEGLG---KDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            +F+     DING  +G    +E+  + + +         +S   S +P          + ++I   D  T    PW     +  V+  +Y      P   +PR I K  L+ L K G +  IG E EF++F KN   E  I  S   FD   +     +   I +    L  G++ E  + E G  Q E        +   D +  FK + K VA   G  A++M  P+   P NGMH++ SLWK  +N F+        E+ LS+   H++ G+LKH++AL+ + +PTVN Y+R+    +    I+W Y +R   +RV   K       IE R P  ++N YLA+AG+++ G+DGIK  +E      TN              + LP SL EALE  + DK + E LG   K+F+D + + +++  +  L   DI   T    + E E+YF++
Sbjct:   19 RFLLLAFTDINGSLKGMEIPMERYEEAVED--------GVSFDGSSIP----GFEGIEDSDLIFKADPSTYAEIPW---EGIGRVYGYIYKGDE--PYQADPRGILKRVLERLEKEGLKAHIGPEPEFYIFKKNGTWELHIPDSGGYFDLVGLDKAREIRREIALYMPYL--GLKPEVLHHEVGKAQHEIDFRYDEALRTADNIVSFKHVVKAVAELHGYYATFMPKPIYGFPGNGMHLHISLWKDGENVFIG-------EDGLSDTALHFIGGILKHAKALAALTNPTVNSYKRLVPGYEAPVYISWGYRNRSALIRVPAFKGSGAR--IEYRCPDPSANPYLALAGILMVGLDGIKKKVEPDSYVETNVYEMDDAERERLGIDTLPGSLGEALEELKKDKTVREALGGAYKNFID-YKEREWEEYIEYLSSRDIPIDTKKVTEWELERYFYV 443          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A1I8HS62 (Gln-synt_C domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030319g3 PE=3 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 1.478e-64
Identity = 141/435 (32.41%), Postives = 224/435 (51.49%), Query Frame = 2
Query:  224 IQFIQAVVVDINGIGRGKMFSIEKLADL-MNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHES-SKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKY 1522
            +++++ +  DING  R K+ +         +       ++ ++   + V + +  S  G   N I+  D  TL+       +    V C+++   TG P P + R ICK  ++++  +G  +L   E EF LF     +P      +   F+ + +  P+   +      AG+  E  + E G GQ+E  L   +GIE+VD+ + FK ++K  A      AS+MT  L  Q  NG H+N SLW  + N   N+FH + S   +LS  G+ +L+GLL H++AL+ + SPTVNCYRR+      TK  ++   +R    R++  + E     +E+R+ SSA N YLA+A  + AG+DGI+  L L  ++ T  + LP S SEALE F+AD    E LG DFV +F   K DT+V  L  V++   T + F+ EK+ Y
Sbjct:    7 VEYLRLLFPDINGCARSKILTPRAFKAFEQHGLAMFQGMLGMACQGTAVTRMLADSGCG---NAIVKADWSTLRTYTAQSGAQYGDVLCNMFVAGTGEPYPTDTRYICKQAIKQMNNIGLEVLATYEIEFRLFKLKDGQPAWQPVQYGNAFVFSEVE-PFLTDLERSCSAAGLHVEVMHSEYGSGQVEVNLLPQWGIESVDEGFRFKLIAKETARRHDFEASFMTKRLPGQTGNGWHLNLSLWT-SGNRLTNIFHAADSSSKQLSTTGEQFLSGLLHHARALTAVSSPTVNCYRRLHTPWAPTK-CDYGVDNRMTTFRLQTQRKETSR--VESRIVSSACNPYLALAATLFAGLDGIQRDLRLDQVDTT--KDLPHSFSEALEAFKADTWFKECLGSDFVRWFDIIKTDTEVEPLAGVEVKSETESDFELEKKIY 431          
BLAST of Glutamine synthetase vs. TrEMBL
Match: R7VIP4 (Gln-synt_C domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_219831 PE=3 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 8.640e-64
Identity = 138/420 (32.86%), Postives = 218/420 (51.90%), Query Frame = 2
Query:  230 FIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNS--NVVMVFCDLYDKSTG-LPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDIN 1480
            FI+    D +GI R +M     +A  M +   +   I   G +S +   I    N    N   +PD +TL+  PW+ +    V  + CDL   +TG +P P  PR + K +++ L  +G  +    E E  LFD  + +P +    F   F Q +      + + +    A ++ ES+ +E G  Q E PL   +GIE  D +++F+   K + +  G+ A++MT P  +   NG H NHSLW   D    + F  +   + LS++ + WL GL+KH+ AL  I+ PTVNCYRR+       K  +W   +R  + RVKV        FIENR+PS+A N YLA+A  I AG+DGI+ G   PP  + +++K P +L EALE  Q DKV+ + LG+ F+ +++  K + ++  L + D++
Sbjct:   13 FIRFCWSDTHGISRARMIPRRNVAKFMQSGVGVFQGILALGADSGL--YIDLPHNNGWPNSYAMPDLKTLRPIPWVNDGVHRVGQMLCDLTLPNTGGMPMPNCPRSMAKKQVERLRTMGLELYSSFETEMTLFDLATGKPKVPDAGFTTTF-QMSKEENLLMEIDDLLKAASVDVESYQIEYGASQFEMPLAPCFGIEPADMMFVFRNGLKEICHKRGVDATFMTKPCPSNICNGGHYNHSLWTAGDRK--SAFASADDSDGLSQIFRQWLGGLIKHAPALCAIYCPTVNCYRRLNQPWAPNKA-DWGIDNRLPSFRVKVGSSP----FIENRIPSAACNPYLAIAATIAAGIDGIQTGSTCPPAMDPSAQKFPRTLQEALEFLQEDKVMTDALGEPFMQWYVPMKQELEIKRLPNTDVS 422          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A267FA05 (Gln-synt_C domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030319g2 PE=3 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 1.240e-63
Identity = 139/435 (31.95%), Postives = 223/435 (51.26%), Query Frame = 2
Query:  224 IQFIQAVVVDINGIGRGKMFSIEKLADL-MNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHES-SKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKY 1522
            +++++ +  DING  R K+ +         +       ++ ++   + V + +  S  G   N I+  D  TL+       +    V C+++   TG P P + R ICK  ++++  +G  +L   E EF LF     +P      +   F+ + +  P+   +      AG+  E  + E G GQ+E  L   +GIE+VD+ + FK ++K  A      AS+MT  L  Q  NG H+N SLW  + N   N+FH + S   +LS  G+ +L+GLL H++AL+ + SPTVNCYRR+      TK  ++   +R    R++  + E     +E+R+ SSA N YLA+A  + AG+DGI+  L L  ++ T  + LP S  EALE F+AD    E LG DFV +F   K DT++  L  V++   T + F+ EK+ Y
Sbjct:    7 VEYLRLLFPDINGCARSKILTPRAFKAFEQHGLAMFQGMLGMACQGTAVTRMLADSGCG---NAIVKADWSTLRTYTAQSGAQYGDVLCNMFVAGTGEPYPTDTRYICKQAIEQMNNIGLEVLATYEIEFRLFKLKDGQPAWQPVQYGNAFVFSEVE-PFLTDLERSCSAAGLHVEVMHSEYGSGQVEVNLLPQWGIESVDEGFRFKLIAKETARRHDFEASFMTKRLPGQTGNGWHLNLSLWT-SGNRLTNIFHAADSSSKQLSTTGEQFLSGLLHHARALTAVSSPTVNCYRRLHTPWAPTK-CDYGVDNRMTTFRLQTQRKETSR--VESRIVSSACNPYLALAATLFAGLDGIQRDLRLDQVDTT--KDLPHSFPEALEAFKADTWFKECLGADFVRWFDIIKTDTEIEPLAGVEVKSETESDFELEKKIY 431          
BLAST of Glutamine synthetase vs. TrEMBL
Match: A0A5J4NYP7 (Gln-synt_C domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002093 PE=3 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.691e-62
Identity = 154/471 (32.70%), Postives = 230/471 (48.83%), Query Frame = 2
Query:  218 QKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWI---KNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELG-KLGYRMLIGVEHEFHLF-----------------DKNSKEPFISRFCFDEHF-MQTTMAL----PYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELP-----PINNTNSE----KLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYF 1525
             +  F++  + D+NGI   K+        +++N  EI   +   G   E+   + +     + N  ++PD  T    PW    +N NV  + C++ +   G     +PR + +  L EL  K    +  G E EF +F                 DK     F S   +   F M  + AL    P+   + +Q   A ++ E F  E G  Q+E PL   YGI + D  +IFK+  + VA    +  S+MT P+ N+ A+G H NHSLW +      NV  ++  + +LS+L ++W+ GL+ H  AL+ + SPTVNCYRR      T   I+W+  DR VA+RVK    +E   +IENRL SSAS  Y  +A  + AGMDGI+  LE P      +     E    KLP++L EA+E  +ADK+LV  LG  FVD+FI++K   D+  L DVDI   +      E+ +Y 
Sbjct:   21 HRYNFVRLYLADMNGIQLSKVVPSRHADKILSNHCEIYSGVLQMGPRFEI-NLVPEILEKKHENGYLVPDISTCHPCPWACRHQNINVCGIVCEI-NWQDGTVVQGHPRTVARRLLSELAQKHNLELFSGFEPEFRVFRSEGFQEACAFPTANSSDKQDSVQFKSPKPYSNVFDMYRSGALSVYEPFLFDLDQQLKAARVDAEEFTHEHGTAQLEIPLIPQYGIRSADSYFIFKQAVREVAKGHNMRVSFMTMPILNEAASGCHFNHSLWDRKTGR--NVLFDAENDEKLSQLSRYWIGGLIAHMPALTALCSPTVNCYRRFNGNF-TPTSIDWDINDRFVALRVK--NVDENRTYIENRLCSSASCSYHVLAATVAAGMDGIERKLEPPKRGKKTVAEEGCEPDRLKLPKTLREAIESLKADKILVNRLGTQFVDWFIRTKQYGDLQTLADVDIESDSERILAYERYEYL 484          
BLAST of Glutamine synthetase vs. TrEMBL
Match: R7T6B1 (Gln-synt_C domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_171217 PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 5.623e-62
Identity = 141/433 (32.56%), Postives = 226/433 (52.19%), Query Frame = 2
Query:  173 MRKYRNCEEIKNGLSQK----IQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDIS--GTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWI--KNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQEL-GKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMAL-PYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMN-FIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSK 1438
            M    +  E + GLS++      +++    D++GI R K+   ++    M     I +  ++S  GT SEVP S  +      GN+ +IPD  T  + PW   K++ +  V C+ Y   TG     + R I +  L +L  + G +  +G E+EF L D  +++P      FD +  +      P+  ++     N G++ E +  E   GQ EFP    +G+ AVD  ++ K+  K ++   G  A++MT P+ +  ANG+H NHSLW  A N   N F +   E+++SE  +HW+ G+ KH +AL  +  PT NCYRR+        E NW   +R  + R   +K+ +K N ++ENRLP+ ++N YL VA  I AGMDG++N +E P  N+ N+ ++  SL +AL   + D+VL E LG+  V +F   K
Sbjct:    1 MASREDATERRRGLSEEELSTFDYLRFTWTDMHGISRSKVVP-KRHVQHMWEHGAIVFCGELSRFGTRSEVP-SHAEVIALEFGNMKVIPDPGTFHVVPWAGGKDARIAEVICEGYWIQTGKRHEVDTRHIARRMLDQLQSEFGLKCFMGWEYEFFLLDPKTQKPVYE--GFDIYATELIAKFEPFLCKVESMLANIGVDIEYYVSEYASGQFEFPTVPKFGLNAVDMGFLLKKGVKEMSALEGFKAAFMTQPIRDLAANGLHFNHSLWDGAGN---NAFFDCKSEDKMSETFRHWIGGIFKHFKALVALCCPTTNCYRRLYQPWAPDTE-NWGIDNRMASFR---AKNYDKQNTYLENRLPTGSANPYLVVAATIAAGMDGLRNRIEPPAQNDRNAPRVTGSLEKALVDLEQDEVLKEALGEVLVRWFTLEK 422          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:NCBI gene;Acc:103040170])

HSP 1 Score: 157.918 bits (398), Expect = 7.103e-41
Identity = 128/443 (28.89%), Postives = 208/443 (46.95%), Query Frame = 2
Query:  200 IKNGLSQK-IQFIQAVVVDINGIGRGKMFSIEKLAD--LMNNREEITYL-IDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMA----LPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIK------NGLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSK--------FDTDVN 1456
            IK  +S++ + F++    D++G+ R KM       +  +       +YL + +S  ++EV      S+   + +V+++PD  T ++ PW  +     V CD     TG+P   +PRLI K  L +L  +G+ +     +E  +    + E    +  F   F  TT+     LP+  ++     + G + ++F   +G GQ+E      +GIEA D  + F+   K +A     I +++T    N   N   ++HSLW    N   ++FH S+   ELS++GK WL GLL HS ALS + +P + C  ++    D+   +    G  D   +  VK+    E    I+NRL S+ +N Y+ +A  I AG+DGIK       GL   P N      +P  L +ALE    D V+   LG+ F+ +FI  K         DTD N
Sbjct:  277 IKQQISRENVGFVRFEATDLHGVSRSKMVPARYFHEKAVYGVPMPRSYLELTLSPKDNEVDHP---SAANFSSDVLLVPDLSTFRVLPW--SEQTARVICDPC-TVTGVPLRTSPRLIAKLMLGQLQSMGFSLHSSFTYECCIL--GAPERLGPKVVF---FPATTLLSNHDLPFLQQLVRAMYHMGADVDNFASASGPGQMEICFKPKFGIEAADSAFTFRTGIKEMARKHNYIVTFLTDETLN---NLGQLSHSLWDA--NGRKSLFHSST--GELSDIGKKWLGGLLHHSPALSCLLAPGIGCRSQLSKGRDSKHPLYATCGCNDNSCSFNVKIHGGREM--HIDNRLGSAMANPYIVLAATIAAGLDGIKRNLSIEQGLNRAP-NQQKQVVIPVKLEDALEALAEDAVIRGSLGEPFIQYFIAMKRLEIETQELDTDRN 698          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:NCBI gene;Acc:103040170])

HSP 1 Score: 157.147 bits (396), Expect = 8.364e-41
Identity = 128/443 (28.89%), Postives = 208/443 (46.95%), Query Frame = 2
Query:  200 IKNGLSQK-IQFIQAVVVDINGIGRGKMFSIEKLAD--LMNNREEITYL-IDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTM----ALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYG--DRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIK------NGLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSK--------FDTDVN 1456
            IK  +S++ + F++    D++G+ R KM       +  +       +YL + +S  ++EV      S+   + +V+++PD  T ++ PW  +     V CD     TG+P   +PRLI K  L +L  +G+ +     +E  +    + E    +  F   F  TT+     LP+  ++     + G + ++F   +G GQ+E      +GIEA D  + F+   K +A     I +++T    N   N   ++HSLW    N   ++FH S+   ELS++GK WL GLL HS ALS + +P + C  ++    D+   +    G  D   +  VK+    E    I+NRL S+ +N Y+ +A  I AG+DGIK       GL   P N      +P  L +ALE    D V+   LG+ F+ +FI  K         DTD N
Sbjct:  243 IKQQISRENVGFVRFEATDLHGVSRSKMVPARYFHEKAVYGVPMPRSYLELTLSPKDNEVDHP---SAANFSSDVLLVPDLSTFRVLPW--SEQTARVICDPC-TVTGVPLRTSPRLIAKLMLGQLQSMGFSLHSSFTYECCIL--GAPERLGPKVVF---FPATTLLSNHDLPFLQQLVRAMYHMGADVDNFASASGPGQMEICFKPKFGIEAADSAFTFRTGIKEMARKHNYIVTFLTDETLN---NLGQLSHSLWDA--NGRKSLFHSST--GELSDIGKKWLGGLLHHSPALSCLLAPGIGCRSQLSKGRDSKHPLYATCGCNDNSCSFNVKIHGGREM--HIDNRLGSAMANPYIVLAATIAAGLDGIKRNLSIEQGLNRAP-NQQKQVVIPVKLEDALEALAEDAVIRGSLGEPFIQYFIAMKRLEIETQELDTDRN 664          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: glula (glutamine synthetase [Source:NCBI gene;Acc:103046209])

HSP 1 Score: 63.929 bits (154), Expect = 1.396e-10
Identity = 79/364 (21.70%), Postives = 145/364 (39.84%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTT--KEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + I+G G G       L     + E++  +  D S T           S G+N ++ +IP    +   P+ K+ N  +V C++  K    P   N R+ C+  +Q +         G+E E+ +   +              + P+      D+ + +  +   Y        L AG++    N E    Q EF +    GIE  D +W+ + +   V  D G++ S+   P+  N    G H N S     ++  L    ES     +  LGK       +HS  +   + P   ++  RR+    +T+   E +    +R  ++R+  +  +EK  + E+R PS+  + Y     +I
Sbjct:   26 VQAMYIWIDGTGEGLRCKTRTLDSEPKSIEDLPEWNFDGSST---------YQSEGSNSDMYLIPS--AMFRDPFRKDPNK-LVLCEVL-KYNRKPAETNHRVTCQKIMQMVEDQS--PWFGMEQEYTILGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY-----RACLYAGVQICGTNAEVMPAQWEFQVGPCEGIEMGDHLWVARFILHRVCEDFGVVVSFDPKPIPGNWNGAGCHTNFSTKAMREDGGLKYIEES-----IERLGK-------RHSYHIRA-YDPKGGLDNARRLTGHHETSNIHEFSAGVANRGASIRIPRAVGQEKKGYFEDRRPSANCDPYAVTQALI 356          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: glulb (glutamine synthetase [Source:NCBI gene;Acc:103044444])

HSP 1 Score: 55.0694 bits (131), Expect = 9.917e-8
Identity = 77/361 (21.33%), Postives = 141/361 (39.06%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLIC-------KNKLQELGKLGYRMLIGVE-HEFHLFDKNSKEPFISRFC---FDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLA-NQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTT--KEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + I+G G G       L        E   + D+   N +   S    S G+N ++ +IP  + +   P+ K+ N  ++ C++  K    P   N R +C       +N+    G      ++G++ H F         P    +C    D+ + +  +   Y        L AG++    N E    Q EF +    GI   D +W+ + +   V  D G++ S+   P++ N    G H N S  +  +   L    E+             +  L K  Q     + P   ++  RR+    +T+   E +    +R  ++R+  S  +EK  + E+R PS+  + Y     +I
Sbjct:   26 VQAMYIWIDGTGEGLRCKTRTLD------AEPKTIEDLPEWNFD--GSSTYQSEGSNSDMYLIP--KAIFRDPFRKDPNK-LILCEVL-KYNRKPAETNLRQMCAKIMDKVENQHPWFGMEQEYTILGIDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY-----RACLYAGVDICGTNAEVMPAQWEFQVGPCEGIRMGDHLWMARFILHRVCEDFGVVVSFDPKPISGNWNGAGCHTNFSTKEMREEGGLKQIEEA-------------IEKLSKRHQYHIRAYDPKGGLDNARRLTGRHETSNINEFSAGVANRGASIRIPRSVGQEKRGYFEDRRPSANCDPYAVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Match: glulb (glutamine synthetase [Source:NCBI gene;Acc:103044444])

HSP 1 Score: 55.0694 bits (131), Expect = 1.089e-7
Identity = 77/361 (21.33%), Postives = 141/361 (39.06%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLIC-------KNKLQELGKLGYRMLIGVE-HEFHLFDKNSKEPFISRFC---FDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLA-NQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTT--KEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + I+G G G       L        E   + D+   N +   S    S G+N ++ +IP  + +   P+ K+ N  ++ C++  K    P   N R +C       +N+    G      ++G++ H F         P    +C    D+ + +  +   Y        L AG++    N E    Q EF +    GI   D +W+ + +   V  D G++ S+   P++ N    G H N S  +  +   L    E+             +  L K  Q     + P   ++  RR+    +T+   E +    +R  ++R+  S  +EK  + E+R PS+  + Y     +I
Sbjct:   42 VQAMYIWIDGTGEGLRCKTRTLD------AEPKTIEDLPEWNFD--GSSTYQSEGSNSDMYLIP--KAIFRDPFRKDPNK-LILCEVL-KYNRKPAETNLRQMCAKIMDKVENQHPWFGMEQEYTILGIDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY-----RACLYAGVDICGTNAEVMPAQWEFQVGPCEGIRMGDHLWMARFILHRVCEDFGVVVSFDPKPISGNWNGAGCHTNFSTKEMREEGGLKQIEEA-------------IEKLSKRHQYHIRAYDPKGGLDNARRLTGRHETSNINEFSAGVANRGASIRIPRSVGQEKRGYFEDRRPSANCDPYAVTEALI 372          
BLAST of Glutamine synthetase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008530.1 (pep scaffold:Pmarinus_7.0:GL476642:753214:761317:-1 gene:ENSPMAG00000007702.1 transcript:ENSPMAT00000008530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.8398 bits (133), Expect = 9.568e-9
Identity = 76/361 (21.05%), Postives = 144/361 (39.89%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQEL-------GKLGYRMLIGVE-HEFHLFDKNSKEPFISRFC---FDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTTK--EINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + ++G G G       L        E   + D+   N +   S    + G+N ++ +IP     + P   +N    +V C++  K    P   N R  CK  ++ +       G      ++GV+ H F         P    +C    D+ + +  +   Y        L AG++    N E    Q EF +    GI+  D +W+ + +   V  D G++A++   P+  N    G H N S     ++  L    E+     + +LGK       +HS  +   + P   ++  RR+  + +T+   E +    +R  ++R+     ++   ++E+R PS+  N Y     +I
Sbjct:   26 VQAMYIWLDGTGEGLRCKTRTLD------AEPKTVADLPEWNFD--GSSTYQAEGSNSDMYLIP-VAMFRDP--FRNDPNKLVLCEVL-KYNRQPAETNLRGTCKMVMERIRAQVPWFGMEQEYTILGVDGHPFGWPSNGFPGPQGPYYCGVGSDKAYGRDIVEAHY-----RACLYAGVKICGTNAEVMPSQWEFQVGPCEGIDMGDHLWVARFILHRVCEDFGVVATFDPKPIPGNWNGAGCHTNFSTLPMREDGGLQHIEEA-----IEKLGK-------RHSYHIRA-YDPRGGLDNARRLTGSHETSSIHEFSAGVANRGASIRIPRQVGQDGCGYMEDRRPSANCNPYAVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Nematostella
Match: EDO25869 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDH3])

HSP 1 Score: 95.1301 bits (235), Expect = 8.516e-22
Identity = 76/303 (25.08%), Postives = 135/303 (44.55%), Query Frame = 2
Query:  398 TNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPR-PFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQA------LNAGIEFESFNLEAGL-----GQIEFPLNAYY-GIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
             + +    P   +L + PW +++    +   ++  + GLP  P +PR +    +  L   GY  ++ VE EF+L DKN       +     + ++      Y +   EQ       L +  E +   +   +     GQ+E  L   +  ++AVD+   +K L K VAN  G+ A +M  P  +Q  +GMH++ SL  +  N+ +     +S++   + L KH + G++        IF P  N YRR +A        +W   +R V+ RV       K   +E+R+  + +N YLA A ++
Sbjct:    3 ADADCWTYPIPGSLTLQPW-RSTPTGQLQVSMH-PTQGLPAAPADPRHVLVRAIDRLKADGYHPVMAVELEFYLLDKNRDANGRPQPALQANGVRPQAPQVYGVYELEQLQPFLDDLYSACEVQGLPVRTAISEYAPGQVELTLEHRFDALQAVDEGVRYKRLVKGVANKHGMQACFMAKPFGDQAGSGMHMHVSLADEHGNNLM-----ASEDPHGTPLLKHAIGGMMATLNDALAIFCPNANSYRRFQANSYAPLAKSWGVNNRTVSFRVP--GGPAKSRHVEHRICGADANPYLAAAAIL 296          
BLAST of Glutamine synthetase vs. Ensembl Medaka
Match: lgsn (lengsin, lens protein with glutamine synthetase domain [Source:NCBI gene;Acc:101162898])

HSP 1 Score: 158.688 bits (400), Expect = 1.866e-41
Identity = 124/442 (28.05%), Postives = 208/442 (47.06%), Query Frame = 2
Query:  194 EEIKNGLSQK-IQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEV---PKS--IVQSSNGT-NGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSK-EPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEI---NWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLEL-PPINNTNSEK----LPESLSEALEIFQADKVLVEGLGKDFVDFFIK-SKFDTDVNILKD 1468
            E+IK  ++++ I F++    D++G+ R K   +          E+  Y + +  +  E+   PKS  +  +S    + +V++IPD  T K+ PW + +    V CD     TG P   +PRLI K  L +L  LG+ +     +E  +     +  P      F    + +   LP+  ++ +     G + +S    +G GQ+E  L   +GI A D  + F+   K +A  L  IAS+ T    +   N   ++HSLW    N   ++FH   K  ELSE+G+ WLAGLL HS ALS + SP + C   +   +   K +        D   +  +K     E    ++N+L S+ +N Y+ +A  + AG+DGI+  L +   +    S++    +P  + +ALE  + D V+   LG+ FV +FI   KF+ +   L D
Sbjct:  203 EQIKQQIARENINFVRFEATDLHGVSRSKTVPVRHF------HEKAVYGVPMPRSYLELTLSPKSNEVDHASTANFSSDVLLIPDLSTFKLLPWAEQT--ARVICDPC-TVTGSPLWTSPRLIAKQLLGQLQSLGFSLHSSFTYECCVLGAPERIGP--KTLLFPATTLLSNHDLPFFQQLVDSMYCMGADIDSIASASGPGQMEINLRPEFGISAADSAFTFRTGIKEMARKLSYIASFFTD---DGLYNAGVLSHSLWDA--NGRRSLFHGGEKPGELSEIGRKWLAGLLTHSAALSCLMSPGLGCRNHMAKTIKDPKRLLYATCGCNDNSSSFNIKSHGGRE--THVDNKLGSAMANPYIVLAATVAAGLDGIRRNLTVESSLTKAPSQQKDFSIPIKMDDALEALEEDHVIRSALGEPFVQYFIAMKKFEIETQELDD 626          
BLAST of Glutamine synthetase vs. Ensembl Medaka
Match: glula (glutamate-ammonia ligase [Source:NCBI gene;Acc:101159856])

HSP 1 Score: 57.7658 bits (138), Expect = 1.346e-8
Identity = 76/364 (20.88%), Postives = 144/364 (39.56%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTT--KEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + I+G G G       L     + E++  +  D S T           + G+N ++ ++P    +   P+ K+ N  +V C++  K    P   N R+ CK  +  +         G+E E+ +   +              + P+      D+ + +  +   Y        L AG+     N E    Q EF +    GI+  D +W+ + +   V  D G++AS+   P+  N    G H N S  +  +   L        E+ + +LGK       +H   +   + P   ++  RR+    +T+   E +    +R  ++R+  S  +EK  + E+R PS+  + Y     +I
Sbjct:   26 VQAMYIWIDGTGEGLRCKTRTLDSEPKSIEDLPEWNFDGSST---------YQAEGSNSDMYLLP--AAMFRDPFRKDPNK-LVLCEVL-KYNRKPAESNLRITCKKVMDMV--TDQHPWFGMEQEYTILGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY-----RACLYAGVNICGTNAEVMPAQWEFQVGPCEGIDMGDHLWVARFILHRVCEDFGVVASFDPKPIPGNWNGAGCHTNVSTKEMREEGGLKAI-----EDAIEKLGK-------RHRYHIRA-YDPKGGLDNARRLTGHHETSNIHEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYGVTEALI 356          
BLAST of Glutamine synthetase vs. Ensembl Medaka
Match: glula (glutamate-ammonia ligase [Source:NCBI gene;Acc:101159856])

HSP 1 Score: 57.7658 bits (138), Expect = 1.346e-8
Identity = 76/364 (20.88%), Postives = 144/364 (39.56%), Query Frame = 2
Query:  233 IQAVVVDINGIGRGKMFSIEKLADLMNNREEIT-YLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNS-------------KEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPL-ANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPT--VNCYRRIRAAVDTT--KEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMI 1267
            +QA+ + I+G G G       L     + E++  +  D S T           + G+N ++ ++P    +   P+ K+ N  +V C++  K    P   N R+ CK  +  +         G+E E+ +   +              + P+      D+ + +  +   Y        L AG+     N E    Q EF +    GI+  D +W+ + +   V  D G++AS+   P+  N    G H N S  +  +   L        E+ + +LGK       +H   +   + P   ++  RR+    +T+   E +    +R  ++R+  S  +EK  + E+R PS+  + Y     +I
Sbjct:   26 VQAMYIWIDGTGEGLRCKTRTLDSEPKSIEDLPEWNFDGSST---------YQAEGSNSDMYLLP--AAMFRDPFRKDPNK-LVLCEVL-KYNRKPAESNLRITCKKVMDMV--TDQHPWFGMEQEYTILGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY-----RACLYAGVNICGTNAEVMPAQWEFQVGPCEGIDMGDHLWVARFILHRVCEDFGVVASFDPKPIPGNWNGAGCHTNVSTKEMREEGGLKAI-----EDAIEKLGK-------RHRYHIRA-YDPKGGLDNARRLTGHHETSNIHEFSAGVANRGASIRIPRSVGQEKKGYFEDRRPSANCDPYGVTEALI 356          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003832.1 (SMESG000003832.1)

HSP 1 Score: 936.791 bits (2420), Expect = 0.000e+0
Identity = 453/453 (100.00%), Postives = 453/453 (100.00%), Query Frame = 2
Query:  173 MRKYRNCEEIKNGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            MRKYRNCEEIKNGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL
Sbjct:    1 MRKYRNCEEIKNGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 453          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003836.1 (SMESG000003836.1)

HSP 1 Score: 489.189 bits (1258), Expect = 4.442e-170
Identity = 229/445 (51.46%), Postives = 317/445 (71.24%), Query Frame = 2
Query:  200 IKNGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELP-PINNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            ++  LS+ ++FIQA+ VDINGI RGK++ +EKL+DL+  ++E+  L++I GT SE+P++I + +     N +++PD+ +++  PW  +S++ M F D YD+   +P PFNPRL  + +L EL K+G++  IGVE+EF LFDK++++PF    CFD  F Q+T ALPY   + +      IE +S++LE GLGQIE PL  Y G+E VD  W FKELSKYVAND G+IASYM  PLA    NG+HINHSLW + + SF N     S ++E+SE+ +HWLAGLLKHS+AL   F+PTVNCYRRI  A     +I+WNY DR VA RVK S ++EK+N+IENRLPSSA NIYLA+AGMIVAG+DGIKN ++LP P N  + E LP SL EAL+    D+VL+ G+G+ F+D+FIK+K +TDV +L++VD+   T    Q+E +KYF+L
Sbjct:    6 VQISLSKNVEFIQAITVDINGIARGKVYPVEKLSDLLEGKQEVVGLLEILGTKSEIPQTISELTRNHFENELLVPDQTSIRGCPWSDDSSLAMFFYDTYDRVKNVPWPFNPRLAARKQLNELEKMGFKFFIGVENEFRLFDKHTRKPFTQEICFDHQFTQSTTALPYMKGLCKILKRMNIEMDSWHLEYGLGQIEVPLKVYSGMEGVDNAWFFKELSKYVANDFGMIASYMCVPLARDAGNGLHINHSLWIKTNESFTNAMWAKSDKDEMSEIAQHWLAGLLKHSKALCAFFNPTVNCYRRILMANWAPNKISWNYRDRTVAFRVKASSNQEKVNYIENRLPSSACNIYLAIAGMIVAGIDGIKNKIKLPDPANIFHGEDLPRSLPEALDELSKDQVLINGMGEKFIDWFIKAKLETDVFVLRNVDLESQTEEALQQEFDKYFNL 450          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003831.1 (SMESG000003831.1)

HSP 1 Score: 475.707 bits (1223), Expect = 9.200e-165
Identity = 231/441 (52.38%), Postives = 313/441 (70.98%), Query Frame = 2
Query:  212 LSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNT-NSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            L  +++FIQ + VDI+G  RGKMF  EKL DL  N+EE+  L+++ GT  E+P+S+ + S     N+++ P++ +L++ PW K+S++ MVF D YDK T  P PFNPRL+ KNK++EL  +G +++IGVE+EF LF K S++P          F Q T+ LP+A  +++ A +  IEF+S+NLE G GQIE PL AY GI  VDKVW+F+E SKYVA+ L L A+YMT P++ + ANGMHINHSLW   D    N+F +S  EN LS++GKHWLAG+LKH++ALS  FSPTVNCYRR+ AA      I+WNY DR VAMRVK S   EK N+IENRLPSSA NIY+A+A MIVAG+DGIKN L+L    N  + EKLP++L+E+LE+ + DKVL EGLG  FVD+++K K +T+V++ K V+I+D+     + E  KYFHL
Sbjct:    7 LPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLT--ELEFHKYFHL 445          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003831.1 (SMESG000003831.1)

HSP 1 Score: 475.322 bits (1222), Expect = 1.465e-164
Identity = 231/441 (52.38%), Postives = 313/441 (70.98%), Query Frame = 2
Query:  212 LSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPINNT-NSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            L  +++FIQ + VDI+G  RGKMF  EKL DL  N+EE+  L+++ GT  E+P+S+ + S     N+++ P++ +L++ PW K+S++ MVF D YDK T  P PFNPRL+ KNK++EL  +G +++IGVE+EF LF K S++P          F Q T+ LP+A  +++ A +  IEF+S+NLE G GQIE PL AY GI  VDKVW+F+E SKYVA+ L L A+YMT P++ + ANGMHINHSLW   D    N+F +S  EN LS++GKHWLAG+LKH++ALS  FSPTVNCYRR+ AA      I+WNY DR VAMRVK S   EK N+IENRLPSSA NIY+A+A MIVAG+DGIKN L+L    N  + EKLP++L+E+LE+ + DKVL EGLG  FVD+++K K +T+V++ K V+I+D+     + E  KYFHL
Sbjct:   18 LPDEVEFIQTITVDIHGFSRGKMFPREKLNDLFQNKEEVVGLLEVLGTRFEIPESLTELSENHYRNILITPEKSSLRVAPWSKDSSLAMVFYDAYDKITNSPWPFNPRLLAKNKIKELEVMGMKLMIGVENEFRLFGKGSRKPLTDSVQLLSQFHQATVVLPFARELKKVAKDFDIEFDSWNLEYGSGQIEIPLRAYEGINGVDKVWMFRETSKYVADRLNLHATYMTLPISKETANGMHINHSLWSVKDKGLSNLFWDSKNENSLSDVGKHWLAGILKHTRALSAFFSPTVNCYRRVAAADWAPNNISWNYDDRSVAMRVKTSTANEKQNYIENRLPSSACNIYIAIASMIVAGIDGIKNKLDLFEAGNGFHCEKLPKTLAESLEVLKQDKVLTEGLGPKFVDWYVKVKQETEVDLFKSVNIHDVGLT--ELEFHKYFHL 456          
BLAST of Glutamine synthetase vs. Planmine SMEST
Match: SMESG000003829.1 (SMESG000003829.1)

HSP 1 Score: 446.432 bits (1147), Expect = 3.227e-153
Identity = 219/438 (50.00%), Postives = 305/438 (69.63%), Query Frame = 2
Query:  221 KIQFIQAVVVDINGIGRGKMFSIEKLADLMNNREEITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNVVMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFDKNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGLGQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPANGMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVIFSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRLPSSASNIYLAVAGMIVAGMDGIKNGLELPPI-NNTNSEKLPESLSEALEIFQADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKYFHL 1531
            ++QFIQ + +DINGI RGK+F I KL+DL+  +EEI  +I + GTNSE+  SI + S+  N  +++  D+ T+++ PW ++ ++ MVF D+YD+    P P NPRL+ K K+ EL  +  +++IG+E+EF +F+K  K+   +       F Q T +  Y   + +      I  +S+N E G GQIE PL +  GIE +DK W+FKE+SKYVA+ +GL+ASYMT P+  +  NG HINHSLW +++    N   E  K +ELSE+GK+WLAG+LKHS+ LS I+SPTVNCYRRI++A+    +I+WNY DR VAMRVK S+D EKMN+IENR+PSSA NIYLAVAGMIVAG+DGIKN L+LP   N ++ E+LP +LSEAL   + DKVLVEGLG  FVD+++K K +TDV +LKD D+++ T  G  +E  KYF +
Sbjct:   13 EVQFIQVIHIDINGISRGKVFPIGKLSDLLRKKEEIICIIGMIGTNSEIISSIKEISHYENARLVL--DKSTIRVAPWSQDCSLAMVFADVYDRVGNSPLPINPRLLAKCKINELEAMDLKLVIGIENEFRIFNKTDKKFVQNSMKHYSQFHQITESYSYIKELNKDLKKCDILIDSWNFECGSGQIEIPLLSSEGIEGLDKTWMFKEISKYVADKMGLVASYMTVPIPAESGNGCHINHSLWTKSEKGPTNAMWEPEKVDELSEIGKYWLAGILKHSRGLSAIYSPTVNCYRRIQSALFAPDKISWNYRDRSVAMRVKTSQDYEKMNYIENRIPSSACNIYLAVAGMIVAGIDGIKNKLQLPEHGNGSHCERLPTTLSEALSALKDDKVLVEGLGAKFVDWYVKVKEETDVKVLKDSDLHNNTEEGISQEFIKYFDI 448          
The following BLAST results are available for this feature:
BLAST of Glutamine synthetase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LGSN5.481e-3826.82lengsin, lens protein with glutamine synthetase do... [more]
GLUL8.224e-820.88glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL8.224e-820.88glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL8.224e-820.88glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
GLUL8.224e-820.88glutamate-ammonia ligase [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gln-52.990e-1224.49GLutamiNe synthetase (Glutamate-ammonia ligase) [... [more]
gln-61.204e-1024.04GLutamiNe synthetase (Glutamate-ammonia ligase) [... [more]
gln-61.204e-1024.04GLutamiNe synthetase (Glutamate-ammonia ligase) [... [more]
gln-31.245e-1024.11Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
gln-31.416e-1024.11Glutamine synthetase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gs12.565e-1121.79gene:FBgn0001142 transcript:FBtr0078115[more]
Gs12.565e-1121.79gene:FBgn0001142 transcript:FBtr0078114[more]
Gs12.565e-1121.79gene:FBgn0001142 transcript:FBtr0300568[more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgsn8.510e-3928.60lengsin, lens protein with glutamine synthetase do... [more]
glulb2.667e-1022.53glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glulb3.203e-1023.20glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glulb3.203e-1023.20glutamate-ammonia ligase (glutamine synthase) b [S... [more]
glulb3.203e-1023.20glutamate-ammonia ligase (glutamine synthase) b [S... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pkn21.050e-3727.21protein kinase N2 [Source:Xenbase;Acc:XB-GENE-9952... [more]
avpr1b3.292e-3727.21arginine vasopressin receptor 1B [Source:Xenbase;A... [more]
c8a2.439e-721.31complement component 8, alpha polypeptide [Source:... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Lgsn1.991e-3728.30lengsin, lens protein with glutamine synthetase do... [more]
Glul1.230e-721.15glutamate-ammonia ligase (glutamine synthetase) [S... [more]
Glul1.230e-721.15glutamate-ammonia ligase (glutamine synthetase) [S... [more]
back to top
BLAST of Glutamine synthetase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q05907|GLN1A_PYRFU3.334e-5031.17Glutamine synthetase OS=Pyrococcus furiosus (strai... [more]
sp|Q9UY99|GLN1A_PYRAB2.469e-4929.34Glutamine synthetase OS=Pyrococcus abyssi (strain ... [more]
sp|O58097|GLN1A_PYRHO3.377e-4829.57Glutamine synthetase OS=Pyrococcus horikoshii (str... [more]
sp|P36687|GLN1A_PYRWO2.685e-4731.17Glutamine synthetase OS=Pyrococcus woesei OX=2262 ... [more]
sp|O08467|GLN1A_THEKO2.393e-4229.30Glutamine synthetase OS=Thermococcus kodakarensis ... [more]
back to top
BLAST of Glutamine synthetase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8HS621.478e-6432.41Gln-synt_C domain-containing protein OS=Macrostomu... [more]
R7VIP48.640e-6432.86Gln-synt_C domain-containing protein OS=Capitella ... [more]
A0A267FA051.240e-6331.95Gln-synt_C domain-containing protein OS=Macrostomu... [more]
A0A5J4NYP72.691e-6232.70Gln-synt_C domain-containing protein OS=Paragonimu... [more]
R7T6B15.623e-6232.56Gln-synt_C domain-containing protein OS=Capitella ... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgsn7.103e-4128.89lengsin, lens protein with glutamine synthetase do... [more]
lgsn8.364e-4128.89lengsin, lens protein with glutamine synthetase do... [more]
glula1.396e-1021.70glutamine synthetase [Source:NCBI gene;Acc:1030462... [more]
glulb9.917e-821.33glutamine synthetase [Source:NCBI gene;Acc:1030444... [more]
glulb1.089e-721.33glutamine synthetase [Source:NCBI gene;Acc:1030444... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008530.19.568e-921.05pep scaffold:Pmarinus_7.0:GL476642:753214:761317:-... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamine synthetase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO258698.516e-2225.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamine synthetase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lgsn1.866e-4128.05lengsin, lens protein with glutamine synthetase do... [more]
glula1.346e-820.88glutamate-ammonia ligase [Source:NCBI gene;Acc:101... [more]
glula1.346e-820.88glutamate-ammonia ligase [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Glutamine synthetase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003832.10.000e+0100.00SMESG000003832.1[more]
SMESG000003836.14.442e-17051.46SMESG000003836.1[more]
SMESG000003831.19.200e-16552.38SMESG000003831.1[more]
SMESG000003831.11.465e-16452.38SMESG000003831.1[more]
SMESG000003829.13.227e-15350.00SMESG000003829.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026405 ID=SMED30026405|Name=Glutamine synthetase|organism=Schmidtea mediterranea sexual|type=transcript|length=1628bp
GCTGTCAGTGGCTTGCTGTGGATTTTGTTTTATCCAGTAGGATTTATTAT
TTTCAACATATCATTTATTTCATTCTCCTTGTCCCATCTGACACTGTTTA
ACTACGTTTGTCCGTACGTGATGATGTGCAAACTCTGTTTAAAAAGAAAT
ACAGGCTAGGGAGAATTCAGTTATGAGAAAGTATAGAAATTGTGAGGAAA
TAAAGAATGGATTATCTCAGAAAATTCAGTTCATTCAGGCAGTTGTTGTT
GATATCAATGGAATTGGAAGAGGTAAAATGTTTTCAATAGAGAAGTTGGC
CGACCTCATGAACAACAGGGAAGAAATAACCTATCTTATAGATATATCAG
GGACAAATAGCGAGGTTCCGAAATCAATTGTCCAAAGTTCAAATGGAACA
AATGGAAATGTTATCATGATACCGGATGAGGAAACTTTGAAAATTCCTCC
CTGGATTAAAAACTCTAATGTTGTCATGGTTTTCTGTGACTTATATGACA
AATCGACAGGCTTACCAAGACCATTTAATCCTAGACTGATTTGCAAAAAC
AAATTACAAGAACTGGGAAAACTGGGATATCGGATGTTGATTGGTGTGGA
GCATGAATTTCACTTATTCGATAAAAATAGTAAAGAACCATTTATATCGA
GATTTTGTTTTGATGAACATTTTATGCAAACAACAATGGCGTTGCCCTAT
GCCATTCGGATGAGGGAGCAGGCATTGAACGCAGGAATTGAATTCGAAAG
TTTCAATCTGGAGGCCGGATTGGGTCAGATTGAATTTCCGCTTAATGCTT
ATTATGGAATCGAAGCGGTGGATAAAGTCTGGATATTCAAAGAGCTATCG
AAATATGTTGCAAATGATCTAGGGTTGATCGCTAGCTACATGACTGCTCC
ATTGGCTAATCAACCAGCCAATGGGATGCACATAAATCATTCACTATGGA
AACAAGCTGACAATTCGTTTTTAAATGTCTTTCATGAATCATCAAAAGAA
AATGAATTATCTGAATTAGGAAAACATTGGCTAGCCGGACTGTTAAAGCA
TTCGCAAGCTTTGAGTGTGATTTTCAGCCCAACTGTCAACTGTTACCGAC
GTATTAGGGCCGCTGTGGATACTACAAAGGAAATCAACTGGAATTATGGT
GACAGGAAAGTTGCAATGCGCGTGAAAGTATCAAAAGATGAGGAAAAGAT
GAATTTCATAGAAAACCGCTTACCAAGCTCTGCTAGCAATATCTACTTAG
CTGTTGCGGGAATGATTGTAGCGGGAATGGATGGAATAAAAAATGGATTG
GAACTACCACCTATTAATAACACAAATTCTGAAAAATTACCTGAAAGTCT
TTCAGAAGCATTAGAAATATTCCAAGCTGACAAAGTATTGGTTGAAGGAC
TTGGAAAAGACTTTGTTGATTTCTTTATTAAGTCAAAATTTGATACAGAC
GTCAATATTCTCAAGGATGTTGATATTAATGATATTACTCCGAACGGGTT
TCAAAAAGAAAAGGAAAAGTATTTTCACTTGTAGATGAGCTCAGTTAAGA
TTCACCCTGGTTCTCATTCATCCAAGTAGTTTAGATAGCAATTCACTGAC
TGTGATCAAACATTTGTAAAATTGGGAC
back to top

protein sequence of SMED30026405-orf-1

>SMED30026405-orf-1 ID=SMED30026405-orf-1|Name=SMED30026405-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=454bp
MRKYRNCEEIKNGLSQKIQFIQAVVVDINGIGRGKMFSIEKLADLMNNRE
EITYLIDISGTNSEVPKSIVQSSNGTNGNVIMIPDEETLKIPPWIKNSNV
VMVFCDLYDKSTGLPRPFNPRLICKNKLQELGKLGYRMLIGVEHEFHLFD
KNSKEPFISRFCFDEHFMQTTMALPYAIRMREQALNAGIEFESFNLEAGL
GQIEFPLNAYYGIEAVDKVWIFKELSKYVANDLGLIASYMTAPLANQPAN
GMHINHSLWKQADNSFLNVFHESSKENELSELGKHWLAGLLKHSQALSVI
FSPTVNCYRRIRAAVDTTKEINWNYGDRKVAMRVKVSKDEEKMNFIENRL
PSSASNIYLAVAGMIVAGMDGIKNGLELPPINNTNSEKLPESLSEALEIF
QADKVLVEGLGKDFVDFFIKSKFDTDVNILKDVDINDITPNGFQKEKEKY
FHL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036651Gln_synt_N
IPR008146Gln_synth_cat_dom
IPR008147Gln_synt_b-grasp
IPR014746Gln_synth/guanido_kin_cat_dom
Vocabulary: molecular function
TermDefinition
GO:0004356glutamate-ammonia ligase activity
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0006807nitrogen compound metabolic process
GO:0006542glutamine biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008146Glutamine synthetase, catalytic domainSMARTSM01230Gln_synt_C_2coord: 117..368
e-value: 2.5E-53
score: 193.2
IPR008146Glutamine synthetase, catalytic domainPFAMPF00120Gln-synt_Ccoord: 119..423
e-value: 2.0E-67
score: 227.6
NoneNo IPR availableGENE3DG3DSA:3.30.590.10coord: 117..439
e-value: 3.9E-79
score: 267.8
NoneNo IPR availablePANTHERPTHR43407:SF1LENGSINcoord: 6..431
NoneNo IPR availablePANTHERPTHR43407FAMILY NOT NAMEDcoord: 6..431
IPR036651Glutamine synthetase, N-terminal domain superfamilyGENE3DG3DSA:3.10.20.70coord: 6..116
e-value: 1.4E-7
score: 33.2
IPR036651Glutamine synthetase, N-terminal domain superfamilySUPERFAMILYSSF54368Glutamine synthetase, N-terminal domaincoord: 16..112
IPR014746Glutamine synthetase/guanido kinase, catalytic domainSUPERFAMILYSSF55931Glutamine synthetase/guanido kinasecoord: 117..423