Tyrosine-protein kinase

Overview
NameTyrosine-protein kinase
Smed IDSMED30026402
Length (bp)2044
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein kinase (SMED30026402) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30026402) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase (SMED30026402) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30026402) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026402

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30026402h1SMcG0014112 dd_Smed_v4_3147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026402h1SMcG0014112 dd_Smed_v4_3147_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026402h1SMcG0014112 dd_Smed_v4_3147_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SRC (SRC proto-oncogene, non-receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11283])

HSP 1 Score: 431.409 bits (1108), Expect = 9.685e-144
Identity = 221/455 (48.57%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   88 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 530          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SRC (SRC proto-oncogene, non-receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11283])

HSP 1 Score: 431.409 bits (1108), Expect = 9.685e-144
Identity = 221/455 (48.57%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   88 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 530          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SRC (SRC proto-oncogene, non-receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11283])

HSP 1 Score: 431.409 bits (1108), Expect = 9.685e-144
Identity = 221/455 (48.57%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   88 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 530          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SRC (SRC proto-oncogene, non-receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11283])

HSP 1 Score: 426.402 bits (1095), Expect = 1.032e-141
Identity = 223/461 (48.37%), Postives = 302/461 (65.51%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISS-----DMSEA-WWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I +     D+ E  WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   88 TFVALYDYESRTETDLSFKKGERLQIVNNTRKVDVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 536          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: HCK (HCK proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:4840])

HSP 1 Score: 422.165 bits (1084), Expect = 1.117e-140
Identity = 215/450 (47.78%), Postives = 296/450 (65.78%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSC-PQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDD-VYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            V AL+ YEA H +DL F KGD M +  +  E WW A    T+K GYIPSNYV   D   +    +  I+ K+A+++LL  GN +G+++IR    +K  Y+LSVR +D  +    VKHYKIRTLDN  GFYIS RS F  +  L+ +Y+   DGLC KL++ C   + + P +    E+ R+ ++LE+ LG G FGEV++  +N   +VAVK +KP SM    F+AEA +M  L H ++V++  V T+   +P++IITE MA G+LL++L+S EG K  L +++D  +QIAEGMA++E RN++HRDLRAANILV   L  K+ADFGLARV +D  Y A  G KFPIKWTAPEA     F++KSDVWSFG+L+ EIVTYGR PYPG+ N +V+  + +GYR+P P      CP+ELY I ++CW   PE RPTF ++Q + + +    ESQY
Sbjct:   62 VVALYDYEAIHHEDLSFQKGDQMVVLEESGE-WWKARSLATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGD-TVKHYKIRTLDNG-GFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVPCMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANVMKTLQHDKLVKLHAVVTK---EPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPEN----CPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQY 501          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 402.905 bits (1034), Expect = 7.118e-134
Identity = 206/467 (44.11%), Postives = 300/467 (64.24%), Query Frame = 2
Query:  281 NQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPC-SDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRH--KPPIQF---KDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLS----VKVADFGLAR--VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELY-AIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
             +R T+ AL+ Y++R   DL F KGD MY+    +  WW   H  T +TGY+P N+V       S  E WY   I    A++ +L    P GT++IR   +D++ +AL++R  D  +N   VKHYKI+ LD++ G++I+ R  F ++  L++YY    DGLCC+LT   P+    +P +     ++ E+ R+ + L+R LG+G+FGEV+ GKW   VEVA+K +KP +M    F+ EA++M + +HP +V++  VCT+  E+P +IITE M NG+LL YLR+ +G  L +  ++DM +QIA GM YLE R  VHRDL A N+LV + +S    VKVADFGLAR  + +D+Y A TG KFPIKWTAPEA     F+VKSDVWS+G+L+YEI+T G+ PYPG+ NR+V+++V  GYR+P P G    CP+++Y  + LKCWD  P+ RPTF  L   F+ + ++ +  Y
Sbjct:   15 QERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIES--EEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTR--EEPFYIITEYMINGSLLQYLRT-DGSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRG----CPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 472          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 403.29 bits (1035), Expect = 2.429e-133
Identity = 206/467 (44.11%), Postives = 300/467 (64.24%), Query Frame = 2
Query:  281 NQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPC-SDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRH--KPPIQF---KDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLS----VKVADFGLAR--VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELY-AIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
             +R T+ AL+ Y++R   DL F KGD MY+    +  WW   H  T +TGY+P N+V       S  E WY   I    A++ +L    P GT++IR   +D++ +AL++R  D  +N   VKHYKI+ LD++ G++I+ R  F ++  L++YY    DGLCC+LT   P+    +P +     ++ E+ R+ + L+R LG+G+FGEV+ GKW   VEVA+K +KP +M    F+ EA++M + +HP +V++  VCT+  E+P +IITE M NG+LL YLR+ +G  L +  ++DM +QIA GM YLE R  VHRDL A N+LV + +S    VKVADFGLAR  + +D+Y A TG KFPIKWTAPEA     F+VKSDVWS+G+L+YEI+T G+ PYPG+ NR+V+++V  GYR+P P G    CP+++Y  + LKCWD  P+ RPTF  L   F+ + ++ +  Y
Sbjct:   71 QERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIES--EEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTR--EEPFYIITEYMINGSLLQYLRT-DGSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRG----CPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 528          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 403.29 bits (1035), Expect = 2.429e-133
Identity = 206/467 (44.11%), Postives = 300/467 (64.24%), Query Frame = 2
Query:  281 NQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPC-SDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRH--KPPIQF---KDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLS----VKVADFGLAR--VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELY-AIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
             +R T+ AL+ Y++R   DL F KGD MY+    +  WW   H  T +TGY+P N+V       S  E WY   I    A++ +L    P GT++IR   +D++ +AL++R  D  +N   VKHYKI+ LD++ G++I+ R  F ++  L++YY    DGLCC+LT   P+    +P +     ++ E+ R+ + L+R LG+G+FGEV+ GKW   VEVA+K +KP +M    F+ EA++M + +HP +V++  VCT+  E+P +IITE M NG+LL YLR+ +G  L +  ++DM +QIA GM YLE R  VHRDL A N+LV + +S    VKVADFGLAR  + +D+Y A TG KFPIKWTAPEA     F+VKSDVWS+G+L+YEI+T G+ PYPG+ NR+V+++V  GYR+P P G    CP+++Y  + LKCWD  P+ RPTF  L   F+ + ++ +  Y
Sbjct:   71 QERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIES--EEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTR--EEPFYIITEYMINGSLLQYLRT-DGSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRG----CPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 528          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 403.29 bits (1035), Expect = 2.666e-133
Identity = 206/467 (44.11%), Postives = 300/467 (64.24%), Query Frame = 2
Query:  281 NQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPC-SDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRH--KPPIQF---KDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLS----VKVADFGLAR--VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELY-AIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
             +R T+ AL+ Y++R   DL F KGD MY+    +  WW   H  T +TGY+P N+V       S  E WY   I    A++ +L    P GT++IR   +D++ +AL++R  D  +N   VKHYKI+ LD++ G++I+ R  F ++  L++YY    DGLCC+LT   P+    +P +     ++ E+ R+ + L+R LG+G+FGEV+ GKW   VEVA+K +KP +M    F+ EA++M + +HP +V++  VCT+  E+P +IITE M NG+LL YLR+ +G  L +  ++DM +QIA GM YLE R  VHRDL A N+LV + +S    VKVADFGLAR  + +D+Y A TG KFPIKWTAPEA     F+VKSDVWS+G+L+YEI+T G+ PYPG+ NR+V+++V  GYR+P P G    CP+++Y  + LKCWD  P+ RPTF  L   F+ + ++ +  Y
Sbjct:   75 QERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIES--EEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTR--EEPFYIITEYMINGSLLQYLRT-DGSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRG----CPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 532          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 403.29 bits (1035), Expect = 2.666e-133
Identity = 206/467 (44.11%), Postives = 300/467 (64.24%), Query Frame = 2
Query:  281 NQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPC-SDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRH--KPPIQF---KDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLS----VKVADFGLAR--VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELY-AIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
             +R T+ AL+ Y++R   DL F KGD MY+    +  WW   H  T +TGY+P N+V       S  E WY   I    A++ +L    P GT++IR   +D++ +AL++R  D  +N   VKHYKI+ LD++ G++I+ R  F ++  L++YY    DGLCC+LT   P+    +P +     ++ E+ R+ + L+R LG+G+FGEV+ GKW   VEVA+K +KP +M    F+ EA++M + +HP +V++  VCT+  E+P +IITE M NG+LL YLR+ +G  L +  ++DM +QIA GM YLE R  VHRDL A N+LV + +S    VKVADFGLAR  + +D+Y A TG KFPIKWTAPEA     F+VKSDVWS+G+L+YEI+T G+ PYPG+ NR+V+++V  GYR+P P G    CP+++Y  + LKCWD  P+ RPTF  L   F+ + ++ +  Y
Sbjct:   75 QERETLVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIES--EEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTR--EEPFYIITEYMINGSLLQYLRT-DGSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRG----CPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 532          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src42A (gene:FBgn0264959 transcript:FBtr0335275)

HSP 1 Score: 391.734 bits (1005), Expect = 7.230e-129
Identity = 211/458 (46.07%), Postives = 287/458 (62.66%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSKH--YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQF------KDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRS--PEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            AL+ Y+AR  +DL F KG+ + I +D    WWLA    T+  GYIPSNYV          E WY   I   EA+KKLL   N  G ++IR  S+S+H  Y+LSVR  DT      VKHY+IR LD   GF+I+ R+ F  +  L+++Y  ++DGLC  L   C Q  KP  +          E+ R  ++  R LG+G FG+V+ G WNN+  VA+K LK  +MD   F+AEA++M KL H +++Q+  VCT   E+P++IITELM +G+LL YL++   +G+ L++  ++DM +QIA GMAYLES+N++HRDL A N+LV +   VK+ADFGLAR + +D Y A  G +FPIKWTAPEA    +FS+KSDVWSFG+L+ E+VTYGR PYPG+ N +VL +V  GYR+P P      C   LY I L+CW   P  RPTF  LQ   E +  + +S Y
Sbjct:   70 ALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKKTRSEGYIPSNYVA--KLKSIEAEPWYFRKIKRIEAEKKLLLPENEHGAFLIRD-SESRHNDYSLSVRDGDT------VKHYRIRQLDEG-GFFIARRTTFRTLQELVEHYSKDSDGLCVNLCKPCVQIEKPVTEGLSHRTRDQWEIDRTSLKFVRKLGSGQFGDVWEGLWNNTTPVAIKTLKSGTMDPKDFLAEAQIMKKLRHTKLIQLYAVCTV--EEPIYIITELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGMAYLESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIKEDEYEARVGARFPIKWTAPEAANYSKFSIKSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPQPPN----CEPRLYEIMLECWHKDPMRRPTFETLQWKLEDFYTSDQSDY 511          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0100508)

HSP 1 Score: 387.882 bits (995), Expect = 6.108e-127
Identity = 193/458 (42.14%), Postives = 289/458 (63.10%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDI--------EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARV-TDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
             V AL+ Y++R   DL F KGD M +  D    WW  ++ TT++ G IP N+V  +    S    + ++  KEADK LL   NP GT+++RP   + + Y+LSV+ ++  + Y+V KHY+I+ LDN  G+YI+    FP++ +L+  Y  N  GLC  L+  CP   KP  Q  D+        E+ R  I+L R LG G+FGEV+ GKW NS++VAVK L+  +M  + F+ EA +M K  H R+V +  VC+Q  E+P++I+ E M+ G+LL++LR  +G+ L   +++ + +Q+A GM YLES+  +HRDL A N+L+ E+   K+ DFGLARV  DD Y    G++FP+KWTAPEA +  +FS+KSDVWS+G+L+ E+ TYG+ PYPG+ +R+V++ + +G+R+P P       PD +Y + L+CWDA PE RPTF  L   FE + + +E  Y
Sbjct:   99 VVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHV-KHYRIKPLDNG-GYYIATNQTFPSLQALVMAYSKNALGLCHILSRPCP---KPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQ--EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYF--PDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSEVPY 547          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0100505)

HSP 1 Score: 387.882 bits (995), Expect = 6.108e-127
Identity = 193/458 (42.14%), Postives = 289/458 (63.10%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDI--------EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARV-TDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
             V AL+ Y++R   DL F KGD M +  D    WW  ++ TT++ G IP N+V  +    S    + ++  KEADK LL   NP GT+++RP   + + Y+LSV+ ++  + Y+V KHY+I+ LDN  G+YI+    FP++ +L+  Y  N  GLC  L+  CP   KP  Q  D+        E+ R  I+L R LG G+FGEV+ GKW NS++VAVK L+  +M  + F+ EA +M K  H R+V +  VC+Q  E+P++I+ E M+ G+LL++LR  +G+ L   +++ + +Q+A GM YLES+  +HRDL A N+L+ E+   K+ DFGLARV  DD Y    G++FP+KWTAPEA +  +FS+KSDVWS+G+L+ E+ TYG+ PYPG+ +R+V++ + +G+R+P P       PD +Y + L+CWDA PE RPTF  L   FE + + +E  Y
Sbjct:   99 VVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHV-KHYRIKPLDNG-GYYIATNQTFPSLQALVMAYSKNALGLCHILSRPCP---KPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQ--EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYF--PDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSEVPY 547          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0100504)

HSP 1 Score: 387.882 bits (995), Expect = 6.108e-127
Identity = 193/458 (42.14%), Postives = 289/458 (63.10%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDI--------EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARV-TDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
             V AL+ Y++R   DL F KGD M +  D    WW  ++ TT++ G IP N+V  +    S    + ++  KEADK LL   NP GT+++RP   + + Y+LSV+ ++  + Y+V KHY+I+ LDN  G+YI+    FP++ +L+  Y  N  GLC  L+  CP   KP  Q  D+        E+ R  I+L R LG G+FGEV+ GKW NS++VAVK L+  +M  + F+ EA +M K  H R+V +  VC+Q  E+P++I+ E M+ G+LL++LR  +G+ L   +++ + +Q+A GM YLES+  +HRDL A N+L+ E+   K+ DFGLARV  DD Y    G++FP+KWTAPEA +  +FS+KSDVWS+G+L+ E+ TYG+ PYPG+ +R+V++ + +G+R+P P       PD +Y + L+CWDA PE RPTF  L   FE + + +E  Y
Sbjct:   99 VVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHV-KHYRIKPLDNG-GYYIATNQTFPSLQALVMAYSKNALGLCHILSRPCP---KPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQ--EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYF--PDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSEVPY 547          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0304990)

HSP 1 Score: 387.882 bits (995), Expect = 6.108e-127
Identity = 193/458 (42.14%), Postives = 289/458 (63.10%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDI--------EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARV-TDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
             V AL+ Y++R   DL F KGD M +  D    WW  ++ TT++ G IP N+V  +    S    + ++  KEADK LL   NP GT+++RP   + + Y+LSV+ ++  + Y+V KHY+I+ LDN  G+YI+    FP++ +L+  Y  N  GLC  L+  CP   KP  Q  D+        E+ R  I+L R LG G+FGEV+ GKW NS++VAVK L+  +M  + F+ EA +M K  H R+V +  VC+Q  E+P++I+ E M+ G+LL++LR  +G+ L   +++ + +Q+A GM YLES+  +HRDL A N+L+ E+   K+ DFGLARV  DD Y    G++FP+KWTAPEA +  +FS+KSDVWS+G+L+ E+ TYG+ PYPG+ +R+V++ + +G+R+P P       PD +Y + L+CWDA PE RPTF  L   FE + + +E  Y
Sbjct:   99 VVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHV-KHYRIKPLDNG-GYYIATNQTFPSLQALVMAYSKNALGLCHILSRPCP---KPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQ--EEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYF--PDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSEVPY 547          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: lyn (LYN proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-040912-7])

HSP 1 Score: 432.18 bits (1110), Expect = 1.062e-144
Identity = 226/459 (49.24%), Postives = 304/459 (66.23%), Query Frame = 2
Query:  275 MYNQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSC--PQRHKPPIQFKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVT-DDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            M  +   V AL+ YEA H DDL F KG+ + I  +  E WW A   TT+K G+IPSNYV   D   +    + DIT K+A+++LL   N  G+Y+IR    SK  Y+LS+R  D  +   VVKHYKIR+LDN  G+YIS +  F +ISS+IK+Y   +DGLC KL  +C  P+  KP    KD  E+S+D I++ + LG G FGEV++  +NNS +VAVK LKP +M    F+ EA LM  L H R+V++  V T+   +P++IITE MANG+LL++L+S  G K++L +++D  +QIAEGMAY+E +N++HRDLRAAN+LV E L  K+ADFGLARV  DD Y A  G KFPIKWTAPEA     F++KSD+WSFGVL+YEI+TYG+ PYPG+ N +V+  V +GYR+P P      CP ELY I   CW   PE+RPTF ++Q + + +    E QY
Sbjct:   59 MEEKEKIVVALYPYEAIHADDLGFKKGEKLKIIEEHGE-WWKARSLTTRKEGFIPSNYVAEADTMETEEWFYKDITRKDAERQLLAPANKPGSYLIRESETSKGSYSLSIRDVDA-QGQDVVKHYKIRSLDNG-GYYISPKITFSDISSMIKHYHKQSDGLCRKLDKACEKPKAQKP--WDKDAWEISKDSIKMVKKLGAGQFGEVWMAFYNNSTKVAVKTLKPGTMSVEAFLEEANLMKTLQHDRLVRLYAVVTK--TEPIYIITEYMANGSLLDFLKSQAGSKIQLPKLIDFSAQIAEGMAYIEKKNYIHRDLRAANVLVSEMLLCKIADFGLARVIEDDQYTAREGAKFPIKWTAPEAINYGSFTIKSDMWSFGVLLYEIITYGKIPYPGMSNSEVMSSVQRGYRMPRPEN----CPVELYEIMTTCWKNKPEDRPTFDYIQSVLDDFYTATEGQY 506          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: src (v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog [Source:NCBI gene;Acc:325084])

HSP 1 Score: 428.328 bits (1100), Expect = 8.394e-143
Identity = 220/455 (48.35%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   TT ++GYIPSNYV   D   +  E WY   IT +++++ LL + N  GT+++R    +K  Y LSV  +D  K   V KHYKIR LD+  GFYI++R++F  +  L+ +Y+ + DGLC  LT  CP   KPP Q   +D  E+ RD +RL+  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM SQIA GMAY+E  N+VHRDLRAANILV ++L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P PA     CPD L+ + L CW   PE RPTF +LQ   E +  + E QY
Sbjct:   86 TFVALYDYESRTASDLSFRKGERLQIVNNTEGDWWLARSLTTGESGYIPSNYVAPSDSIQA--EEWYFGKITRRDSERLLLNLENRRGTFLVRESETTKGAYCLSVLDYDNVKGLNV-KHYKIRKLDSG-GFYITSRTQFSTLQQLVNHYRQHADGLCHSLTDVCPVL-KPPTQGLARDAWEIPRDSLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMGQGSLLDFLKGDMGKMLRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPA----ECPDSLHELMLTCWRKEPEERPTFEYLQGFLEDYFTSTEPQY 528          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: src (v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog [Source:NCBI gene;Acc:325084])

HSP 1 Score: 428.328 bits (1100), Expect = 8.394e-143
Identity = 220/455 (48.35%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   TT ++GYIPSNYV   D   +  E WY   IT +++++ LL + N  GT+++R    +K  Y LSV  +D  K   V KHYKIR LD+  GFYI++R++F  +  L+ +Y+ + DGLC  LT  CP   KPP Q   +D  E+ RD +RL+  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM SQIA GMAY+E  N+VHRDLRAANILV ++L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P PA     CPD L+ + L CW   PE RPTF +LQ   E +  + E QY
Sbjct:   86 TFVALYDYESRTASDLSFRKGERLQIVNNTEGDWWLARSLTTGESGYIPSNYVAPSDSIQA--EEWYFGKITRRDSERLLLNLENRRGTFLVRESETTKGAYCLSVLDYDNVKGLNV-KHYKIRKLDSG-GFYITSRTQFSTLQQLVNHYRQHADGLCHSLTDVCPVL-KPPTQGLARDAWEIPRDSLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMGQGSLLDFLKGDMGKMLRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPA----ECPDSLHELMLTCWRKEPEERPTFEYLQGFLEDYFTSTEPQY 528          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: fyna (FYN proto-oncogene, Src family tyrosine kinase a [Source:NCBI gene;Acc:373872])

HSP 1 Score: 424.476 bits (1090), Expect = 3.077e-141
Identity = 213/454 (46.92%), Postives = 300/454 (66.08%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSC----PQRHKPPIQFKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            AL+ YEAR  DDL F KG+   I +     WW A   TT  TGYIPSNYV   D   +  E WY   +  K+A+++LL  GNP GT++IR    +K  Y+LS++ +D TK  +V KHYKIR LDN  G+YI+ R++F  +  L+ +Y     GLCC+L + C    P+     ++ KD+ E+ R+ ++L + LGNG FGEV++G WN + +VAVK LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+  EG+ L+L  ++DM +Q+A GMAY+E  N++HRDLR+ANILV + L  K+ADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+VT GR PYPG+ NR+VL++V +GYR+P P      CP  L+ + L+CW   PE RPTF +LQ   E +    E QY
Sbjct:   89 ALYDYEARSEDDLSFRKGEKFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSIQA--EDWYFGKLGRKDAERQLLSNGNPRGTFLIRESETTKGAYSLSIQDWDETKGDHV-KHYKIRKLDNG-GYYITTRAQFETLQQLVHHYSARAAGLCCRLIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD----CPSSLHELMLQCWKRDPEERPTFEYLQAFLEDYFTATEPQY 531          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: src (v-src avian sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog [Source:NCBI gene;Acc:325084])

HSP 1 Score: 421.779 bits (1083), Expect = 3.188e-140
Identity = 220/461 (47.72%), Postives = 301/461 (65.29%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEA------WWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++  +       WWLA   TT ++GYIPSNYV   D   +  E WY   IT +++++ LL + N  GT+++R    +K  Y LSV  +D  K   V KHYKIR LD+  GFYI++R++F  +  L+ +Y+ + DGLC  LT  CP   KPP Q   +D  E+ RD +RL+  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM SQIA GMAY+E  N+VHRDLRAANILV ++L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P PA     CPD L+ + L CW   PE RPTF +LQ   E +  + E QY
Sbjct:   86 TFVALYDYESRTASDLSFRKGERLQIVNNTRKLNPREGDWWLARSLTTGESGYIPSNYVAPSDSIQA--EEWYFGKITRRDSERLLLNLENRRGTFLVRESETTKGAYCLSVLDYDNVKGLNV-KHYKIRKLDSG-GFYITSRTQFSTLQQLVNHYRQHADGLCHSLTDVCPVL-KPPTQGLARDAWEIPRDSLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMGQGSLLDFLKGDMGKMLRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPA----ECPDSLHELMLTCWRKEPEERPTFEYLQGFLEDYFTSTEPQY 534          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: cthrc1 (collagen triple helix repeat containing 1 [Source:Xenbase;Acc:XB-GENE-980161])

HSP 1 Score: 429.483 bits (1103), Expect = 7.991e-144
Identity = 220/455 (48.35%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   ++ +TGYIPSNYV   D   +  E WY   IT +EA++ LL + NP GT+++R    +K  Y LSV  +D  +   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ RD +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +    E QY
Sbjct:   34 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLSSGQTGYIPSNYVAPSDSIQA--EEWYLGKITRREAERLLLSLENPRGTFLVRESETTKGAYCLSVSDYDANRGLNV-KHYKIRKLDSG-GFYITSRTQFSSLQQLVAYYSKHADGLCHRLTTVCPT-AKPQTQGLSKDAWEIPRDSLRLELKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGEMGRYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPD----CPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTATEPQY 476          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: cthrc1 (collagen triple helix repeat containing 1 [Source:Xenbase;Acc:XB-GENE-980161])

HSP 1 Score: 429.483 bits (1103), Expect = 9.032e-144
Identity = 220/455 (48.35%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   ++ +TGYIPSNYV   D   +  E WY   IT +EA++ LL + NP GT+++R    +K  Y LSV  +D  +   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ RD +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +    E QY
Sbjct:   41 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLSSGQTGYIPSNYVAPSDSIQA--EEWYLGKITRREAERLLLSLENPRGTFLVRESETTKGAYCLSVSDYDANRGLNV-KHYKIRKLDSG-GFYITSRTQFSSLQQLVAYYSKHADGLCHRLTTVCPT-AKPQTQGLSKDAWEIPRDSLRLELKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGEMGRYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPD----CPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTATEPQY 483          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: cthrc1 (collagen triple helix repeat containing 1 [Source:Xenbase;Acc:XB-GENE-980161])

HSP 1 Score: 429.098 bits (1102), Expect = 1.015e-143
Identity = 220/455 (48.35%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   ++ +TGYIPSNYV   D   +  E WY   IT +EA++ LL + NP GT+++R    +K  Y LSV  +D  +   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ RD +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +    E QY
Sbjct:   36 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLSSGQTGYIPSNYVAPSDSIQA--EEWYLGKITRREAERLLLSLENPRGTFLVRESETTKGAYCLSVSDYDANRGLNV-KHYKIRKLDSG-GFYITSRTQFSSLQQLVAYYSKHADGLCHRLTTVCPT-AKPQTQGLSKDAWEIPRDSLRLELKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGEMGRYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPD----CPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTATEPQY 478          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: cthrc1 (collagen triple helix repeat containing 1 [Source:Xenbase;Acc:XB-GENE-980161])

HSP 1 Score: 429.098 bits (1102), Expect = 2.274e-143
Identity = 220/455 (48.35%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   ++ +TGYIPSNYV   D   +  E WY   IT +EA++ LL + NP GT+++R    +K  Y LSV  +D  +   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ RD +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +    E QY
Sbjct:   58 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLSSGQTGYIPSNYVAPSDSIQA--EEWYLGKITRREAERLLLSLENPRGTFLVRESETTKGAYCLSVSDYDANRGLNV-KHYKIRKLDSG-GFYITSRTQFSSLQQLVAYYSKHADGLCHRLTTVCPT-AKPQTQGLSKDAWEIPRDSLRLELKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGEMGRYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPD----CPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTATEPQY 500          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: cthrc1 (collagen triple helix repeat containing 1 [Source:Xenbase;Acc:XB-GENE-980161])

HSP 1 Score: 430.254 bits (1105), Expect = 2.296e-143
Identity = 220/455 (48.35%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   ++ +TGYIPSNYV   D   +  E WY   IT +EA++ LL + NP GT+++R    +K  Y LSV  +D  +   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ RD +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +    E QY
Sbjct:   84 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLSSGQTGYIPSNYVAPSDSIQA--EEWYLGKITRREAERLLLSLENPRGTFLVRESETTKGAYCLSVSDYDANRGLNV-KHYKIRKLDSG-GFYITSRTQFSSLQQLVAYYSKHADGLCHRLTTVCPT-AKPQTQGLSKDAWEIPRDSLRLELKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGEMGRYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPD----CPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTATEPQY 526          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Src (Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:98397])

HSP 1 Score: 429.869 bits (1104), Expect = 2.301e-143
Identity = 221/455 (48.57%), Postives = 299/455 (65.71%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   87 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 529          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Src (Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:98397])

HSP 1 Score: 429.869 bits (1104), Expect = 2.301e-143
Identity = 221/455 (48.57%), Postives = 299/455 (65.71%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   87 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 529          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Src (Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:98397])

HSP 1 Score: 429.869 bits (1104), Expect = 2.301e-143
Identity = 221/455 (48.57%), Postives = 299/455 (65.71%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   87 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 529          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Src (Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:98397])

HSP 1 Score: 424.861 bits (1091), Expect = 2.347e-141
Identity = 223/461 (48.37%), Postives = 301/461 (65.29%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISS-----DMSEA-WWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I +     D+ E  WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   87 TFVALYDYESRTETDLSFKKGERLQIVNNTRKVDVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 535          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Src (Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:98397])

HSP 1 Score: 424.861 bits (1091), Expect = 2.347e-141
Identity = 223/461 (48.37%), Postives = 301/461 (65.29%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISS-----DMSEA-WWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I +     D+ E  WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   87 TFVALYDYESRTETDLSFKKGERLQIVNNTRKVDVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 535          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P42687|SPK1_GIRTI (Tyrosine-protein kinase SPK-1 OS=Girardia tigrina OX=6162 PE=2 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 4.597e-143
Identity = 209/440 (47.50%), Postives = 290/440 (65.91%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGF-YISNRSKFPNISSLIKYYQTNTDG-LCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTD-DVYNADTGT-KFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAG--GKIVCPDELYAIKLKCWDAYPENRPTFSHLQD 1597
            V+A + Y A    D+ F + ++MY+     E W   +     K G +PSNYV   DGSP S E W +I   EA+K L+++G   GTYIIRP      YALSVR FD  K   +VKH++I+TL +  G  Y  N   FPNI +LI++Y+ N  G     LT   P  ++PP+ F+DIE++R+ I +   +G G FG V+  KW  S EVA K L+ +  +R +F+ EA++MHKL H +IV++LGVCT+P + P+ II E M NG+L  YL++P+G+K  LN+M+ MM++I+EGMAYLES   VHRDLRA NILV  DL+ KVADFGL  +TD  + + +  T +FP KWTAPEA   + F+ KSDVWS+G++M+EI+T+  +PYP IP ++V+++VSKGYR+PNP      + CPDE+Y I + CWDA PE RPTF  LQ+
Sbjct:   38 VKAKYKYAASGDTDISFEEKEIMYVLEQFDEFWLKVVKQKDNKEGLVPSNYVSKQDGSPQSVEAWREIQRWEAEKSLMKIGLQKGTYIIRPSRKENSYALSVRDFDEKKKICIVKHFQIKTLQDEKGISYSVNIRNFPNILTLIQFYEKNGIGNTHIPLTDPMPDNYQPPVHFQDIEINRENIEILNEIGRGFFGSVHRAKWGRSYEVAAKMLQSSKAEREKFVLEAKIMHKLRHRKIVELLGVCTEPQDMPMLIIVEYMKNGSLKEYLKTPDGKKTNLNQMVHMMAEISEGMAYLESEKVVHRDLRADNILVANDLTRKVADFGLTELTDGSLGDQEKKTLRFPYKWTAPEAAKSKVFTSKSDVWSYGIVMFEILTWASSPYPDIPAKEVIEKVSKGYRMPNPEKFITGVCCPDEIYKIMIWCWDANPEKRPTFLVLQE 477          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P12931|SRC_HUMAN (Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3)

HSP 1 Score: 431.409 bits (1108), Expect = 4.651e-143
Identity = 221/455 (48.57%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   88 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 530          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P13116|SRC2_XENLA (Tyrosine-protein kinase Src-2 OS=Xenopus laevis OX=8355 GN=src-b PE=2 SV=3)

HSP 1 Score: 431.024 bits (1107), Expect = 4.914e-143
Identity = 220/455 (48.35%), Postives = 301/455 (66.15%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   ++ +TGYIPSNYV   D   +  E WY   IT +EA++ LL + NP GT+++R    +K  Y LSV  +D ++   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ RD +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +    E QY
Sbjct:   84 TFVALYDYESRTETDLSFRKGERLQIVNNTEGDWWLARSLSSGQTGYIPSNYVAPSDSIQA--EEWYLGKITRREAERLLLSLENPRGTFLVRESETTKGAYCLSVSDYDASRGLNV-KHYKIRKLDSG-GFYITSRTQFSSLQQLVAYYSKHADGLCHRLTAVCPT-AKPQTQGLSKDAWEIPRDSLRLELKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGEMGRYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPD----CPESLHDLMFQCWRKDPEERPTFEYLQAFLEDYFTATEPQY 526          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P00523|SRC_CHICK (Proto-oncogene tyrosine-protein kinase Src OS=Gallus gallus OX=9031 GN=SRC PE=1 SV=4)

HSP 1 Score: 430.254 bits (1105), Expect = 1.092e-142
Identity = 222/455 (48.79%), Postives = 300/455 (65.93%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   TT +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   85 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKGEMGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQY 527          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q9WUD9|SRC_RAT (Proto-oncogene tyrosine-protein kinase Src OS=Rattus norvegicus OX=10116 GN=Src PE=1 SV=4)

HSP 1 Score: 429.869 bits (1104), Expect = 1.792e-142
Identity = 221/455 (48.57%), Postives = 299/455 (65.71%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   +T +TGYIPSNYV   D   +  E WY   IT +E+++ LL   NP GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F ++  L+ YY  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV E+L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P P      CP+ L+ +  +CW   PE RPTF +LQ   E +  + E QY
Sbjct:   88 TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQA--EEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPT-SKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPP----ECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQY 530          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: G7YFZ5 (Tyrosine-protein kinase OS=Clonorchis sinensis OX=79923 GN=CLF_106945 PE=3 SV=1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 284/448 (63.39%), Postives = 355/448 (79.24%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYF 1639
            VRAL++Y  +H DDL F KGD M++S D+S  WWLA H  T  TGYIPSNYV++DDG P+S + WYDI+ +EADK+LLR+GNP GTY+IR  S++++YALSVRH+D  +N YVVKHY+IR LDN+ G++ISNR  FPNI  LI YY    +GLCC+LT+ CP+ ++PP+QF+D EV+R+ I + R LG+GSFGEVYL KWN+SVEVAVK ++ +  DR++FI EA LMH+ +HPRIVQ+LGVCTQP ++PV+IITELMA GAL+++LR  EGQ+L L++++DMM+QIA GM YLE RN VHRDLRAANILVD D SVKV+DFGLA++  D   AD  TKFPIKWTAPEA +Q  FS+KSDVWSFGVLMYEIVTYG TPYPG+  RQ + EV KGYRLPNP      CPD+LY I LKCWD  PENRPTF  L D+F++W  + E+QYF
Sbjct:  109 VRALYTYTGQHQDDLPFRKGDTMFVS-DVSAQWWLARHQKTGATGYIPSNYVLIDDGLPTSLDAWYDISRREADKRLLRVGNPKGTYLIRSSSETQNYALSVRHYDQERNIYVVKHYRIRVLDNDNGYFISNRITFPNIKDLISYYSRTAEGLCCRLTVPCPRDYRPPVQFRDFEVNRNSITMVRQLGHGSFGEVYLAKWNDSVEVAVK-MRLSHTDRTKFIEEARLMHEFHHPRIVQLLGVCTQPEDEPVYIITELMAKGALVDFLRGDEGQQLSLSDLIDMMAQIASGMTYLEERNSVHRDLRAANILVDSDNSVKVSDFGLAKIISDDAQADHSTKFPIKWTAPEAALQHIFSIKSDVWSFGVLMYEIVTYGGTPYPGMSTRQTIVEVDKGYRLPNPHTANHPCPDDLYNIMLKCWDVRPENRPTFRSLYDVFDNWASHVETQYF 554          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A4S2LUM5 (Tyrosine-protein kinase OS=Opisthorchis felineus OX=147828 GN=CRM22_004736 PE=3 SV=1)

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 284/448 (63.39%), Postives = 355/448 (79.24%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYF 1639
            VRAL++Y  +H DDL F KGD M++S D+S  WWLA H  T  TGYIPSNYV++DDG P+S + WYDI+ +EADK+LLR+GNP GTY+IR  S++++YALSVRH+D  +N YVVKHY+IR LDN+ G++ISNR  FPNI  LI YY    +GLCC+LT+ CP+ ++PP+QF+D EV+R+ I + R LG+GSFGEVYL KWN+SVEVAVK ++ +  DR++FI EA LMH+ +HPRIVQ+LGVCTQP ++PV+IITELMA GAL+++LR  EGQ+L L++++DMM+QIA GM YLE RN VHRDLRAANILVD D SVKV+DFGLA++  D   AD  TKFPIKWTAPEA +Q  FS+KSDVWSFGVLMYEIVTYG TPYPG+  RQ + EV KGYRLPNP      CPD+LY I LKCWD  PENRPTF  L D+F++W  + E+QYF
Sbjct:  109 VRALYTYTGQHQDDLPFRKGDTMFVS-DVSAQWWLARHQKTGATGYIPSNYVLIDDGLPTSLDAWYDISRREADKRLLRVGNPKGTYLIRSSSETQNYALSVRHYDQERNIYVVKHYRIRVLDNDNGYFISNRITFPNIKDLISYYSRTAEGLCCRLTVPCPRDYRPPVQFRDFEVNRNSITMVRQLGHGSFGEVYLAKWNDSVEVAVK-MRLSHTDRTKFIEEARLMHEFHHPRIVQLLGVCTQPEDEPVYIITELMAKGALVDFLRGDEGQQLSLSDLIDMMAQIASGMTYLEERNSVHRDLRAANILVDSDNSVKVSDFGLAKIISDDAQADHSTKFPIKWTAPEAALQHIFSIKSDVWSFGVLMYEIVTYGGTPYPGMSTRQTIVEVDKGYRLPNPHTANHPCPDDLYNIMLKCWDVRPENRPTFRSLYDVFDNWASHVETQYF 554          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A074ZSJ9 (Tyrosine-protein kinase OS=Opisthorchis viverrini OX=6198 GN=T265_04412 PE=3 SV=1)

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 284/448 (63.39%), Postives = 355/448 (79.24%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYF 1639
            VRAL++Y  +H DDL F KGD M++S D+S  WWLA H  T  TGYIPSNYV++DDG P+S + WYDI+ +EADK+LLR+GNP GTY+IR  S++++YALSVRH+D  +N YVVKHY+IR LDN+ G++ISNR  FPNI  LI YY    +GLCC+LT+ CP+ ++PP+QF+D EV+R+ I + R LG+GSFGEVYL KWN+SVEVAVK ++ +  DR++FI EA LMH+ +HPRIVQ+LGVCTQP ++PV+IITELMA GAL+++LR  EGQ+L L++++DMM+QIA GM YLE RN VHRDLRAANILVD D SVKV+DFGLA++  D   AD  TKFPIKWTAPEA +Q  FS+KSDVWSFGVLMYEIVTYG TPYPG+  RQ + EV KGYRLPNP      CPD+LY I LKCWD  PENRPTF  L D+F++W  + E+QYF
Sbjct:  109 VRALYTYTGQHQDDLPFRKGDTMFVS-DVSAQWWLARHQKTGATGYIPSNYVLIDDGLPTSLDAWYDISRREADKRLLRVGNPKGTYLIRSSSETQNYALSVRHYDQERNIYVVKHYRIRVLDNDNGYFISNRITFPNIKDLISYYSRTAEGLCCRLTVPCPRDYRPPVQFRDFEVNRNSITMVRQLGHGSFGEVYLAKWNDSVEVAVK-MRLSHTDRTKFIEEARLMHEFHHPRIVQLLGVCTQPEDEPVYIITELMAKGALVDFLRGDEGQQLSLSDLIDMMAQIASGMTYLEERNSVHRDLRAANILVDSDNSVKVSDFGLAKIISDDAQADHSTKFPIKWTAPEAALQHIFSIKSDVWSFGVLMYEIVTYGGTPYPGMSTRQTIVEVDKGYRLPNPHTANHPCPDDLYNIMLKCWDVRPENRPTFRSLYDVFDNWASHVETQYF 554          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: C1LGZ6 (Tyrosine-protein kinase OS=Schistosoma japonicum OX=6182 GN=fyn-prov PE=2 SV=1)

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 280/448 (62.50%), Postives = 352/448 (78.57%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYF 1639
            VRAL+SY+  + DDL F KGD+M++ S MS+AWW A HA T  +GYIPSNYV LDDG P+S + WYDI  +EAD+KLL +GNP GTY+IRP S++++YALSVRH+D+ KN +VVKHY+IR LDNN GF+IS R+ FPNI  L+ YY  + DGLCC+L++ CP+ ++PP+QF+D E++RD I   R LG G+FGEVYL KWN SVEVAVK ++ +  DRSRFI EA LMH  +HPRIVQ+LGVCT+P +QPV+IITELM  GAL ++LR+ EG KL L++++D+M+QIA GM+YLE  N VHRDLRAANILVD+D SVKV+DFGLA++  D  +AD  TKFPIKWTAPEA +Q  FS+KSDVWSFG+LMYEIVTYG TPYPG+  RQ + EV KGYRLP P   +  CPD+LY +  KCWDA PENRPTF  L D+FE+W  + E+QY 
Sbjct:  117 VRALYSYQGHNQDDLPFQKGDIMFVVSGMSDAWWFARHAETGMSGYIPSNYVCLDDGLPTSLDAWYDIGRREADRKLLLVGNPKGTYLIRPSSETQNYALSVRHYDSEKNMWVVKHYRIRILDNNGGFFISIRTTFPNIQDLVNYYTVHPDGLCCRLSIPCPRAYRPPVQFRDFEINRDSITRIRKLGQGTFGEVYLAKWNGSVEVAVK-MRLDPTDRSRFIEEARLMHAFHHPRIVQLLGVCTEPEDQPVYIITELMRKGALYDFLRTEEGHKLTLDDLIDIMAQIASGMSYLEEMNSVHRDLRAANILVDQDYSVKVSDFGLAKIISDDSHADPNTKFPIKWTAPEAALQHIFSIKSDVWSFGILMYEIVTYGGTPYPGMTTRQTVAEVEKGYRLPCPHTPEHPCPDDLYNLMRKCWDARPENRPTFRSLYDVFENWSTHTEAQYL 563          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A094ZT02 (Tyrosine-protein kinase OS=Schistosoma haematobium OX=6185 GN=MS3_05644 PE=3 SV=1)

HSP 1 Score: 610.912 bits (1574), Expect = 0.000e+0
Identity = 279/448 (62.28%), Postives = 352/448 (78.57%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYF 1639
            VRAL+SY+  + DDL F KGD+M++ S MS+AWW A H+ T  +GYIPSNYV L+DG P+S + WYDI  +EAD+KLL +GNP GTY+IRP S++++YALSVRH+D+ KN +VVKHY+IR LDNN GF+IS R+ FPNI  LI YY  + DGLCC+L++ CP+ ++PP+QF+D E++RD I   R LG G+FGEVYL KWN SVEVAVK ++ +  DRSRFI EA LMH  +HPRIVQ+LGVCT+P +QPV+IITELM  GAL ++LR+ EG KL L++++D+M+QIA GM+YLE  N VHRDLRAANILVD+D SVKV+DFGLA++  D  +AD  TKFPIKWTAPEA +Q  FS+KSDVWSFG+LMYEIVTYG TPYPG+  RQ + EV KGYRLP P   +  CPD+LY +  KCWDA PENRPTF  L D+FE+W  + E+QY 
Sbjct:  117 VRALYSYQGHNQDDLSFQKGDIMFVISGMSDAWWFARHSDTGMSGYIPSNYVCLNDGLPTSLDAWYDIGRREADRKLLLVGNPKGTYLIRPSSETQNYALSVRHYDSEKNMWVVKHYRIRILDNNGGFFISIRTTFPNIQDLINYYTVHPDGLCCRLSIPCPRAYRPPVQFRDFEINRDSITRIRKLGQGTFGEVYLAKWNGSVEVAVK-MRLDPTDRSRFIEEARLMHAFHHPRIVQLLGVCTEPEDQPVYIITELMRKGALYDFLRTEEGHKLTLDDLIDIMAQIASGMSYLEEMNSVHRDLRAANILVDQDYSVKVSDFGLAKIISDDSHADPNTKFPIKWTAPEAALQHIFSIKSDVWSFGILMYEIVTYGGTPYPGMTTRQTVAEVEKGYRLPCPHTPEHPCPDDLYNLMRKCWDARPENRPTFRSLYDVFENWSTHTEAQYL 563          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: fyna (tyrosine-protein kinase fyna [Source:NCBI gene;Acc:103043249])

HSP 1 Score: 422.55 bits (1085), Expect = 1.579e-140
Identity = 212/454 (46.70%), Postives = 299/454 (65.86%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSC----PQRHKPPIQFKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            AL+ YEAR  DDL F KG+   I +     WW A   TT  TGYIPSNYV   D   +  E WY   +  K+A+++LL  GNP GT++IR    +K  Y+LS++ +D  K  +V KHYKIR LDN  G+YI+ R++F  +  L+++Y     GLCC+L + C    P+     ++ KD+ E+ R+ ++L + LGNG FGEV++G WN + +VAVK LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+  EG+ L+L  ++DM +Q+A GMAY+E  N++HRDLR+ANILV + L  K+ADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+VT GR PYPG+ NR+VL++V +GYR+P P      CP  L+ + L+CW   PE RPTF +LQ   E +    E QY
Sbjct:   89 ALYDYEARTEDDLSFRKGEKFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSIQA--EDWYFGKLGRKDAERQLLSNGNPRGTFLIRESETTKGAYSLSIQDWDDIKGDHV-KHYKIRKLDNG-GYYITTRAQFETLQQLVQHYSARAAGLCCRLIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVS---EEPIYIVTEYMGKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD----CPISLHELMLQCWKRDPEERPTFEYLQAFLEDYFTATEPQY 531          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: src (proto-oncogene tyrosine-protein kinase Src [Source:NCBI gene;Acc:103038924])

HSP 1 Score: 421.394 bits (1082), Expect = 4.821e-140
Identity = 220/462 (47.62%), Postives = 300/462 (64.94%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSS-------HEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++    WWLA   TT ++GYIPSNYV   D   +         + WY   IT +++++ LL + N  GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F N+  L+ +Y+ + DGLC  LT  CP   KP  Q   +D  E+ R+ +RL+  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM SQIA GMAY+E  N+VHRDLRAANILV ++L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFGVL+ E+ T GR PYPG+ NR+VLD+V +GYR+P PA     CPD L+ + L CW   PE RPTF +LQ   E +  + E QY
Sbjct:   88 TFVALYDYESRTASDLSFRKGERLQIVNNTEGDWWLARSLTTGESGYIPSNYVAPSDSIQAEDHLRLTLEKRWYFGKITRRDSERLLLSLDNRRGTFLVRESETTKGAYCLSVLDFDNVKGLNV-KHYKIRKLDSG-GFYITSRTQFSNLQQLVSHYRKHADGLCHFLTDVCPVL-KPQTQGLARDAWEIPRESLRLDLKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMGQGSLLDFLKGDMGKILRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPGMVNREVLDQVERGYRMPCPA----ECPDSLHDLMLTCWRKEPEERPTFEYLQGFLEDYFTSTEPQY 539          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: src (proto-oncogene tyrosine-protein kinase Src [Source:NCBI gene;Acc:103038924])

HSP 1 Score: 419.468 bits (1077), Expect = 2.568e-139
Identity = 221/461 (47.94%), Postives = 301/461 (65.29%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEA------WWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KG+ + I ++  +       WWLA   TT ++GYIPSNYV   D   +  E WY   IT +++++ LL + N  GT+++R    +K  Y LSV  FD  K   V KHYKIR LD+  GFYI++R++F N+  L+ +Y+ + DGLC  LT  CP   KP  Q   +D  E+ R+ +RL+  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M  G+LL++L+   G+ LRL +++DM SQIA GMAY+E  N+VHRDLRAANILV ++L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFGVL+ E+ T GR PYPG+ NR+VLD+V +GYR+P PA     CPD L+ + L CW   PE RPTF +LQ   E +  + E QY
Sbjct:   88 TFVALYDYESRTASDLSFRKGERLQIVNNTRKLNCREGDWWLARSLTTGESGYIPSNYVAPSDSIQA--EEWYFGKITRRDSERLLLSLDNRRGTFLVRESETTKGAYCLSVLDFDNVKGLNV-KHYKIRKLDSG-GFYITSRTQFSNLQQLVSHYRKHADGLCHFLTDVCPVL-KPQTQGLARDAWEIPRESLRLDLKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMGQGSLLDFLKGDMGKILRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPGMVNREVLDQVERGYRMPCPA----ECPDSLHDLMLTCWRKEPEERPTFEYLQGFLEDYFTSTEPQY 536          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: clul1 (tyrosine-protein kinase yes [Source:NCBI gene;Acc:103029125])

HSP 1 Score: 418.313 bits (1074), Expect = 7.516e-139
Identity = 214/452 (47.35%), Postives = 298/452 (65.93%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            AL+ YEAR +DDL F KGD   I ++    WW A    T K GYIPSNYV   D   +  E WY   +  K+A++ LL  GN  GT+++R    +K  Y+LS+R +D  K   V KHYKIR LDN  G+YI+ R++F  +  L+K+Y  + DGLC +LT  CP   KP  Q   KD  E+ R+ +RLE  LG G FGEV++G WN + +VA+K LKP +M    F+ EA++M KL H ++V +  V +   E+P++I+TE M  G+LL++L+  EG+ L+L +++DM +QIA+GMA++E  N++HRDLRAANILV ++L  K+ADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+VT GR PYPG+ NR+VL++V +GYR+P P G    CP+ L+ +   CW   P+ RPTF ++Q   E +    E QY
Sbjct:  102 ALYDYEARTSDDLSFKKGDRFQIINNTEGDWWEARSINTGKKGYIPSNYVAPADSIQA--EEWYFGKMGRKDAERLLLVPGNQRGTFLVRESETTKGAYSLSIRDWDDMKGDNV-KHYKIRKLDNG-GYYITTRAQFETLQKLVKHYTEHADGLCYRLTTVCPTV-KPQTQGLAKDAWEIPRESLRLELKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMSPEAFLQEAQIMKKLRHDKLVPLYAVVS---EEPIYIVTEYMGKGSLLDFLKEGEGKYLKLPQLVDMAAQIADGMAFIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQG----CPESLHEMMRLCWKKEPDERPTFEYIQSFLEDYFTATEPQY 541          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: SRC (proto-oncogene tyrosine-protein kinase Src-like [Source:NCBI gene;Acc:103042998])

HSP 1 Score: 417.927 bits (1073), Expect = 1.098e-138
Identity = 216/462 (46.75%), Postives = 304/462 (65.80%), Query Frame = 2
Query:  272 VMYNQR--PTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            +M  QR   T  AL+ YE+R T DL F KG+ + I ++    WWLA   TT ++GYIPSNYV   D   +    +  IT +++++ LL + N  GT+++R    +K  Y LSV  +D  K   + KHYKIR LD+  GFYI++R++F ++  L+ +Y+T+ DGLC  LT  CP   KP  Q   +D  E+ R+ +RL+  LG G FGEV++G WN +  VA+K LK  +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+  +G+ LRL +++DM SQIA GMAY+E  N+VHRDLRAANILV ++L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+ T GR PYPG+ NR+VLD+V +GYR+P PA     CP  ++ + L CW   PE RPTF +LQ   E +  + E QY
Sbjct:   79 IMSPQRGVTTFVALYDYESRTTADLTFKKGERLQILNNTEGDWWLARSLTTGESGYIPSNYVAPSDSIQAEEWFFGKITRRDSERLLLNIQNRRGTFLVRESETTKGAYCLSVLDYDNMKGLNI-KHYKIRKLDSG-GFYITSRTQFTSLQQLVLHYRTHADGLCHVLTDICPML-KPQTQGLARDAWEIPRESLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKRGTMSPEAFLEEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSQGSLLDFLKGDKGKFLRLPQLVDMASQIAAGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELATKGRVPYPGMVNREVLDQVERGYRMPCPA----ECPSSMHELMLSCWRKEPEERPTFEYLQGFLEDYFTSTEPQY 530          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 422.165 bits (1084), Expect = 1.828e-142
Identity = 213/450 (47.33%), Postives = 296/450 (65.78%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDD-VYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            V AL+ +E  + DD+ F KGD M I  +  E WW+A        GYIPSNYV   +   +    +  ++ KE ++ LL  GN IG Y++R    +K  Y+LSVR +D T N  VV+HYKIRTLDN  G++IS R  FP++ +LI++Y  ++DGLC KL   C  +    +  KD  E+ RD ++L + LG G FGEV++G +NN  +VA+K +KP SM    F+ EA LM  L HPR+V++  V TQ   +P++I+TE M NG+LL+YL+S EG  L + +M+DM +QIAEGMA++E +N++HRDLRAANILV+E L+ K+ADFGLAR+ +D  Y A  G KFPIKWTAPEA     FS+KSDVWSFG+L+ EI+T+GR PYPG+ N  V+ ++ +GYR+P P       P +LY + + CW   PE RPTF +LQ + E +  + E QY
Sbjct:    3 VVALYDFEQLNPDDMGFKKGDKMRIIQERGE-WWMAELMDGSHKGYIPSNYVAKANSLETEEWFFSGVSRKEGERLLLAPGNSIGAYLLRDSESNKGSYSLSVRDYDIT-NGDVVRHYKIRTLDNG-GYFISARLTFPDLFALIQHYTAHSDGLCQKLLRPCVSKKPQQLWEKDAWEIPRDSLKLSKRLGAGQFGEVWMGIYNNRTKVAIKTMKPGSMSPEAFLDEANLMKTLQHPRLVRLYAVVTQ---EPIYIVTEFMENGSLLDYLKSTEGSTLPMPKMIDMAAQIAEGMAFIERKNYIHRDLRAANILVNEQLASKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEIITFGRIPYPGMSNSDVIRQLERGYRMPCPEQ----APKQLYGVMMDCWKERPEERPTFEYLQGVLEDFFTSTEGQY 442          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: clul1 (clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GENE-031118-57])

HSP 1 Score: 421.394 bits (1082), Expect = 1.007e-141
Identity = 217/460 (47.17%), Postives = 303/460 (65.87%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEA--------WWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            AL+ Y+AR  DDL F KG+   I ++  E         WW A   +T   GYIPSNYV   D   +  E WY   ++ K+A+++LL  GNP GT++IR    +K  Y+LS+R +D  K   V KHYKIR LDN  G+YI+ R++F  +  L+++Y  + DGLC KLTL CP   KP  Q   +D  E+ RD ++LE  LG G FGEV+ G WN + +VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+  +G+ L+L +++DM +QIA GMAY+E  N++HRDLRAANILV ++L  K+ADFGLAR + D+ Y A  G KFPIKWTAPEA M  RF++KSDVWSFG+L+ E+VT GR PYPG+ NR+VL++V +GYR+P P      CP+ L+ + ++CW   PE RPTF +LQ   E +    E QY
Sbjct:   20 ALYDYDARTQDDLSFRKGEKFQIINNTIEVAVVYREGDWWEARSLSTGNKGYIPSNYVAPADSVQA--EEWYFGKVSRKDAERQLLCPGNPRGTFLIRESETTKGAYSLSIRDWDEVKGDNV-KHYKIRKLDNG-GYYITTRAQFDTLQKLVQHYSEHADGLCYKLTLVCPN-EKPQTQGLARDAWEMPRDSLKLELKLGQGCFGEVWAGTWNGTTKVAIKTLKPGTMSPEAFLEEAQIMKKLRHDKLVQLYAVVS---EEPIYIVTEFMSKGSLLDFLKEGDGRYLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDNLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAAMFGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPPS----CPESLHELMMQCWKKDPEERPTFEYLQAFLEDYFTATEPQY 467          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 395.971 bits (1016), Expect = 5.073e-132
Identity = 208/451 (46.12%), Postives = 280/451 (62.08%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKT-------GYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPP---IQFKDI---EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVT----DDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQ 1594
            AL+ Y+ R  +DL F +G+L+ ++   +  WW A   T   +       GYIP+NYV   +      E W+  DI   +A+K LL   N  G ++IR     K  Y+LSVR   T      VKHY+IR LD N GF+IS R  F N+  L++YY++N+DGLC  L   C     P    + +  +   E+ R  I+L++ LG G FGEV+ G WNNS  VAVK LKP +M +  FI EA++M +L H  ++Q+  VC+Q  E+P++IITELM +G+LL+YLR P G++L+  E++DM  QIA GMAYLES+N++HRDL A NILV E    KVADFGLAR+     +D Y    G K PIKWTAPEA    RFSVKSDVWSFG+L+YE++TYGR PYP + N +VL ++ +GYR+P P      CP   Y+I L+CW+   E RPTF  LQ
Sbjct:    3 ALYDYDGRTNEDLSFKEGELLEVTDKTNSDWWYAQKKTASTSNERYNTRGYIPANYVA--EYQSLDAEPWFFGDIKRADAEKYLLADVNTTGAFLIRQSESRKTDYSLSVRDGST------VKHYRIRQLDENGGFFISRRVTFQNLIELVQYYKSNSDGLCMALQKPCVVIEAPTTIGLSYNTVDKWEIPRASIQLQKRLGAGMFGEVWQGLWNNSTLVAVKTLKPGAMKKEEFIGEAQIMKQLRHANLIQLYAVCSQ--EEPIYIITELMRHGSLLDYLRGPLGKQLKAPELVDMARQIAAGMAYLESQNYIHRDLAARNILVGEGKVCKVADFGLARIIKVRYEDEYEGKAGAKVPIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYGRMPYPEMGNMEVLKQLDRGYRMPQPDN----CPPLFYSIMLECWNKKEEERPTFETLQ 439          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 396.356 bits (1017), Expect = 1.641e-131
Identity = 207/454 (45.59%), Postives = 292/454 (64.32%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVR-HFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSC----PQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDD-VYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            V AL+ Y+  H DDL F +GD + I  + ++ WW A    TKK GYIPSN+V   +        +  ++ K+A+++LL  GN IG+Y+IR    +K  Y+LSVR H     +   VKHYKIRTLD   G++I++R  F  +  L+ YY    DGLC KL   C    PQ+   P +    E+ R+ I+LE+ LG G FG+V++G +N   +VAVK +KP SM    F+ EA LM  L H ++V++  V T   ++P+FI+TE M  G+LL++L++ EG +L+  +M+DM +Q+AEGMA++E +N++HRDLRAANILV+ +L  K+ADFGLAR+ +D  Y A  G KFPIKWTAPEA     FS+KSDVWSFG+L+ E+VT+GR PYPG+ N +V+  + +GYR+P P      CP ELY+I  +CW   PE RPTF +LQ + E +    E QY
Sbjct:   68 VVALYDYDPIHADDLCFRRGDQLVIVEEGND-WWKARSVATKKEGYIPSNFVAKVNSIEKEEWFFKGLSRKDAERQLLLCGNKIGSYLIRDSETNKGSYSLSVRDHIVEVGD--TVKHYKIRTLDKG-GYFITSRITFHTLQELVVYYHLKADGLCQKLGKPCIAIQPQK---PWEKDAWEIPRESIKLEKKLGAGQFGDVWMGVYNKKTKVAVKMMKPGSMAPQAFLEEANLMKTLQHDKLVRLHAVVT---DEPIFIVTEYMEKGSLLDFLKTSEGSRLKQPKMIDMCAQVAEGMAFIEDKNYIHRDLRAANILVNVNLVCKIADFGLARIIEDNEYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEMVTFGRIPYPGMTNPEVIRSLERGYRMPKPDN----CPCELYSIMQECWRQKPEERPTFEYLQSLLEDFYTATELQY 507          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006670.1 (pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene:ENSPMAG00000006016.1 transcript:ENSPMAT00000006670.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 358.992 bits (920), Expect = 1.122e-118
Identity = 178/369 (48.24%), Postives = 245/369 (66.40%), Query Frame = 2
Query:  521 KLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ------FKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARV----TDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQ 1594
            +L++ GN  G++++R    S H Y+LSVR  DT      VKHYKIR L+    F+I+ R++F  +  L++ Y  + +GLC  L   C ++  P  +          E+ R  ++L + LG G FGEV+ G WN +  VA+K LK  +MDR  F+ EA+LM +L HP+++Q+  VCTQ  E+P++IITELM+NG+L NYL++PEG+ L L E++DM +Q+A GMAYLE++N++HRDL A NILV E  + KVADFGLARV     +D Y A  G+KFPIKWTAPEA    RFS+KSDVWSFGVL++EI+TYG+ PYPG  N +VL  V +GYR+P P G    CP   Y + L+CW+   + RPTF  LQ
Sbjct:    9 QLMKSGNVHGSFLVRQSETSGHGYSLSVRDGDT------VKHYKIRVLEKG-SFFITRRNQFATLRDLVQSYSRDANGLCVTLNQPCLKKEMPQTEGLSSDMADKWEIPRSSVQLVKRLGAGQFGEVWQGLWNKTTPVAIKTLKQGTMDRDDFLREAQLMKRLRHPKLIQLYAVCTQ--EEPIYIITELMSNGSLANYLQTPEGRSLDLVELVDMAAQVAAGMAYLEAQNYIHRDLAARNILVAEHNACKVADFGLARVIKMSNEDEYEARVGSKFPIKWTAPEAANYNRFSIKSDVWSFGVLLHEIITYGKLPYPGQTNAEVLAAVDRGYRMPCPPG----CPQAFYDLMLECWNVDDQARPTFETLQ 364          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 103.99 bits (258), Expect = 2.148e-23
Identity = 86/265 (32.45%), Postives = 131/265 (49.43%), Query Frame = 2
Query:  842 LERVLGNGSFGEVY--LGKWNNSVEVAVKQLK-PNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYL-RSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINA 1624
            L++V+G GS+G VY  + K  + V VA+K++   N  + +  +AE  L+  LNH  IV+  G   +  E  ++I+ E  ANG+L   + RS  G  L  NE    ++Q   G+ YL     +HRD++AANIL+  D +VK+ADFG++ + +       GT   + W APE    R  S  SD+WS G  + E++T    PY  + +  +   V      P P+       D L     KC+      RPT   L    +H  IN+
Sbjct:   27 LKQVIGRGSYGVVYKAINKHTDQV-VAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYE--LYILLEYCANGSLRRLISRSSTG--LSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGT---LNWMAPEILGNRGASTLSDIWSLGATVVEMLT-KNPPYHNLTDANIYYAVENDTYYP-PSSFSEPLKDFLS----KCFVKNMYKRPTADQL---LKHVWINS 274          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 100.908 bits (250), Expect = 2.782e-23
Identity = 68/221 (30.77%), Postives = 120/221 (54.30%), Query Frame = 2
Query:  791 KPPIQFKDI--EVSRDCIRLERVLGNGSFGEVYLGKWN-NSVEVAVKQLKPNSMDRSRFIA----EAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPY 1432
            KP +Q++D   + S    ++ R LG GSFG V+L + N N    A+K LK +++ + + +     E  ++  ++HP I+++ G  T    Q VF++ + +  G L + LR  + Q+          +++   + YL S++ ++RDL+  NIL+D++  +K+ DFG A+   DV     GT     + APE    + ++   D WSFGVL+YE++  G TP+
Sbjct:   71 KPMLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPFIIRMWG--TFQDSQQVFMVMDYIEGGELFSLLR--KSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTP---DYIAPEVVSTKPYNKSVDWWSFGVLIYEMLA-GYTPF 283          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 103.219 bits (256), Expect = 4.771e-23
Identity = 79/268 (29.48%), Postives = 138/268 (51.49%), Query Frame = 2
Query:  851 VLGNGSFGEVYLGKWNNSVEV-AVKQLK-PNSMDRSRFI--------AEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEML--DMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVY-NADTGTKFPIKWTAPE-AGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKL-------KCWDAYPENRPTFSHL 1591
            ++G GSFG VYL     + E+ AVKQ++ P    ++  I        +E   +  L+H  IVQ LG   +     +F+  E +A G++ + +R       R +E L   + +Q+ +G+AYL S+  +HRD++A N+L+D+D   K++DFG++R + D+Y N+D   +  + W APE    ++ +S K D+WS G ++ E+   G+ P+        L+ V+  +++        +  D L  I          C++  PE RPT + L
Sbjct: 1180 MIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFL--EYVAGGSVGSLIR----MYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRKSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSN------LEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANEL 1434          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 88.5817 bits (218), Expect = 1.113e-19
Identity = 71/230 (30.87%), Postives = 116/230 (50.43%), Query Frame = 2
Query:  839 RLERVLGNGSFGEVYLG-KWNNSVEVAVKQLKPNSMDR--SRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRS------PEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGM-QRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPA 1498
            +LE+ LGNG++  VY G      V VA+K++K +S +   S  I E  LM +L H  IV++  V     E  + ++ E M N  L  Y+ S      P G  L LN +     Q+ +G+A+      +HRDL+  N+L+++   +K+ DFGLAR      N  +     + + AP+  M  R +S   D+WS G ++ E++T G+  +PG  + + L  +      PN +
Sbjct:    9 QLEK-LGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHT--ENKLTLVFEFMDND-LKKYMDSRTVGNTPRG--LELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMIT-GKPLFPGTNDEEQLKLIFDIMGTPNES 231          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 88.9669 bits (219), Expect = 2.055e-19
Identity = 61/200 (30.50%), Postives = 105/200 (52.50%), Query Frame = 2
Query:  848 RVLGNGSFGEVYLGK-WNNSVEVAVKQLKPNSMDRSRFIA----EAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPY 1432
            R LG GSFG V+L +  +N    A+K LK   + R + +     E  ++  + HP I+++ G       Q +F+I + +  G L + LR  + Q+          +++   + YL S++ ++RDL+  NIL+D++  +K+ DFG A+   DV     GT     + APE    + ++   D WSFG+L+YE++  G TP+
Sbjct:   91 RTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDA--QQIFMIMDYIEGGELFSLLR--KSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTYTLCGTP---DYIAPEVVSTKPYNKSIDWWSFGILIYEMLA-GYTPF 282          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 264.618 bits (675), Expect = 1.925e-83
Identity = 134/290 (46.21%), Postives = 185/290 (63.79%), Query Frame = 2
Query:  818 EVSRDCIRLERVLGNGSFGEVYLGKWNN-SVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQD----IFEHWEINAESQYFS*FSIVLFFH 1669
            E+ R  I ++  LG G +GEVY G W   +  VAVK L+  +M+   F+ EA +M  + H  +VQ+LGVCT+ P  P +IITE M NG LL+YLRSP+G+ L    ++ M +Q+   M+YLES NF+HRDL A N LV ++  VKVADFGL+R V++D+Y A  G KFPIKWTAPEA     FS+KSDVW+FG+L++E+ TYG +PYPGI   QV D++  GYR+P P G    CP E+Y++   CW   P +RP+F  + +    +F    +N E  Y S   +  + H
Sbjct:    8 EIERTEIAMKHKLGGGQYGEVYEGTWKKYNKTVAVKTLREETMEVEEFLKEASVMKGIKHQNLVQLLGVCTREP--PFYIITEFMMNGNLLDYLRSPKGKDLDAVTLMYMATQVGSAMSYLESMNFIHRDLAARNCLVGDNNLVKVADFGLSRLVSEDIYTAHQGAKFPIKWTAPEALAHNTFSIKSDVWAFGILLWELATYGMSPYPGIDLSQVYDKLDGGYRMPCPEG----CPPEVYSLMQTCWCWDPNSRPSFKEIHEKLNTMFPSSNVN-EGVYISYIKVYFYIH 290          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO49804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY7])

HSP 1 Score: 219.935 bits (559), Expect = 2.011e-67
Identity = 109/221 (49.32%), Postives = 143/221 (64.71%), Query Frame = 2
Query:  893 WNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCW 1552
            W  ++ VAVK +K  +M    FI EA++M +  H  +VQ+ G+C+   E+P++II ELM  G LL+YLR  +  KL+  EM +M+ Q+A  M YLES NF+HRDL A N L+ E+ +VKVADFGLAR V DD Y A  GTKFPIKW APE  +  +FS KSDVW+FG+L +E+ T G+ PYP   N  V+  V  GYRL  P    + CPD  Y+   KCW
Sbjct:    2 WRGTIPVAVKMMKDGAMSEEDFIEEAKVMKQFQHGNLVQLYGICS---EKPIYIIQELMKGGCLLHYLRKSQF-KLQSAEMTEMVRQVAAAMKYLESHNFIHRDLAARNCLIGENRTVKVADFGLARYVIDDEYTASEGTKFPIKWAAPEVILYSKFSSKSDVWAFGILAWEVYTGGKQPYPATNNTDVVQMVINGYRLEKP----LRCPDAAYSTMRKCW 214          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO40994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K8])

HSP 1 Score: 216.083 bits (549), Expect = 1.768e-63
Identity = 112/262 (42.75%), Postives = 163/262 (62.21%), Query Frame = 2
Query:  818 EVSRDCIRLERVLGNGSFGEVYLGKWN----NSVEVAVKQLKPNSMDRSR--FIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFS 1585
            E+ +  ++LE+V+G G FG+VY G       N++ VA+K LK  S  ++R  F++EA +M +   P ++ + GV ++    P+ I+TE M+NG+L N+L+  +  KL L +++ M   IA GM YL   NFVHRDL A NILV E L  KVADFGL+R  +D     +G K P++WTAPEA   R+FS  SDVWS+G+L++E  ++   PY    N +V+D V  GYRLP P    + CP  ++ I L+CWDA    RP+F+
Sbjct:   52 ELDKRWLKLEKVIGGGEFGDVYKGTLKRPGENTIPVAIKTLKQGSTSKNRGDFLSEASVMGQFCDPNVIFLEGVVSKT--HPLMIVTEFMSNGSLDNFLKKMD-SKLSLIQLMGMARGIASGMKYLSEMNFVHRDLAARNILVTETLVCKVADFGLSRELEDSAYETSGGKIPVRWTAPEAIKYRKFSTSSDVWSYGILLWETFSFAERPYWDWSNFEVMDRVETGYRLPPP----MSCPKVIHQIMLECWDADRTKRPSFA 306          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 215.312 bits (547), Expect = 1.973e-63
Identity = 114/276 (41.30%), Postives = 171/276 (61.96%), Query Frame = 2
Query:  818 EVSRDCIRLERVLGNGSFGEVYLGKWNN----SVEVAVKQLKPNSMDRSR--FIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADT------GTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEH 1609
            E+++D ++LE ++G G F +VY G   N      +VAVK LKP S  ++R  F  EA +M + +HP ++ + GV T+   +P+ IITE + NG+L N+L+S +G+   L +++ +   +A GMAYL   NF+HRDL A NILV ++L+ KV+DFGL+R  DD    +       G K P++WTAPEA   R+FS  SDVWS+G+L++EI+++G  PY    N QV+D V  GYRLP P    + CP  ++ + L CWD    +RP F+ +   F+ 
Sbjct:   21 EINKDDLKLEIIIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRT--RPMMIITEFLENGSLDNFLKSNDGRLTTL-QLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAP----MKCPKVIHNLMLDCWDKEKTSRPKFADIVRRFDE 289          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO33732 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD3])

HSP 1 Score: 196.823 bits (499), Expect = 2.890e-58
Identity = 105/238 (44.12%), Postives = 153/238 (64.29%), Query Frame = 2
Query:  818 EVSRDCIRLERVLGNGSFGEVYLGKWNN----SVEVAVKQLKPNSMDRSR--FIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADT------GTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNP 1495
            E+++D ++LE V+G G F +VY G   N      +VAVK LKP S  ++R  F  EA +M + +HP ++ + GV T+   +P+ IITE + NG+L N+L+S +G +L   +++ +   +A GMAYL   NF+HRDL A NILV ++L+ KV+DFGL+R  DD    +       G K P++WTAPEA   R+FS  SDVWS+G+L++EI+++G  PY    N QV+D V  GYRLP P
Sbjct:   22 EINKDDLKLEIVIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRT--RPMMIITEFLENGSLENFLKSNDG-RLTTLQLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAP 256          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: yrk (proto-oncogene tyrosine-protein kinase Yrk [Source:NCBI gene;Acc:101155365])

HSP 1 Score: 424.091 bits (1089), Expect = 2.599e-141
Identity = 214/454 (47.14%), Postives = 303/454 (66.74%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSC----PQRHKPPIQFKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            AL+ Y+AR  DDL F KG+   I ++    WW A    T K+GYIPSNYV   D   +  E WY   +  K+A+++LL  GNP GT++IR    +K  Y+LS+R +D TK  +V KHYKIR LDN  G+YI+ RS+F  +  L+++Y     GLCC+L  SC    P+     ++ KD+ E+ R+ ++L + LGNG FGEV++G WN + +VAVK LKP +M    F+ EA++M +L H ++VQ+  V +   E+P++IITE M+ G+LL++L+  EGQ L+L +++DM +QIA GMAY+E  N++HRDLRAANILV ++L  K+ADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E++T GR PYPG+ NR+VL++V +GYR+P   G    CP  L+ + L+CW   P+ R TF +LQ   E +    E QY
Sbjct:   81 ALYDYDARTEDDLTFQKGEKFQIINNTEGDWWEARSLDTGKSGYIPSNYVAPIDSIQA--EEWYFGKMGRKDAERQLLGQGNPRGTFLIRESETTKGAYSLSIRDWDDTKGDHV-KHYKIRKLDNG-GYYITTRSQFDTVQQLVEHYTERAAGLCCRLIGSCKRGMPKLADLSVKTKDMWEIPRESLQLIKKLGNGQFGEVWMGMWNGTTKVAVKTLKPGTMSPEAFLEEAQIMKRLRHDKLVQLYAVVS---EEPIYIITEFMSEGSLLDFLKDGEGQTLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCAPG----CPASLHELMLQCWRREPDERHTFEYLQSFLEDYFTATEPQY 523          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: SRC (SRC proto-oncogene, non-receptor tyrosine kinase [Source:NCBI gene;Acc:101173856])

HSP 1 Score: 422.55 bits (1085), Expect = 1.837e-140
Identity = 218/455 (47.91%), Postives = 301/455 (66.15%), Query Frame = 2
Query:  293 TVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            T  AL+ YE+R   DL F KGD + I ++    WWLA   TT ++GYIPSNYV   D   +  E WY   IT +++++ LL + N  GT+++R    +K  Y LSV  +D  K   V KHYKIR LD+  GFYI++R++F ++  L+ +Y+ ++DGLC  LT  CP   KP  Q   +D  E+ R+ +RL+  LG G FGEV++G WN +  VA+K LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+   G+ LRL +++DM +QIA GMAY+E  N+VHRDLRAANILV ++L  KVADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFGVL+ E+ T GR PYPG+ NR+VLD+V +GYR+P PA     CP  L+ + L CW   PE RPTF +LQ   E +  + E QY
Sbjct:   96 TFVALYDYESRTASDLTFRKGDRLQIVNNTEGDWWLARSLTTGESGYIPSNYVAPSDSIQA--EEWYFGKITRRDSERLLLNLQNRRGTFLVRESETTKGAYCLSVLDYDNAKGLNV-KHYKIRKLDSG-GFYITSRTQFTSLQQLVFHYRKHSDGLCHALTDVCPV-AKPQTQGLARDAWEIPRESLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVS---EEPIYIVTEYMSQGSLLDFLKGDTGKLLRLPQLVDMAAQIAAGMAYVEKMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPGMVNREVLDQVERGYRMPCPA----ECPSSLHELMLSCWRKDPEERPTFEYLQGFLEDYFTSTEPQY 538          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: YES1 (YES proto-oncogene 1, Src family tyrosine kinase [Source:NCBI gene;Acc:101158313])

HSP 1 Score: 421.009 bits (1081), Expect = 7.588e-140
Identity = 215/452 (47.57%), Postives = 301/452 (66.59%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSKH-YALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQ--FKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            AL+ YEAR +DDL F KGD   I ++    WW A   TT K GYIPSNYV   D   +  E WY   +  K+A++ LL  GN  GT+++R    +K  Y+LS+R +D+ K   V KHYKIR LDN  G+YI+ R++F  +  L+K+Y  + DGLC +LT  CP   KP  Q   KD  E+SR+ ++LE  LG G FGEV++G WN + +VA+K LKP +M    F+ EA++M KL H ++V +  V +   E+P++I+TE M+ G+LL++L+  EG+ L L  ++DM ++IA+GMA++E  N++HRDLRAANILV ++L  K+ADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E+VT GR PYPG+ NR+VL++V +GYR+P P G    CP+ L+ +   CW   P+ RPTF +LQ   E +  + E QY
Sbjct:  105 ALYDYEARTSDDLTFKKGDRFQIINNTEGDWWEARSITTGKKGYIPSNYVAPADSIQA--EEWYFGKMGRKDAERLLLNPGNDRGTFLVRESETTKGAYSLSIRDWDSAKGDNV-KHYKIRKLDNG-GYYITTRAQFDTLQKLVKHYTEHADGLCHRLTTVCPTV-KPQTQGLAKDAWEISRESLQLELKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMSPEAFLQEAQIMKKLRHDKLVPLFAVVS---EEPIYIVTEYMSKGSLLDFLKEGEGKFLNLVMLVDMAAKIADGMAFIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQG----CPESLHEMMKLCWKKEPDERPTFEYLQSFLEDYFTSTEPQY 544          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: fyna (tyrosine-protein kinase fyna [Source:NCBI gene;Acc:101157019])

HSP 1 Score: 417.927 bits (1073), Expect = 9.230e-139
Identity = 209/454 (46.04%), Postives = 298/454 (65.64%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSC----PQRHKPPIQFKDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            AL+ YEAR  DDL F KG+   I +     WW A   TT  TGYIPSNYV   D   +  E WY   +  K+A+++LL  GN  GT++IR    +K  Y+LS++ +D  K  +V KHYKIR LDN  G+YI+ R++F  +  L+++Y     GLCC+L   C    P+     ++ KD+ E+ R+ ++L + LGNG FGEV++G WN + +VAVK LKP +M    F+ EA++M KL H ++VQ+  V +   E+P++I+TE M+ G+LL++L+  EG+ L+L  ++DM +Q+A GMAY+E  N++HRDLR+ANILV + L  K+ADFGLAR + D+ Y A  G KFPIKWTAPEA +  +F++KSDVWSFG+L+ E+VT GR PYPG+ NR+VL++V +GYR+P P      CP  L+ + ++CW   PE RPTF +LQ   E +    E QY
Sbjct:   89 ALYDYEARTEDDLSFRKGERFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSIQA--EDWYFGKLGRKDAERQLLSSGNARGTFLIRESETTKGAYSLSIQDWDDIKGDHV-KHYKIRKLDNG-GYYITTRAQFETLQQLVQHYSARAAGLCCRLIAPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVS---EEPIYIVTEYMSKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDGLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQD----CPTSLHELMVQCWKKDPEERPTFEYLQAFLEDYFTATEPQY 531          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: yrk (proto-oncogene tyrosine-protein kinase Yrk [Source:NCBI gene;Acc:101155365])

HSP 1 Score: 417.542 bits (1072), Expect = 1.023e-138
Identity = 214/453 (47.24%), Postives = 301/453 (66.45%), Query Frame = 2
Query:  302 ALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWY--DITHKEADKKLLRMGNPIGTYIIRPCSDSK-HYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQF---KDI-EVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLAR-VTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            AL+ Y+AR  DDL F KG+   I ++    WW A    T K+GYIPSNYV   D   +  E WY   +  K+A+++LL  GNP GT++IR    +K  Y+LS+R +D TK  +V KHYKIR LDN  G+YI+ RS+F  +  L+++Y  + DGLC  LT SCP  +  P+     +D  EV R+ + L++ LG G FG+V +G WN + +VAVK LKP +M    F+ EA++M +L H ++VQ+  V +   E+P++IITE M+ G+LL++L+  EGQ L+L +++DM +QIA GMAY+E  N++HRDLRAANILV ++L  K+ADFGLAR + D+ Y A  G KFPIKWTAPEA +  RF++KSDVWSFG+L+ E++T GR PYPG+ NR+VL++V +GYR+P   G    CP  L+ + L+CW   P+ R TF +LQ   E +    E QY
Sbjct:   81 ALYDYDARTEDDLTFQKGEKFQIINNTEGDWWEARSLDTGKSGYIPSNYVAPIDSIQA--EEWYFGKMGRKDAERQLLGQGNPRGTFLIRESETTKGAYSLSIRDWDDTKGDHV-KHYKIRKLDNG-GYYITTRSQFDTVQQLVEHYTGSNDGLCYYLTKSCP--NSVPLTMGLARDAWEVPRETLTLQKKLGQGCFGDVCMGMWNGTTKVAVKTLKPGTMSPEAFLEEAQIMKRLRHDKLVQLYAVVS---EEPIYIITEFMSEGSLLDFLKDGEGQTLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCAPG----CPASLHELMLQCWRREPDERHTFEYLQSFLEDYFTATEPQY 520          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000045588.1 (SMESG000045588.1)

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 517/517 (100.00%), Postives = 517/517 (100.00%), Query Frame = 2
Query:   92 MGNCLSIENNQKQQYPKPSNREKSYNFEVTNISQNNSETQQMXXXXXXXXXXXXXXXXXXVMYNQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYFS 1642
            MGNCLSIENNQKQQYPKPSNREKSYNFEVTNISQNNSETQQMILSPPLQQQMIPSSPIPPVMYNQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYFS
Sbjct:    1 MGNCLSIENNQKQQYPKPSNREKSYNFEVTNISQNNSETQQMILSPPLQQQMIPSSPIPPVMYNQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYFS 517          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000029204.1 (SMESG000029204.1)

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 517/517 (100.00%), Postives = 517/517 (100.00%), Query Frame = 2
Query:   92 MGNCLSIENNQKQQYPKPSNREKSYNFEVTNISQNNSETQQMXXXXXXXXXXXXXXXXXXVMYNQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYFS 1642
            MGNCLSIENNQKQQYPKPSNREKSYNFEVTNISQNNSETQQMILSPPLQQQMIPSSPIPPVMYNQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYFS
Sbjct:    1 MGNCLSIENNQKQQYPKPSNREKSYNFEVTNISQNNSETQQMILSPPLQQQMIPSSPIPPVMYNQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQYFS 517          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000060646.1 (SMESG000060646.1)

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 307/447 (68.68%), Postives = 366/447 (81.88%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            VRAL++Y   +  DL F KGD+M +SSD++E WW A H    +TGYIPSNYV +DDG+P+SHE W+DI H EAD+KLL MGNP GTYIIRP SDS++ ALS+RHFD  +N+YVVKHYKIRTLDN  G+YIS+R+ FP+I +LI +Y  +TDGLCC+LT   P++HKPP QF++IEV+R CI L R LGNGSFGEV+LGKWN+ +EVAVK ++PN MD   F+ EA+LMHKL+HPRIVQILGVCT+P   P++IITELMA GALLN+LR  EGQKL L +ML M+SQIAEGMAYLES+ FVHRDLRAANILV +DLSVKVADFGLAR+T+D Y AD GTKFPIKWTAPEAG++R FSVKSDVWSFGVLM+EI+TYGRTPY G  N +VL+EVS+GYRLPNP GGKI CP ELY I L CWDA  E RPTFS L+D FE++ I  E QY
Sbjct:   42 VRALYNYNIHNAGDLAFCKGDIMVVSSDLNEPWWFATHQGNFQTGYIPSNYVSVDDGTPTSHEAWFDIIHSEADRKLLLMGNPKGTYIIRPSSDSRNCALSIRHFDPERNFYVVKHYKIRTLDNG-GYYISHRTPFPDIRTLIAHYTQHTDGLCCRLTEPFPRQHKPPFQFREIEVNRKCITLVRKLGNGSFGEVWLGKWNDIIEVAVKMMRPNCMDSDTFLGEAQLMHKLHHPRIVQILGVCTEPAGSPIYIITELMAKGALLNFLREEEGQKLTLQDMLLMLSQIAEGMAYLESKCFVHRDLRAANILVSDDLSVKVADFGLARITEDEYLADPGTKFPIKWTAPEAGLKRVFSVKSDVWSFGVLMFEIITYGRTPYAGFQNCKVLEEVSRGYRLPNPQGGKIKCPGELYNIMLSCWDATSEKRPTFSFLKDTFENYTIATERQY 487          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000060646.1 (SMESG000060646.1)

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 302/447 (67.56%), Postives = 366/447 (81.88%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            VRAL++Y   +  DL F KGD+M +SSD++E WW A H    +TGYIPSNYV +DDG+P+SHE W+DI H EAD+KLL MGNP GTYIIRP SDS++ ALS+RHFD  +N+YVVKHYKIRTLDN  G+YIS+R+ FP+I +LI +Y  +TDGLCC+LT   P++HKPP QF++IEV+R CI L R LGNGSFGEV+LGKWN+ +EVAVK ++PN MD   F+ EA+LMHKL+HPRIVQILGVCT+P   P++IITELMA GALLN+LR  EGQKL L +ML M+SQIAEGMAYLES+ FVHRDLRAANILV +DLSVKVADFGLAR+T+D Y AD GTKFPIKWTAPEAG++R FSVKSDVWSFGVLM+EI+TYGRTPY G PN +VL+ VS+GYRLPNP G +IVCP  LY I L CWDA  E RPTFS+++D+F+++ I  E  Y
Sbjct:   42 VRALYNYNIHNAGDLAFCKGDIMVVSSDLNEPWWFATHQGNFQTGYIPSNYVSVDDGTPTSHEAWFDIIHSEADRKLLLMGNPKGTYIIRPSSDSRNCALSIRHFDPERNFYVVKHYKIRTLDNG-GYYISHRTPFPDIRTLIAHYTQHTDGLCCRLTEPFPRQHKPPFQFREIEVNRKCITLVRKLGNGSFGEVWLGKWNDIIEVAVKMMRPNCMDSDTFLGEAQLMHKLHHPRIVQILGVCTEPAGSPIYIITELMAKGALLNFLREEEGQKLTLQDMLLMLSQIAEGMAYLESKCFVHRDLRAANILVSDDLSVKVADFGLARITEDEYLADPGTKFPIKWTAPEAGLKRVFSVKSDVWSFGVLMFEIITYGRTPYAGFPNNKVLESVSRGYRLPNPHGERIVCPRLLYNIMLSCWDAISEKRPTFSYMKDVFDNFAIANEPLY 487          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000060646.1 (SMESG000060646.1)

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 304/447 (68.01%), Postives = 370/447 (82.77%), Query Frame = 2
Query:  296 VRALFSYEARHTDDLEFSKGDLMYISSDMSEAWWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGNPIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISNRSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIRLERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLNHPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLDMMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVYNADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGIPNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHLQDIFEHWEINAESQY 1636
            VRAL++Y+ R+  DL F+KGD+++++S+M++ WW+A H+ T   GYIPSNYVV+DDGSP+S EG+++I H EADKKLL MG   GTYIIRP SDS++ ALS+RHFD  +N+YVVKHYKIRTLDN  G+YIS+R+ FP+I +LI +Y  +TDGLCC+LT   P++HKPP QF++IEV+R CI L R LGNGSFGEV+LGKWN+ +EVAVK ++PN MD   F+ EA+LMHKL+HPRIVQILGVCT+P   P++IITELMA GALLN+LR  EGQKL L +ML M+SQIAEGMAYLES+ FVHRDLRAANILV +DLSVKVADFGLAR+T+D Y AD GTKFPIKWTAPEAG++R FSVKSDVWSFGVLM+EI+TYGRTPY G  N +VL+EVS+GYRLPNP GGKI CP ELY I L CWDA  E RPTFS L+D FE++ I  E QY
Sbjct:   30 VRALYTYDIRNPGDLSFAKGDILFVTSNMNDPWWVARHSRTDAVGYIPSNYVVVDDGSPTSIEGFFEINHIEADKKLLLMGYSPGTYIIRPSSDSRNCALSIRHFDPERNFYVVKHYKIRTLDNG-GYYISHRTPFPDIRTLIAHYTQHTDGLCCRLTEPFPRQHKPPFQFREIEVNRKCITLVRKLGNGSFGEVWLGKWNDIIEVAVKMMRPNCMDSDTFLGEAQLMHKLHHPRIVQILGVCTEPAGSPIYIITELMAKGALLNFLREEEGQKLTLQDMLLMLSQIAEGMAYLESKCFVHRDLRAANILVSDDLSVKVADFGLARITEDEYLADPGTKFPIKWTAPEAGLKRVFSVKSDVWSFGVLMFEIITYGRTPYAGFQNCKVLEEVSRGYRLPNPQGGKIKCPGELYNIMLSCWDATSEKRPTFSFLKDTFENYTIATERQY 475          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SRC9.685e-14448.57SRC proto-oncogene, non-receptor tyrosine kinase [... [more]
SRC9.685e-14448.57SRC proto-oncogene, non-receptor tyrosine kinase [... [more]
SRC9.685e-14448.57SRC proto-oncogene, non-receptor tyrosine kinase [... [more]
SRC1.032e-14148.37SRC proto-oncogene, non-receptor tyrosine kinase [... [more]
HCK1.117e-14047.78HCK proto-oncogene, Src family tyrosine kinase [So... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
src-17.118e-13444.11Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-12.429e-13344.11Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-12.429e-13344.11Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-12.666e-13344.11Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-12.666e-13344.11Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Src42A7.230e-12946.07gene:FBgn0264959 transcript:FBtr0335275[more]
Src64B6.108e-12742.14gene:FBgn0262733 transcript:FBtr0100508[more]
Src64B6.108e-12742.14gene:FBgn0262733 transcript:FBtr0100505[more]
Src64B6.108e-12742.14gene:FBgn0262733 transcript:FBtr0100504[more]
Src64B6.108e-12742.14gene:FBgn0262733 transcript:FBtr0304990[more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lyn1.062e-14449.24LYN proto-oncogene, Src family tyrosine kinase [So... [more]
src8.394e-14348.35v-src avian sarcoma (Schmidt-Ruppin A-2) viral onc... [more]
src8.394e-14348.35v-src avian sarcoma (Schmidt-Ruppin A-2) viral onc... [more]
fyna3.077e-14146.92FYN proto-oncogene, Src family tyrosine kinase a [... [more]
src3.188e-14047.72v-src avian sarcoma (Schmidt-Ruppin A-2) viral onc... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cthrc17.991e-14448.35collagen triple helix repeat containing 1 [Source:... [more]
cthrc19.032e-14448.35collagen triple helix repeat containing 1 [Source:... [more]
cthrc11.015e-14348.35collagen triple helix repeat containing 1 [Source:... [more]
cthrc12.274e-14348.35collagen triple helix repeat containing 1 [Source:... [more]
cthrc12.296e-14348.35collagen triple helix repeat containing 1 [Source:... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Src2.301e-14348.57Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:9... [more]
Src2.301e-14348.57Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:9... [more]
Src2.301e-14348.57Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:9... [more]
Src2.347e-14148.37Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:9... [more]
Src2.347e-14148.37Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P42687|SPK1_GIRTI4.597e-14347.50Tyrosine-protein kinase SPK-1 OS=Girardia tigrina ... [more]
sp|P12931|SRC_HUMAN4.651e-14348.57Proto-oncogene tyrosine-protein kinase Src OS=Homo... [more]
sp|P13116|SRC2_XENLA4.914e-14348.35Tyrosine-protein kinase Src-2 OS=Xenopus laevis OX... [more]
sp|P00523|SRC_CHICK1.092e-14248.79Proto-oncogene tyrosine-protein kinase Src OS=Gall... [more]
sp|Q9WUD9|SRC_RAT1.792e-14248.57Proto-oncogene tyrosine-protein kinase Src OS=Ratt... [more]
back to top
BLAST of Tyrosine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YFZ50.000e+063.39Tyrosine-protein kinase OS=Clonorchis sinensis OX=... [more]
A0A4S2LUM50.000e+063.39Tyrosine-protein kinase OS=Opisthorchis felineus O... [more]
A0A074ZSJ90.000e+063.39Tyrosine-protein kinase OS=Opisthorchis viverrini ... [more]
C1LGZ60.000e+062.50Tyrosine-protein kinase OS=Schistosoma japonicum O... [more]
A0A094ZT020.000e+062.28Tyrosine-protein kinase OS=Schistosoma haematobium... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fyna1.579e-14046.70tyrosine-protein kinase fyna [Source:NCBI gene;Acc... [more]
src4.821e-14047.62proto-oncogene tyrosine-protein kinase Src [Source... [more]
src2.568e-13947.94proto-oncogene tyrosine-protein kinase Src [Source... [more]
clul17.516e-13947.35tyrosine-protein kinase yes [Source:NCBI gene;Acc:... [more]
SRC1.098e-13846.75proto-oncogene tyrosine-protein kinase Src-like [S... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hck1.828e-14247.33HCK proto-oncogene, Src family tyrosine kinase [So... [more]
clul11.007e-14147.17clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GE... [more]
frk5.073e-13246.12fyn-related Src family tyrosine kinase [Source:ZFI... [more]
hck1.641e-13145.59HCK proto-oncogene, Src family tyrosine kinase [So... [more]
ENSPMAT00000006670.11.122e-11848.24pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC152.148e-2332.45Protein kinase of the Mitotic Exit Network; locali... [more]
TPK32.782e-2330.77cAMP-dependent protein kinase catalytic subunit; p... [more]
BCK14.771e-2329.48MAPKKK acting in the protein kinase C signaling pa... [more]
PHO851.113e-1930.87Cyclin-dependent kinase; has ten cyclin partners; ... [more]
TPK12.055e-1930.50cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471951.925e-8346.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498042.011e-6749.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409941.768e-6342.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337361.973e-6341.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337322.890e-5844.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yrk2.599e-14147.14proto-oncogene tyrosine-protein kinase Yrk [Source... [more]
SRC1.837e-14047.91SRC proto-oncogene, non-receptor tyrosine kinase [... [more]
YES17.588e-14047.57YES proto-oncogene 1, Src family tyrosine kinase [... [more]
fyna9.230e-13946.04tyrosine-protein kinase fyna [Source:NCBI gene;Acc... [more]
yrk1.023e-13847.24proto-oncogene tyrosine-protein kinase Yrk [Source... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045588.10.000e+0100.00SMESG000045588.1[more]
SMESG000029204.10.000e+0100.00SMESG000029204.1[more]
SMESG000060646.10.000e+068.68SMESG000060646.1[more]
SMESG000060646.10.000e+067.56SMESG000060646.1[more]
SMESG000060646.10.000e+068.01SMESG000060646.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026402 ID=SMED30026402|Name=Tyrosine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2044bp
TTTGGAAATAAACTTTAAGTTTGAGTGAAAGTTAAATAAGAAATATTTGT
TTATTAAATAAATGAAAAACTTTCATAATTATTTTTGAAAGATGGGTAAC
TGCTTGTCAATTGAAAACAACCAGAAACAACAATATCCAAAACCAAGTAA
CAGAGAAAAAAGTTATAATTTTGAAGTAACTAATATTTCCCAAAATAATT
CTGAAACACAACAAATGATTCTTTCTCCTCCTTTACAACAACAAATGATT
CCTTCATCTCCAATACCTCCAGTCATGTATAATCAGAGACCAACTGTTAG
AGCATTATTTTCTTACGAAGCTCGTCACACAGATGATTTGGAATTTAGTA
AAGGGGATTTAATGTATATTTCATCAGACATGTCAGAAGCTTGGTGGCTT
GCTTTACATGCAACTACTAAAAAAACTGGATATATTCCAAGTAATTATGT
CGTTCTTGATGATGGTTCACCATCTAGTCACGAAGGATGGTATGATATTA
CTCATAAAGAAGCTGATAAGAAATTATTAAGAATGGGTAACCCAATTGGT
ACATATATAATTAGACCATGTTCTGACTCTAAACATTACGCTTTATCTGT
TCGTCATTTTGATACCACTAAAAATTATTACGTTGTTAAGCATTACAAAA
TTCGAACATTAGATAATAATTTGGGATTTTATATTAGTAACAGATCGAAA
TTTCCCAATATTAGTAGCCTTATCAAATATTACCAAACTAATACCGATGG
ATTGTGCTGCAAATTAACACTGTCCTGTCCTCAGAGGCACAAACCTCCGA
TTCAATTTAAAGATATTGAAGTTAGTCGAGATTGTATTCGTTTGGAAAGA
GTTTTGGGAAATGGAAGCTTTGGAGAAGTTTACCTTGGTAAATGGAATAA
TTCTGTCGAGGTTGCCGTTAAACAATTGAAGCCAAATTCTATGGATAGGA
GTCGGTTTATAGCTGAAGCTGAACTGATGCATAAATTGAATCATCCGAGA
ATCGTACAAATTCTCGGAGTTTGTACACAACCCCCAGAGCAGCCAGTTTT
TATTATCACCGAATTAATGGCTAACGGAGCACTTCTGAATTATTTGCGCA
GTCCAGAAGGCCAAAAATTGAGACTAAATGAAATGCTTGACATGATGTCC
CAAATTGCCGAAGGAATGGCATATCTTGAATCGAGAAATTTCGTTCATCG
TGACTTGCGCGCTGCCAATATTTTGGTTGATGAAGATCTTTCAGTGAAAG
TTGCGGATTTCGGATTGGCCAGAGTCACTGATGACGTGTATAACGCTGAC
ACAGGTACTAAATTCCCCATCAAATGGACTGCGCCAGAAGCCGGAATGCA
GCGGAGATTCAGTGTCAAATCCGACGTCTGGTCGTTCGGGGTGTTGATGT
ATGAGATCGTAACATACGGCAGAACTCCCTATCCAGGAATTCCCAATCGG
CAGGTGTTGGACGAGGTCAGCAAAGGCTATCGATTACCGAATCCGGCCGG
TGGAAAGATTGTTTGTCCCGATGAGTTGTATGCAATAAAATTGAAATGCT
GGGACGCCTATCCGGAAAACAGGCCGACCTTCAGTCATTTACAAGATATT
TTTGAGCACTGGGAAATCAATGCAGAGTCTCAATATTTCAGTTGATTTTC
AATTGTTTTGTTTTTTCATTGGTTGATCGCAGCAGCCAATTTGTCATATA
GATCTTCAAGAAAATTTTTTTTCACGTTCGATTTTTTGTTAATTTGCATT
TTTTTAAATATCATGTATTTTTCAATAATTTACTAGCAGTCGATTGGTCT
CCTTTTGCATATTGCCAACAGCCAATAGAAATGCAGGATAATTATTTTAA
TTGGTGTATATAGTTCGACGATAATAGTAATATTAATGATGCTAAAGAAG
CTCAAGATAAGATAAATTATTTTAACATTACAAAATTGTAAAGCAATAAT
TGAACGTTTGATAAAATATATATTACGTAACTTTTTATTGATTTATAATT
TTTTCGTTTATGTTCCCCATTTTGATTTTACTACTATATTTGAT
back to top

protein sequence of SMED30026402-orf-1

>SMED30026402-orf-1 ID=SMED30026402-orf-1|Name=SMED30026402-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=518bp
MGNCLSIENNQKQQYPKPSNREKSYNFEVTNISQNNSETQQMILSPPLQQ
QMIPSSPIPPVMYNQRPTVRALFSYEARHTDDLEFSKGDLMYISSDMSEA
WWLALHATTKKTGYIPSNYVVLDDGSPSSHEGWYDITHKEADKKLLRMGN
PIGTYIIRPCSDSKHYALSVRHFDTTKNYYVVKHYKIRTLDNNLGFYISN
RSKFPNISSLIKYYQTNTDGLCCKLTLSCPQRHKPPIQFKDIEVSRDCIR
LERVLGNGSFGEVYLGKWNNSVEVAVKQLKPNSMDRSRFIAEAELMHKLN
HPRIVQILGVCTQPPEQPVFIITELMANGALLNYLRSPEGQKLRLNEMLD
MMSQIAEGMAYLESRNFVHRDLRAANILVDEDLSVKVADFGLARVTDDVY
NADTGTKFPIKWTAPEAGMQRRFSVKSDVWSFGVLMYEIVTYGRTPYPGI
PNRQVLDEVSKGYRLPNPAGGKIVCPDELYAIKLKCWDAYPENRPTFSHL
QDIFEHWEINAESQYFS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR036028SH3-like_dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR001452SH3_domain
IPR000980SH2
IPR020635Tyr_kinase_cat_dom
IPR008266Tyr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 81..96
score: 31.71
coord: 111..123
score: 46.57
coord: 67..77
score: 40.18
IPR001452SH3 domainSMARTSM00326SH3_2coord: 67..124
e-value: 5.1E-17
score: 72.5
IPR001452SH3 domainPFAMPF00018SH3_1coord: 70..117
e-value: 1.0E-11
score: 44.3
IPR001452SH3 domainPROSITEPS50002SH3coord: 64..125
score: 24.956
IPR000980SH2 domainPRINTSPR00401SH2DOMAINcoord: 152..162
score: 26.49
coord: 181..191
score: 55.22
coord: 163..174
score: 36.27
coord: 203..217
score: 26.21
IPR000980SH2 domainSMARTSM00252SH2_5coord: 131..220
e-value: 8.5E-20
score: 81.8
IPR000980SH2 domainPFAMPF00017SH2coord: 135..214
e-value: 3.5E-13
score: 49.4
IPR000980SH2 domainPROSITEPS50001SH2coord: 136..229
score: 16.158
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 361..379
score: 64.6
coord: 427..449
score: 65.01
coord: 323..336
score: 49.73
coord: 408..418
score: 66.01
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 250..502
e-value: 1.8E-89
score: 299.5
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 249..504
e-value: 1.2E-123
score: 426.7
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 126..240
e-value: 6.9E-24
score: 86.0
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 101..230
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 337..516
e-value: 1.2E-48
score: 163.6
coord: 239..341
e-value: 3.0E-14
score: 49.8
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 242..508
e-value: 5.0E-88
score: 296.6
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 62..124
e-value: 1.2E-18
score: 68.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..21
NoneNo IPR availablePANTHERPTHR24418:SF402TYROSINE PROTEIN-KINASE SRC-1coord: 64..515
NoneNo IPR availablePANTHERPTHR24418TYROSINE-PROTEIN KINASEcoord: 64..515
NoneNo IPR availableCDDcd11845SH3_Src_likecoord: 68..119
e-value: 4.70017E-21
score: 84.1712
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 367..379
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 255..277
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 249..509
score: 43.566
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 236..511
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 43..124