GCR008

Overview
NameGCR008
Smed IDSMED30026385
Length (bp)1467
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR008 (SMED30026385) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR008 (SMED30026385) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR008 (SMED30026385) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR008 (SMED30026385) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026385

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30026385SMESG000018302.1 SmedASXL_065356SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30026385SMESG000018302.1 dd_Smed_v4_22802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026385SMESG000018302.1 dd_Smed_v4_22802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026385SMESG000018302.1 dd_Smed_v4_22802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30026385SMESG000018302.1 dd_Smed_v4_22802_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30026385SMESG000018302.1 dd_Smed_v6_22802_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR008 vs. Ensembl Human
Match: ADRA1B (adrenoceptor alpha 1B [Source:HGNC Symbol;Acc:HGNC:278])

HSP 1 Score: 211.846 bits (538), Expect = 7.634e-62
Identity = 141/359 (39.28%), Postives = 185/359 (51.53%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
             I GN LVI++VA N +LRT TNYFIV+LA ADLL+   V+PF A L  LG   W+ G+I+CD+W A DVL  TASIL+LC I+I+RY      L     +T +  I+ +  VW  S  IS   ++ W++ +   D  C      +PFY   SS+ SFY PL ++LV+Y ++Y  AKR    L+ G        K L      LRIH   F                             + LS        P +S            +  KL KF+ E+KAA+TLG V+G FILCWLPFFI   L S      LF T    D +  +V WLGY NSC+NPIIY  S + F+ AF+R+L
Sbjct:   59 AIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLG--YWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVT--EEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELT-----LRIHSKNFH---------------------------EDTLSSTKAKGHNPRSS------------IAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGS------LFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRIL 363          
BLAST of GCR008 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 191.815 bits (486), Expect = 3.011e-55
Identity = 125/361 (34.63%), Postives = 196/361 (54.29%), Query Frame = 3
Query:   93 FGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLR-HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            FG + GN LVI++VA + +L + T+Y+IV+LA ADLL+   V+PF+ + E+    W FG+++C++W A DVL  TASI+ LC+I+I+RY   + PL     +T +  ++ +  VW  S  IS   +  WRQ +   +++  C+   +P Y+  S++ SFY PL ++LV+Y ++Y  AKR    L+ G +     DK+ ++  V LRIH+                                          + P   S   + K + HF++  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S       F      + +  +V WLGYLNSC+NPIIY  S + F+ AF  +L
Sbjct:   39 FG-VLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEV-LGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETI--CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKT----DKS-DSEQVTLRIHRK-----------------------------------------NAPAGGSGMASAKTKTHFSV--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGS------FFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVL 341          
BLAST of GCR008 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 191.815 bits (486), Expect = 3.255e-55
Identity = 126/361 (34.90%), Postives = 196/361 (54.29%), Query Frame = 3
Query:   93 FGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLR-HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            FG + GN LVI++VA + +L + T+Y+IV+LA ADLL+   V+PF+ + E+    W FG+++C++W A DVL  TASI+ LC+I+I+RY   + PL     +T +  ++ +  VW  S  IS   +  WRQ +   +++  C+   +P Y+  S++ SFY PL ++LV+Y ++Y  AKR    L+ G +     DK+ ++  V LRIH+                                          + P   S   + K + HF++  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S     K   T      +  +V WLGYLNSC+NPIIY  S + F+ AF  +L
Sbjct:   39 FG-VLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEV-LGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETI--CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKT----DKS-DSEQVTLRIHRK-----------------------------------------NAPAGGSGMASAKTKTHFSV--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPDFKPSET------VFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVL 341          
BLAST of GCR008 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 192.2 bits (487), Expect = 6.143e-55
Identity = 127/362 (35.08%), Postives = 197/362 (54.42%), Query Frame = 3
Query:   93 FGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNE-LGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLR-HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            FG + GN LVI++VA + +L + T+Y+IV+LA ADLL+   V+PF+ + E LG   W FG+++C++W A DVL  TASI+ LC+I+I+RY   + PL     +T +  ++ +  VW  S  IS   +  WRQ +   +++  C+   +P Y+  S++ SFY PL ++LV+Y ++Y  AKR    L+ G +     DK+ ++  V LRIH+                                          + P   S   + K + HF++  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S       F      + +  +V WLGYLNSC+NPIIY  S + F+ AF  +L
Sbjct:   39 FG-VLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLG--YWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETI--CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKT----DKS-DSEQVTLRIHRK-----------------------------------------NAPAGGSGMASAKTKTHFSV--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGS------FFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVL 341          
BLAST of GCR008 vs. Ensembl Human
Match: ADRA1A (adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC:277])

HSP 1 Score: 192.2 bits (487), Expect = 6.143e-55
Identity = 127/362 (35.08%), Postives = 197/362 (54.42%), Query Frame = 3
Query:   93 FGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNE-LGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLR-HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            FG + GN LVI++VA + +L + T+Y+IV+LA ADLL+   V+PF+ + E LG   W FG+++C++W A DVL  TASI+ LC+I+I+RY   + PL     +T +  ++ +  VW  S  IS   +  WRQ +   +++  C+   +P Y+  S++ SFY PL ++LV+Y ++Y  AKR    L+ G +     DK+ ++  V LRIH+                                          + P   S   + K + HF++  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S       F      + +  +V WLGYLNSC+NPIIY  S + F+ AF  +L
Sbjct:   39 FG-VLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLG--YWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETI--CQINEEPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKT----DKS-DSEQVTLRIHRK-----------------------------------------NAPAGGSGMASAKTKTHFSV--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGS------FFPDFKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVL 341          
BLAST of GCR008 vs. Ensembl Celegans
Match: dop-4 (Dopamine receptor 4 [Source:UniProtKB/Swiss-Prot;Acc:Q18775])

HSP 1 Score: 201.445 bits (511), Expect = 2.444e-58
Identity = 139/431 (32.25%), Postives = 207/431 (48.03%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSS-DTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVI----EDGDK----------ALNNPPVRLRIHKGG----------FRALQKPN--LYQXXXXXXXXXXXXXXPMGISEPLSCVADLC-SGPVTSSASIAFKLRHFTLG------------------------------------------KKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDN---QNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            T+ GN LV+IAV +   LR  T Y I+SLA ADL++G++VMP   L E+    W+FG + CD++HA D+L++TASI NLC+I+++RY     P+     ++ +  ++ I  VW  SA +SFP IIWWR SS   Y+    C F     Y+S SS+VSFY PL L+L  Y K+Y  A R    ++ G + +     +G K          + N P +R+   +G           F A +     L Q S               + +PL    + C S  ++ S+   F+ R+ T+G                                          ++++++  EQ+AARTL  V+G FILCW PFF+   L +       NK        + I   VTW G+LNS +NP+IY+   R FR AF ++L
Sbjct:   56 TVAGNCLVVIAVCTKKYLRNPTGYLIISLAIADLIVGVIVMPMNSLFEIANHTWLFGLMMCDVFHAMDILASTASIWNLCVISLDRYMAGQDPIGYRDKVSKRRILMAILSVWVLSAILSFPGIIWWRTSSPHLYEDQSQCLFTDSKMYVSFSSLVSFYIPLFLILFAYGKVYIIATRHSKGMRMGIKTVSIKKRNGKKSNTETESILSSENEPTLRIHFGRGKQSSSSLRNSRFHARESTRLLLKQVSCKSLNDRGEHNNNNTVRQPLLRGTEGCHSDSISRSSQRNFRGRNVTIGSNCSSTLLQVDQPDRMSLSSNSQMVMTSPLSTRRKLNVREKSRQMMRYVHEQRAARTLSIVVGAFILCWTPFFVFTPLTAFCESCFSNK--------ETIFTFVTWAGHLNSMLNPLIYSRFSRDFRRAFKQIL 478          
BLAST of GCR008 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 150.214 bits (378), Expect = 2.728e-40
Identity = 106/362 (29.28%), Postives = 180/362 (49.72%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWR--QSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCP 1178
            T+ GN+LV++AV S   L+   NYF+VSLA +DL + + VMP  ++  L    W+ G   C  +   D+L  T+SILNLC IA++RY    +P+   +  T K   I+I +VW  S  IS P II W   Q +   D   SC   T+  ++  S+  SF+ PL++M+V+Y KI+ +A++ I   +    ++   +   ++   ++ I +    + +  +              +  P+ I++  + V  L +    +  ++  K    ++ K       E++AA+T+  ++  F  CWLPFF+  ++       KL         +    TWLGY+NS +NP +Y      FR AF ++LCP
Sbjct:   71 TVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMED---SCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSS-----------RVGEKTPLVIADGQTTVTTLAAHSNPNPTAVLRKREKISVAK-------EKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLH------AKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILCP 405          
BLAST of GCR008 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 145.976 bits (367), Expect = 9.265e-39
Identity = 119/401 (29.68%), Postives = 184/401 (45.89%), Query Frame = 3
Query:   36 FGNETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLR-TCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLR-----------------IHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLV----TWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
             G   +++ S+ ++ + +    IFGN LV++ V  +  LR    N+ IVSLA AD+L+GL+VMP  +  E+  E W  G I C++W A DVL  TASIL++C I+++RY   TSPL      T     I I + W  S  I  P I  WR       +   C   TD  Y+  SS+ SFY P+V+++++Y KIY    R     Q+ ++  E  D  LN   +R                   I     + +   ++      + +  S +    G+   ++   +  S P  S  +   + + F   +K      E++A   LG ++  FIL WLPFF+  ++            G+ G    PLV     WLGY NS +NP+IY    R F+    + L
Sbjct:   18 LGEAVLTISSMLTVMLLI----IFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGE-WTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPER----AEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRH--SRQRLKET-ERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKVSIALDTNHNSPP-ASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVI------------GAFGHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQL 393          
BLAST of GCR008 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 145.591 bits (366), Expect = 1.323e-38
Identity = 121/398 (30.40%), Postives = 185/398 (46.48%), Query Frame = 3
Query:   36 FGNETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLR-TCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKG---GFRALQKPNLYQXXXXXXXXXXXXXXPM-----GISEPLS------CVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLV----TWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
             G   +++ S+ ++ + +    IFGN LV++ V  +  LR    N+ IVSLA AD+L+GL+VMP  +  E+  E W  G I C++W A DVL  TASIL++C I+++RY   TSPL      T     I I + W  S  I  P I  WR       +   C   TD  Y+  SS+ SFY P+V+++++Y KIY    R     Q+ ++  E  D  LN   +R   ++     +   +  +  ++ K K          +      ISE L        +    + P  S  +   + + F   +K      E++A   LG ++  FIL WLPFF+  ++            G+ G    PLV     WLGY NS +NP+IY    R F+    + L
Sbjct:   18 LGEAVLTISSMLTVMLLI----IFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGE-WTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRPER----AEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRH--SRQRLKET-ERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVI------------GAFGHEAPPLVFKFFFWLGYCNSGINPVIYTVFNREFKRGLCKQL 391          
BLAST of GCR008 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 142.895 bits (359), Expect = 1.651e-37
Identity = 107/365 (29.32%), Postives = 176/365 (48.22%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWR--QSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSC---VADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCP 1178
            T+ GN+LV++AV S   L+   NYF+VSLA +DL + + VMP  ++  L    W+ G   C  +   D+L  T+SILNLC IA++RY    +P+   +  T K   I+I +VW  S  IS P II W   Q +   D   SC   T+  ++  S+  SF+ PL++M+V+Y KI+ +A++ I   +    ++   +   ++   ++ I +    + +  +            +     M      SC   V D+       + +   + R      + I    E++AA+T+  ++  F  CWLPFF+  ++       KL         +    TWLGY+NS +NP +Y      FR AF ++LCP
Sbjct:   60 TVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNNWQENMMED---SCGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTKH---MKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKR------EKISVAKEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCETCKLH------AKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFKKILCP 406          
BLAST of GCR008 vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085467)

HSP 1 Score: 236.884 bits (603), Expect = 1.862e-71
Identity = 160/402 (39.80%), Postives = 214/402 (53.23%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNL------------------------YQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL---CPIYYRRMIQREINSSS 1223
            T+FGNSLVI+AV     L T TNYFI SLA AD L+GLVVMPF+ L E+ +  W FG  WCD+W + DVL +TASILNLC+I+++RY   T P      +T K    +I  VW CS+ ISFPAI+WWR + D       C F     Y+  SS +SFY PL++M+  Y +IYR A      L+ G + +      L    + LRIH+GG    Q+  +                        + +  N     +  T      EPLS + +         A      ++F+L +KL KF  E+KAA+TLG VMG FI+CWLPFF+ N+L+               + +  +VTWLG++NSCMNP+IYA   R FR AF+RLL   CP   RR  Q  + S S
Sbjct:  122 TVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAARDGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQ---LTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHN------NGLARHRHMGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGF-----CIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCCPRKIRRKYQPTMRSKS 509          
BLAST of GCR008 vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0085468)

HSP 1 Score: 236.113 bits (601), Expect = 3.232e-71
Identity = 160/402 (39.80%), Postives = 214/402 (53.23%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNL------------------------YQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL---CPIYYRRMIQREINSSS 1223
            T+FGNSLVI+AV     L T TNYFI SLA AD L+GLVVMPF+ L E+ +  W FG  WCD+W + DVL +TASILNLC+I+++RY   T P      +T K    +I  VW CS+ ISFPAI+WWR + D       C F     Y+  SS +SFY PL++M+  Y +IYR A      L+ G + +      L    + LRIH+GG    Q+  +                        + +  N     +  T      EPLS + +         A      ++F+L +KL KF  E+KAA+TLG VMG FI+CWLPFF+ N+L+               + +  +VTWLG++NSCMNP+IYA   R FR AF+RLL   CP   RR  Q  + S S
Sbjct:  122 TVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAARDGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQ---LTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHN------NGLARHRHMGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGF-----CIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCCPRKIRRKYQPTMRSKS 509          
BLAST of GCR008 vs. Ensembl Fly
Match: Dop1R2 (gene:FBgn0266137 transcript:FBtr0330293)

HSP 1 Score: 236.884 bits (603), Expect = 3.165e-69
Identity = 160/402 (39.80%), Postives = 214/402 (53.23%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNL------------------------YQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL---CPIYYRRMIQREINSSS 1223
            T+FGNSLVI+AV     L T TNYFI SLA AD L+GLVVMPF+ L E+ +  W FG  WCD+W + DVL +TASILNLC+I+++RY   T P      +T K    +I  VW CS+ ISFPAI+WWR + D       C F     Y+  SS +SFY PL++M+  Y +IYR A      L+ G + +      L    + LRIH+GG    Q+  +                        + +  N     +  T      EPLS + +         A      ++F+L +KL KF  E+KAA+TLG VMG FI+CWLPFF+ N+L+               + +  +VTWLG++NSCMNP+IYA   R FR AF+RLL   CP   RR  Q  + S S
Sbjct:  122 TVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAARDGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQ---LTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHN------NGLARHRHMGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGF-----CIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCCPRKIRRKYQPTMRSKS 509          
BLAST of GCR008 vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 180.644 bits (457), Expect = 3.891e-50
Identity = 125/380 (32.89%), Postives = 195/380 (51.32%), Query Frame = 3
Query:   51 VSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYR 1190
            ++ I ++ + + +  GT+ GN LV IAV     LR   NY +VSLA +DL + L+VMP A+L E+  E W FG + CD+W +FDVL  TASILNLC I+++RY   T PL  G   T +  ++ + +VW  +ACIS P ++      +  +    C    +  Y   +++ SFY PL +ML +Y++I+R A+R+++  ++ +  ++       +P        G        N  ++S   +   ++ T     S   +       G V+ S  +     H  L  +L K   E+KA+ TLG +M  F +CWLPFFI  ++       + F T  +   +  L  WLGY NS +NPIIYA   R FR  F  +L   Y+R
Sbjct:  160 LTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEV-LEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAK---EKKASTTLGIIMSAFTVCWLPFFILALI-------RPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEIL---YFR 525          
BLAST of GCR008 vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0085746)

HSP 1 Score: 180.644 bits (457), Expect = 3.891e-50
Identity = 125/380 (32.89%), Postives = 195/380 (51.32%), Query Frame = 3
Query:   51 VSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYR 1190
            ++ I ++ + + +  GT+ GN LV IAV     LR   NY +VSLA +DL + L+VMP A+L E+  E W FG + CD+W +FDVL  TASILNLC I+++RY   T PL  G   T +  ++ + +VW  +ACIS P ++      +  +    C    +  Y   +++ SFY PL +ML +Y++I+R A+R+++  ++ +  ++       +P        G        N  ++S   +   ++ T     S   +       G V+ S  +     H  L  +L K   E+KA+ TLG +M  F +CWLPFFI  ++       + F T  +   +  L  WLGY NS +NPIIYA   R FR  F  +L   Y+R
Sbjct:  160 LTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEV-LEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLLILGNEHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRAQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAK---EKKASTTLGIIMSAFTVCWLPFFILALI-------RPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEIL---YFR 525          
BLAST of GCR008 vs. Ensembl Zebrafish
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 214.542 bits (545), Expect = 2.154e-63
Identity = 140/375 (37.33%), Postives = 209/375 (55.73%), Query Frame = 3
Query:   75 IKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL-CPIYYRR 1193
            +  F++F  I GN LVI++V  N +LR+ TNYFIV+LA ADLL+G  V+P  A L  +G   W+FG+I+CD+W A DVL  TASI++LC+I+I+RY   + PL     +T +  ++ +  VW  S  IS   ++ W++     D+VC+     +PFY   SS+ SFY PL+++LV+Y ++Y  AKR    L+ G +      +++N+  + LRIH+G                                  S V +       +  S A + R+ +L  KL+KF+ E+KAA+TLG V+G F LCWLPFF+   + S +   +   T S       ++ WLGY NSC+NPIIY    R F++AFIR+L C  + RR
Sbjct:   54 LGFFITFA-IAGNILVILSVVCNRHLRSPTNYFIVNLAIADLLLGTTVLPVSATLEVVGH--WVFGRIFCDVWAAVDVLCCTASIMSLCVISIDRYIGVSHPLQYPNIVTGRRALLAMLGVWVLSLVISIGPLLGWKEPPSPDDTVCAIN--EEPFYALFSSLGSFYIPLIVILVMYCRVYVVAKRTTKNLEAGVKT-----ESMNSGEITLRIHRG----------------------------------SQVHE------DAGKSRAHQARN-SLTVKLLKFSREKKAAKTLGVVVGMFTLCWLPFFLTLPIVSFNTSLRPPETVS------SIIFWLGYFNSCLNPIIYPCYSREFKLAFIRILKCRCHRRR 371          
BLAST of GCR008 vs. Ensembl Zebrafish
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 211.846 bits (538), Expect = 2.403e-62
Identity = 139/375 (37.07%), Postives = 208/375 (55.47%), Query Frame = 3
Query:   75 IKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL-CPIYYRR 1193
            +  F++F  I GN LVI++V  N +LR+ TNYFIV+LA ADLL+G  V+P  A L  +G   W+FG+I+CD+W A DVL  TASI++LC+I+I+RY   + PL     +T +  ++ +  VW  S  IS   ++ W++     D+VC+     +PFY   SS+ SFY PL+++LV+Y ++Y  AK     L+ G +      +++N+  + LRIH+G                                  S V +       +  S A + R+ +L  KL+KF+ E+KAA+TLG V+G F LCWLPFF+   + S +   +   T S       ++ WLGY NSC+NPIIY    R F++AFIR+L C  + RR
Sbjct:   54 LGFFITFA-IAGNILVILSVVCNRHLRSPTNYFIVNLAIADLLLGTTVLPVSATLEVVGH--WVFGRIFCDVWAAVDVLCCTASIMSLCVISIDRYIGVSHPLQYPNIVTGRRALLAMLGVWVLSLVISIGPLLGWKEPPSPDDTVCAIN--EEPFYALFSSLGSFYIPLIVILVMYCRVYVVAKMTTKNLEAGVKT-----ESMNSGEITLRIHRG----------------------------------SQVHE------DAGKSRAHQARN-SLTVKLLKFSREKKAAKTLGVVVGMFTLCWLPFFLTLPIVSFNTSLRPPETVS------SIIFWLGYFNSCLNPIIYPCYSREFKLAFIRILKCRCHRRR 371          
BLAST of GCR008 vs. Ensembl Zebrafish
Match: adra1aa (adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-030131-2831])

HSP 1 Score: 210.305 bits (534), Expect = 9.753e-62
Identity = 135/368 (36.68%), Postives = 202/368 (54.89%), Query Frame = 3
Query:   75 IKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNE-LGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLR-HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            + +F+ FG + GN LVI++VA + NLRT T+YFIV+LA ADLL+   V+PF+ + E LG+  WIFG+ +CD+W A DVL  TASI++LC+I+++RY   + PL     +T +  ++ +  +W  S  IS   +  W++ +   +S+  CK   +P Y   S++ SFY PLV++L +Y ++Y  A+R    L  G++  E  D A     V LRIH+G                                            +T S   A + R HF L  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S      +F T    D +  +  WLGY NSC+NPIIY  S + F+ AF+ +L
Sbjct:   47 LAIFIVFG-VLGNILVILSVACHRNLRTVTHYFIVNLAVADLLLSSTVLPFSTVFEMLGR--WIFGRPFCDVWAAMDVLCCTASIMSLCVISVDRYIGVSYPLQYPSIVTERRALLALIALWVLSITISIGPLFGWKEPAPDDESI--CKITEEPGYAIFSALGSFYLPLVVILSMYCRVYVVARRETRGLISGQKT-EKSDHAET---VTLRIHRGN-------------------------------------------MTVSEDEALRNRTHFAL--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGS------IFPTYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVL 354          
BLAST of GCR008 vs. Ensembl Zebrafish
Match: adra1ba (adrenoceptor alpha 1Ba [Source:ZFIN;Acc:ZDB-GENE-120510-1])

HSP 1 Score: 199.904 bits (507), Expect = 6.701e-58
Identity = 127/357 (35.57%), Postives = 187/357 (52.38%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            I GN LVI++V  N +LR  TNYFI++LA ADLL+   V+P +   E+    W+FG+I+CD+W A DVL  TASI++LC+I+I+RY     PL     +T K  ++ +  VW  +  IS   ++ W++     D+V  C    +PFY   SS+ SFY PL ++L +Y ++Y  AKR    L+ G        + +++  + LRIH  G +  +                                D   G + SS ++           KL+KF+ E+KAA+TLG V+G FILCWLPFF+   + S +   +   T         ++ WLGY NSC+NPIIY    R F+ AFIR+L
Sbjct:   57 IVGNILVILSVVCNRHLRIPTNYFIINLAMADLLLSTTVLPVSATREI-LNYWVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPSIVTEKRALLAMLGVWVLAFVISIGPLLGWKEPPSEDDTV--CLITEEPFYALFSSLGSFYIPLAVILAMYCRVYIVAKRTTKNLEAGVM-----KERMDSNELTLRIHYKGSQTQE--------------------------------DCSKGHLRSSLTV-----------KLLKFSREKKAAKTLGVVVGMFILCWLPFFLALPIGSFNTSLRPPET------FFKVIFWLGYFNSCLNPIIYPCYSREFKQAFIRIL 356          
BLAST of GCR008 vs. Ensembl Zebrafish
Match: adra1d (adrenoceptor alpha 1D [Source:ZFIN;Acc:ZDB-GENE-090312-203])

HSP 1 Score: 196.823 bits (499), Expect = 1.224e-56
Identity = 135/366 (36.89%), Postives = 197/366 (53.83%), Query Frame = 3
Query:   75 IKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLC-SGPVTSSASIAFKLRHF--TLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAF 1160
            + +F+S   I GN LVI++V  N +L+T TN+FIV+LA ADLL+ ++V+PF A L  LG   W+FG+++C++W A DVL  TASIL+LC+I+I+RY      L     +T +   +++ LVW  S  IS   ++ W++   + +S+  C+   +P Y   SS+ SFY PL+++LV+Y ++Y  A+R    L+ G  V  + DK++    V LRIH                                          C S P  SS S   K   F  +L  +L+KF+ E+KAA+TL  V+G FILCWLPFF    L S       F      D +  ++ WLGY NSC+NPIIY  S + F+ AF
Sbjct:   43 LAIFISVA-IVGNILVILSVLCNKHLQTVTNFFIVNLAIADLLLSIIVLPFSASLEVLG--CWVFGRVFCNIWAAVDVLCCTASILSLCVISIDRYIGVKHCLKYPTIMTERKAGVILVLVWVSSMVISIGPLLGWKEPPPSDESI--CRITEEPGYALFSSLFSFYLPLMVILVMYIRVYIVARRTTKSLEAG--VKRERDKSME---VVLRIH------------------------------------------CRSMPEDSSTSSKTKNHPFRSSLSVRLMKFSREKKAAKTLAIVVGMFILCWLPFFFVLPLGS------FFPALKPSDMVFKVIFWLGYFNSCINPIIYPCSSKEFQRAF 350          
BLAST of GCR008 vs. Ensembl Xenopus
Match: ADRA1D (adrenoceptor alpha 1D [Source:NCBI gene;Acc:100495969])

HSP 1 Score: 204.912 bits (520), Expect = 2.069e-59
Identity = 133/358 (37.15%), Postives = 193/358 (53.91%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            I GN +VI++VA N  L+T TNYFIV+LA ADLL+   V+PF A L  LG   W FG+++CD+W A DVL  TASI++LC+I+I+RY      L     +T K  ++++ L+W  S  IS   ++ W++     DS CS     +P Y   SS+ SFY PL+++LV+Y+++Y  A+R    L+ G  V ++ +K++    V LRIH                                     C + L     ++        R  +L  +L+KF+ E+KAA+TL  V+G FILCWLPFF+   L S       F      D +  ++ WLGY NSC+NPIIY  S + F+ AFIR+L
Sbjct:   57 IVGNIMVILSVACNRQLQTVTNYFIVNLAIADLLLSTTVLPFSATLEVLG--FWAFGRVFCDIWAAVDVLCCTASIMSLCVISIDRYVGVKYSLKYPTIMTEKKAVVILILLWLSSMVISIGPLLGWKEPPPPDDSKCS--ITEEPGYALFSSLFSFYLPLLVILVMYFRVYIVARRTTKSLEAG--VKKERNKSME---VVLRIH-------------------------------------CRSVLEESSSSTRNHKGHTFRS-SLSVRLLKFSREKKAAKTLAIVVGVFILCWLPFFLILPLGS------FFPALKPTDSVFKVIFWLGYFNSCVNPIIYPCSSKEFKRAFIRIL 361          
BLAST of GCR008 vs. Ensembl Xenopus
Match: ENSXETT00000011711.1 (adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488806])

HSP 1 Score: 202.216 bits (513), Expect = 1.419e-58
Identity = 140/394 (35.53%), Postives = 199/394 (50.51%), Query Frame = 3
Query:   36 FGNETVSVISIASIKMFLSFG-------TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSS--DTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVT------WLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            F N+T+  +++    M L F         I GN +VII+V +N  LR  TNY IV+LA ADLL+   V+PF+   E+    W+FG+I CD+W A DVL  TASI +LC I+I+RY      L     +T K  I+ +  VW  S  IS   ++ W++ +  DTY     C+  T+ FY   SS+ SFY PL+++LV+Y ++Y  AKR+   L+ G        + +++  + LRIH                                     C       P  +++ +        L  KL+KF+ E+KAA+TLG V+G FILCWLPFF    L+SL             +H+ P VT      WLGY NSC+NPIIY  S + F+ AFIR+L
Sbjct:   31 FANKTIPSVNLTR-AMLLGFTLGAFISVAIIGNIMVIISVVTNKQLRIPTNYLIVNLAIADLLLSSTVLPFSATKEI-VGYWVFGRILCDVWAAMDVLCCTASIFSLCTISIDRYIGVRHSLRYPTIVTRKRTILALLGVWMFSTVISIGPLLGWKEPAPPDTY----VCEITTEIFYAIFSSLASFYIPLIVILVMYCRVYVVAKRITKNLEAGVM-----KERMDSKELTLRIH-------------------------------------CRNKQDDSP--NNSKVQNNQPRSALSLKLLKFSREKKAAKTLGIVVGMFILCWLPFFTVLPLSSL------------SEHLTPPVTLEKIIFWLGYFNSCINPIIYPCSSKEFKRAFIRIL 362          
BLAST of GCR008 vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491])

HSP 1 Score: 199.904 bits (507), Expect = 1.204e-57
Identity = 129/364 (35.44%), Postives = 197/364 (54.12%), Query Frame = 3
Query:   81 MFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            +F++FG + GN LVI++VA + +L+T T+YFI +LA ADLL+  +V+PF+   E+ Q  W+FG+I+C++W A DVL  TASI++LC I+I+RY   + PL     +T K  ++ +  +W  S  IS   +  W+Q +   D +  C+   +P Y   S+  SFY PL ++LV+Y+++Y  AKR    L  G + +E  D    +  V LRIH+                               S P S            S S + +   F++  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S      ++   +  D I  +  WLGY NSC+NP+IY  S   FR AF  +L
Sbjct:   59 VFITFG-VLGNILVILSVACHRHLQTVTHYFIANLAVADLLLMSMVLPFSATFEI-QGYWLFGRIFCNIWAAVDVLCCTASIMSLCAISIDRYIGVSYPLRYPSIMTEKRGVLALLCIWVLSLVISIGPLFGWKQPAPEDDKI--CEITKEPGYALFSAFGSFYLPLSIILVMYFRVYIVAKRESKVLTSGMK-LEKSD----SEEVTLRIHRK------------------------------STPES----------IGSTSSSKQKTQFSV--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGS------IYPPANSSDTIFKITFWLGYFNSCINPVIYPCSSPEFRKAFQNIL 365          
BLAST of GCR008 vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 172.555 bits (436), Expect = 3.625e-48
Identity = 125/400 (31.25%), Postives = 191/400 (47.75%), Query Frame = 3
Query:   39 GNETVSVISIA-SIKMFLSFGT-----IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALN-NPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSC---------------VADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            GN T   ++++  I   L  GT     IFGN+ VI A+A    L+T  NY I SLA  DL++ ++V+P A  N++  + W  GQ+ CD++ + DVL  T+SIL+LC IA++RY   T P+      T +   ++I + W     IS P ++ WR   D  D   +CK   DP Y   S+  +FY PL+LMLVLY KI++ A+  I    K  +  +  D  L+ +P V  R   G      K  +               +   + E +                   D+   P +       +    T  K+ +    E+K  +TLG +MGTFI CWLPFFI  ++           T  +   +  ++ WLGY NS +NPIIYA+  + F+ AF +++
Sbjct:   17 GNVTEEEVALSYQIVTSLFLGTLILCAIFGNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNK-WTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPMLGWRTPEDRSDPN-ACKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKAARFRIRKTVKKAEKKKVADTCLSVSPAVAERKSNGEPSKNWKRTVEPKPSACVNGAIRHGEDGAVLEIIEVHHYVNSKSHLDLPNHAHDMAVAPCSEK-----RNDRATDAKRKVALARERKTVKTLGIIMGTFIFCWLPFFIVALVLP------FCETCHMPHLLFDVINWLGYSNSLLNPIIYAYFNKDFQSAFKKII 403          
BLAST of GCR008 vs. Ensembl Xenopus
Match: HTR1F (5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled [Source:NCBI gene;Acc:100494586])

HSP 1 Score: 162.54 bits (410), Expect = 6.447e-45
Identity = 113/370 (30.54%), Postives = 172/370 (46.49%), Query Frame = 3
Query:   87 LSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPF-YXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMI-------ICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            L+  T   NSLVI A+     L    NY I SLA  D L+ ++VMPF+++  + +E WI GQ  CD+W + D+   T SIL+L  IA++RY+  T  +   R  T K+   MI +VW  S  IS P + W  Q+ +  D    C    D   +   S+  +FY PL L+L+LY+KIY+ AK +        +  ++  QV+ D    L         H   F  +                                  + +  V      A++       K+ I    E+KAA TLG ++G F++CWLPFF+  ++ +      +  +  I D +   +TWLGYLNS +NP+IY      F+ AF +L+
Sbjct:   33 LTLMTTAINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIMY-IMKETWIMGQAICDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAAFMIAVVWIISIFISMPPLFWRHQALNKED---ECIIKHDHIVFTIYSTFGAFYIPLALILILYYKIYKAAKTLYHKRSVSRVEREQNGQVLLDATTTLCIAEKSFSDHSTDFDKIH-------------------------------ITVRNARVEMKQEKAYR-------KQKISSTRERKAATTLGLILGAFVICWLPFFVKEVIVN------ICESCYISDDMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQKLM 354          
BLAST of GCR008 vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 211.46 bits (537), Expect = 1.986e-62
Identity = 141/358 (39.39%), Postives = 185/358 (51.68%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            I GN LVI++VA N +LRT TNYFIV+LA ADLL+   V+PF A L  LG   W+ G+I+CD+W A DVL  TASIL+LC I+I+RY      L     +T +  I+ +  VW  S  IS   ++ W++ +   D  C      +PFY   SS+ SFY PL ++LV+Y ++Y  AKR    L+ G        K L      LRIH   F                             + LS        P +S            +  KL KF+ E+KAA+TLG V+G FILCWLPFFI   L S      LF T    D +  +V WLGY NSC+NPIIY  S + F+ AF+R+L
Sbjct:   60 IVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLG--YWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVT--EEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELT-----LRIHSKNFH---------------------------EDTLSSTKAKGHNPRSS------------IAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGS------LFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of GCR008 vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 211.46 bits (537), Expect = 7.066e-62
Identity = 141/358 (39.39%), Postives = 185/358 (51.68%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            I GN LVI++VA N +LRT TNYFIV+LA ADLL+   V+PF A L  LG   W+ G+I+CD+W A DVL  TASIL+LC I+I+RY      L     +T +  I+ +  VW  S  IS   ++ W++ +   D  C      +PFY   SS+ SFY PL ++LV+Y ++Y  AKR    L+ G        K L      LRIH   F                             + LS        P +S            +  KL KF+ E+KAA+TLG V+G FILCWLPFFI   L S      LF T    D +  +V WLGY NSC+NPIIY  S + F+ AF+R+L
Sbjct:   60 IVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLG--YWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVT--EEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELT-----LRIHSKNFH---------------------------EDTLSSTKAKGHNPRSS------------IAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGS------LFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of GCR008 vs. Ensembl Mouse
Match: Adra1b (adrenergic receptor, alpha 1b [Source:MGI Symbol;Acc:MGI:104774])

HSP 1 Score: 211.46 bits (537), Expect = 7.066e-62
Identity = 141/358 (39.39%), Postives = 185/358 (51.68%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            I GN LVI++VA N +LRT TNYFIV+LA ADLL+   V+PF A L  LG   W+ G+I+CD+W A DVL  TASIL+LC I+I+RY      L     +T +  I+ +  VW  S  IS   ++ W++ +   D  C      +PFY   SS+ SFY PL ++LV+Y ++Y  AKR    L+ G        K L      LRIH   F                             + LS        P +S            +  KL KF+ E+KAA+TLG V+G FILCWLPFFI   L S      LF T    D +  +V WLGY NSC+NPIIY  S + F+ AF+R+L
Sbjct:   60 IVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLG--YWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVT--EEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELT-----LRIHSKNFH---------------------------EDTLSSTKAKGHNPRSS------------IAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGS------LFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of GCR008 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 191.815 bits (486), Expect = 2.224e-55
Identity = 126/360 (35.00%), Postives = 193/360 (53.61%), Query Frame = 3
Query:   93 FGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            FG + GN LVI++VA + +L + T+Y+IV+LA ADLL+   V+PF+ + E+    W FG+++C++W A DVL  TASI+ LC+I+I+RY   + PL     +T +  +  +  VW  S  IS   +  WRQ +   +++  C+   +P Y+  S++ SFY PL ++LV+Y ++Y  AKR    L+ G +     DK+ ++  V LRIH+    A                                          S  S A    HF++  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S       F      + +  +V WLGYLNSC+NPIIY  S + F+ AF  +L
Sbjct:   39 FG-VLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEI-LGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETI--CQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKT----DKS-DSEQVTLRIHRKNVPA----------------------------------------EGSGVSSAKNKTHFSV--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGS------FFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVL 341          
BLAST of GCR008 vs. Ensembl Mouse
Match: Adra1a (adrenergic receptor, alpha 1a [Source:MGI Symbol;Acc:MGI:104773])

HSP 1 Score: 192.2 bits (487), Expect = 4.489e-55
Identity = 126/360 (35.00%), Postives = 193/360 (53.61%), Query Frame = 3
Query:   93 FGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            FG + GN LVI++VA + +L + T+Y+IV+LA ADLL+   V+PF+ + E+    W FG+++C++W A DVL  TASI+ LC+I+I+RY   + PL     +T +  +  +  VW  S  IS   +  WRQ +   +++  C+   +P Y+  S++ SFY PL ++LV+Y ++Y  AKR    L+ G +     DK+ ++  V LRIH+    A                                          S  S A    HF++  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S       F      + +  +V WLGYLNSC+NPIIY  S + F+ AF  +L
Sbjct:   39 FG-VLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEI-LGYWAFGRVFCNIWAAVDVLCCTASIMGLCIISIDRYIGVSYPLRYPTIVTQRRGVRALLCVWALSLVISIGPLFGWRQQAPEDETI--CQINEEPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKT----DKS-DSEQVTLRIHRKNVPA----------------------------------------EGSGVSSAKNKTHFSV--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGS------FFPNFKPPETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVL 341          
BLAST of GCR008 vs. UniProt/SwissProt
Match: sp|Q24563|DOPR2_DROME (Dopamine receptor 2 OS=Drosophila melanogaster OX=7227 GN=Dop1R2 PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 3.240e-70
Identity = 160/402 (39.80%), Postives = 214/402 (53.23%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNL------------------------YQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL---CPIYYRRMIQREINSSS 1223
            T+FGNSLVI+AV     L T TNYFI SLA AD L+GLVVMPF+ L E+ +  W FG  WCD+W + DVL +TASILNLC+I+++RY   T P      +T K    +I  VW CS+ ISFPAI+WWR + D       C F     Y+  SS +SFY PL++M+  Y +IYR A      L+ G + +      L    + LRIH+GG    Q+  +                        + +  N     +  T      EPLS + +         A      ++F+L +KL KF  E+KAA+TLG VMG FI+CWLPFF+ N+L+               + +  +VTWLG++NSCMNP+IYA   R FR AF+RLL   CP   RR  Q  + S S
Sbjct:  122 TVFGNSLVILAVIRERYLHTATNYFITSLAVADCLVGLVVMPFSALYEVLENTWFFGTDWCDIWRSLDVLFSTASILNLCVISLDRYWAITDPFSYPMRMTVKRAAGLIAAVWICSSAISFPAIVWWRAARDGEMPAYKCTFTEHLGYLVFSSTISFYLPLLVMVFTYCRIYRAAVIQTRSLKIGTKQVLMASGELQ---LTLRIHRGGTTRDQQNQVSGGGGGGGGGGGGGGSLSHSHSHSHHHHHNHGGGTTTSTPEEPDDEPLSALHN------NGLARHRHMGKNFSLSRKLAKFAKEKKAAKTLGIVMGVFIICWLPFFVVNLLSGF-----CIECIEHEEIVSAIVTWLGWINSCMNPVIYACWSRDFRRAFVRLLCMCCPRKIRRKYQPTMRSKS 509          
BLAST of GCR008 vs. UniProt/SwissProt
Match: sp|P97717|ADA1B_MOUSE (Alpha-1B adrenergic receptor OS=Mus musculus OX=10090 GN=Adra1b PE=1 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 3.218e-61
Identity = 144/377 (38.20%), Postives = 192/377 (50.93%), Query Frame = 3
Query:   45 ETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            +    IS+  +  F+ F  I GN LVI++VA N +LRT TNYFIV+LA ADLL+    +PF A L  LG   W+ G+I+CD+W A DVL  TASIL+LC I+I+RY      L     +T +  I+ +  VW  S  IS   ++ W++ +   D  C      +PFY   SS+ SFY PL ++LV+Y ++Y  AKR    L+ G        K L      LRIH   F                             + LS        P +S            +  KL KF+ E+KAA+TLG V+G FILCWLPFFI   L S      LF T    D +  +V WLGY NSC+NPIIY  S + F+ AF+R+L
Sbjct:   41 DVTRAISVGCLGAFILF-AIVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTDLPFSATLEVLG--YWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVT--EEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELT-----LRIHSKNFH---------------------------EDTLSSTKAKGHNPRSS------------IAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGS------LFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 362          
BLAST of GCR008 vs. UniProt/SwissProt
Match: sp|P35368|ADA1B_HUMAN (Alpha-1B adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1B PE=1 SV=3)

HSP 1 Score: 211.846 bits (538), Expect = 3.666e-61
Identity = 141/359 (39.28%), Postives = 185/359 (51.53%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
             I GN LVI++VA N +LRT TNYFIV+LA ADLL+   V+PF A L  LG   W+ G+I+CD+W A DVL  TASIL+LC I+I+RY      L     +T +  I+ +  VW  S  IS   ++ W++ +   D  C      +PFY   SS+ SFY PL ++LV+Y ++Y  AKR    L+ G        K L      LRIH   F                             + LS        P +S            +  KL KF+ E+KAA+TLG V+G FILCWLPFFI   L S      LF T    D +  +V WLGY NSC+NPIIY  S + F+ AF+R+L
Sbjct:   59 AIVGNILVILSVACNRHLRTPTNYFIVNLAMADLLLSFTVLPFSAALEVLG--YWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVT--EEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELT-----LRIHSKNFH---------------------------EDTLSSTKAKGHNPRSS------------IAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGS------LFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRIL 363          
BLAST of GCR008 vs. UniProt/SwissProt
Match: sp|P18841|ADA1B_MESAU (Alpha-1B adrenergic receptor OS=Mesocricetus auratus OX=10036 GN=ADRA1B PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.943e-61
Identity = 141/358 (39.39%), Postives = 185/358 (51.68%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            I GN LVI++VA N +LRT TNYFIV+LA ADLL+   V+PF A L  LG   W+ G+I+CD+W A DVL  TASIL+LC I+I+RY      L     +T +  I+ +  VW  S  IS   ++ W++ +   D  C      +PFY   SS+ SFY PL ++LV+Y ++Y  AKR    L+ G        K L      LRIH   F                             + LS        P +S            +  KL KF+ E+KAA+TLG V+G FILCWLPFFI   L S      LF T    D +  +V WLGY NSC+NPIIY  S + F+ AF+R+L
Sbjct:   60 IVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLG--YWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVT--EEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELT-----LRIHSKNFH---------------------------EDTLSSTKAKGHNPRSS------------IAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGS------LFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of GCR008 vs. UniProt/SwissProt
Match: sp|P15823|ADA1B_RAT (Alpha-1B adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra1b PE=1 SV=2)

HSP 1 Score: 210.69 bits (535), Expect = 8.330e-61
Identity = 141/358 (39.39%), Postives = 185/358 (51.68%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            I GN LVI++VA N +LRT TNYFIV+LA ADLL+   V+PF A L  LG   W+ G+I+CD+W A DVL  TASIL+LC I+I+RY      L     +T +  I+ +  VW  S  IS   ++ W++ +   D  C      +PFY   SS+ SFY PL ++LV+Y ++Y  AKR    L+ G        K L      LRIH   F                             + LS        P +S            +  KL KF+ E+KAA+TLG V+G FILCWLPFFI   L S      LF T    D +  +V WLGY NSC+NPIIY  S + F+ AF+R+L
Sbjct:   60 IVGNILVILSVACNRHLRTPTNYFIVNLAIADLLLSFTVLPFSATLEVLG--YWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLSVWVLSTVISIGPLLGWKEPAPNDDKECGVT--EEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELT-----LRIHSKNFH---------------------------EDTLSSTKAKGHNPRSS------------IAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGS------LFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFMRIL 363          
BLAST of GCR008 vs. TrEMBL
Match: A0A193KUK0 (GCR008 OS=Schmidtea mediterranea OX=79327 GN=gcr008 PE=2 SV=1)

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 406/406 (100.00%), Postives = 406/406 (100.00%), Query Frame = 3
Query:   18 MNTICCFGNETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYRRMIQREINSSSFQAR 1235
            MNTICCFGNETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYISISSIVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQNSKNKSKWFSWKTKPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYRRMIQREINSSSFQAR
Sbjct:    1 MNTICCFGNETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYISISSIVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQNSKNKSKWFSWKTKPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYRRMIQREINSSSFQAR 406          
BLAST of GCR008 vs. TrEMBL
Match: A0A1I8IYG7 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 314.309 bits (804), Expect = 1.944e-95
Identity = 173/375 (46.13%), Postives = 228/375 (60.80%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIE--------------DGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDH---ILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            T+FGNSLVI+AV     LRT TNYFIVSLA ADLLMGLVVMPF++++ + +E W+FG IWCD+WHAFDVLSTTASILNLCMIA+ERY    +P+     +T + C++++  VW CS CISFPAI WWR +S        C F  DP Y+  SS+VSFYAPL++M+ +Y KIYRTA +++   Q G +V+                   +     V LRIH+G     Q                               A     P ++   IA + R   + KKL +F+ EQ+AA+TLG VMG FI CWLPFFICNI+ +++++       ++GDH   ++ +VTWLGY+NS +NP IYAHSMR FR AFI+LL
Sbjct:  256 TVFGNSLVILAVIREHYLRTITNYFIVSLALADLLMGLVVMPFSVISYVTREHWLFGPIWCDLWHAFDVLSTTASILNLCMIAVERYWAIENPISYPSRVTKRRCLLLVSAVWICSCCISFPAIAWWRATSPPSPRHV-CSFTGDPVYLICSSLVSFYAPLLVMVFVYCKIYRTATQLVRSWQAGAKVLHCHGMPTSAGNGRSPGSGGSGGGGTVVLRIHRGRQEVTQS---------------------------ETAAGPSQQPKSTVGGIARRFRSLGVRKKLARFSREQRAAKTLGIVMGIFIACWLPFFICNIVLAINSE-------ALGDHAAKVMTIVTWLGYINSSINPGIYAHSMRDFRRAFIKLL 595          
BLAST of GCR008 vs. TrEMBL
Match: A0A1I8FWQ2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 2.161e-94
Identity = 170/366 (46.45%), Postives = 228/366 (62.30%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQS------SDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSA-SIAFKLR-HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            T+FGNSLVI+AV     LR+ TNYFIVSLA ADLLMG VVMPFA+ + +  + W FG  WCD+WHAFDVLS+TASILNLCMIAIERY    +P+     +T + C++MI +VW C++ ISFPAI WW  +      + ++ +   CKF +DP Y+  SSIVSFYAPL++ML +YWKIYRTA  ++   Q G +V+    + L    V LRI      A +   +    +   +        + + E  +   D         A   A +LR  F + KKL++F+ EQ+AA+TLG VMG FI CW+PFF+CN++++L +       G+    I  +VTWLGY+NS +NP IYAHSMR FR AFI LL
Sbjct:   45 TVFGNSLVIVAVLREHYLRSITNYFIVSLATADLLMGAVVMPFAVASHVTNDRWPFGATWCDLWHAFDVLSSTASILNLCMIAIERYWAIENPMSYPSKVTKRRCLVMIGVVWVCASLISFPAIAWWHAAEPSMKVAASHPTSARCKFTSDPAYLICSSIVSFYAPLLVMLFVYWKIYRTAVHLVRGWQSGAKVLR--GRGLQT-SVVLRIIAAEPVAARPVRVPSARREDDQSCFCDGGGVAMDEITAGSDDDDEHNAGGGARGFARRLRSSFGVRKKLLRFSREQRAAKTLGIVMGVFIACWMPFFVCNVISALSDGG----LGASEAQIFAVVTWLGYVNSSVNPAIYAHSMRDFRRAFISLL 403          
BLAST of GCR008 vs. TrEMBL
Match: A0A2C9K695 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106052829 PE=3 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 1.420e-90
Identity = 163/384 (42.45%), Postives = 232/384 (60.42%), Query Frame = 3
Query:   63 SIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL--CPIYYRRMIQRE 1208
            +I  +    S   + GN +VI+AV     LR  TNYFIVSLA AD+++G VVMPF++ NEL   VW++GQ WCDMW + DVL++TASILNLC+I+++RY   T P+     ++N    I+I LVWFCSA ISFPAI WWR  + +      C F  D  Y+ ISS+VSFY P ++M+ +Y KIYR A   I  ++ G +V  D  +  N   + LRIH+GG+    + + ++    +    S    P+G    +    +     + S+  I  K+RHF + KKL K   EQKAA+TLG V+G FI+CW+PFF  N+L  + + N ++R     + + P+ TWLGY+NS MNPIIYA SM+ FR AF +++  CP Y     +R+
Sbjct:   65 AIGVLLAIFSLIVVVGNLMVIVAVYREVYLRMVTNYFIVSLAIADVMVGGVVMPFSISNELTTSVWLYGQAWCDMWRSLDVLASTASILNLCVISLDRYWAITDPIAYPSKMSNSKVCILIALVWFCSAGISFPAIAWWRAVTPSDLPKHRCLFTEDSAYLIISSVVSFYVPCIIMMFVYCKIYRAALTQIEGIKSGCKVTADCPRGDNGEVMTLRIHRGGYHLRTELSGFE----RGVSDSDTDSPLGSRHHMY-HHNAHPNHLRSTTFITKKIRHFAISKKLTKLAKEQKAAKTLGIVVGVFIICWVPFFCANVLYGICHSNCVYRP----ELLFPVFTWLGYINSGMNPIIYALSMKDFRRAFSKMILCCPRYRYSQCKRQ 439          
BLAST of GCR008 vs. TrEMBL
Match: R7UH39 (G_PROTEIN_RECEP_F1_2 domain-containing protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_24291 PE=3 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 2.212e-89
Identity = 169/376 (44.95%), Postives = 221/376 (58.78%), Query Frame = 3
Query:   84 FLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIE-DGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGP---VTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL---CPIYYR 1190
            F +  TI GN LVI AV     LRT TNYFIVSLA ADL++G VVMPF++  E+  +VWIFG  WCD+WH+FDVL++TASILNLC+I+++RY   T P+     ++     +++ L+W CSA ISFPAIIWWR           C F  D  Y+  SS+VSFY P+ ++L  Y+KIYR A      L+ G +V+  DG   +N   + LRIH+GG R  +    Y  + N            G S        +   P   V  S  I+ K +HF + KKL K   EQKAA+TLG VMG F +CW+PFFI N+L    N + +       D +LP+ TWLGY+NS MNP+IYA SMR FR AF ++L   CP Y R
Sbjct:    4 FFAMVTILGNLLVIAAVVRERYLRTVTNYFIVSLAIADLIIGGVVMPFSIFLEITNDVWIFGSDWCDVWHSFDVLASTASILNLCVISLDRYWAITDPIAYPSKMSTGRSFVLMALIWICSAAISFPAIIWWRTVVSAPLPPHVCAFTEDTGYLIFSSLVSFYCPVSIILFAYYKIYRAATEQTRSLRAGCKVMNADG---VNGEVLTLRIHRGGPRDPEDAIHYARAANSDSD--------GESPSHGLHQHITPQPHKDVRPSRMISRKWKHFAISKKLSKVAKEQKAAKTLGIVMGVFCICWVPFFIANVLYGFCNLDCIAHP----DILLPVFTWLGYINSGMNPVIYACSMRDFRRAFFKILCCFCPGYIR 364          
BLAST of GCR008 vs. Ensembl Cavefish
Match: adra1aa (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:103024013])

HSP 1 Score: 213.001 bits (541), Expect = 6.071e-63
Identity = 135/379 (35.62%), Postives = 207/379 (54.62%), Query Frame = 3
Query:   42 NETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNE-LGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLR-HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            N T +V+    + +F+ FG + GN LVI++VA + NLRT T+YFI +LA ADLL+   V+PF+ + E LG   W+FG+ +CD+W A DVL  TASI++LC I+++RY   + PL     +T +  ++ +  VW  S  IS   +  W++ +   ++V  CK   +P Y   S++ SFY PLV++LV+Y ++Y  A+R    L+KG++     +K+ +   V LRIH+G                                             ++S   A + R HF L  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S      +F      D +  +  WLGY NSC+NPIIY  S + F+ AF+ +L
Sbjct:   36 NVTKAVVLGIVLAIFIVFG-VMGNILVILSVACHRNLRTVTHYFIANLAVADLLLSSTVLPFSAIFEMLGH--WVFGRAFCDVWAAMDVLCCTASIMSLCAISVDRYIGVSYPLRYPTIVTERRALLALMGVWALSITISVGPLFGWKEPAPEDETV--CKITEEPGYAIFSAVGSFYLPLVVILVMYCRVYVVARRETRGLRKGQKT----EKSDHAEAVTLRIHRGN-------------------------------------------TSASEDEALRSRTHFAL--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGS------IFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSSQEFKKAFLSVL 354          
BLAST of GCR008 vs. Ensembl Cavefish
Match: ADRA1D (adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027862])

HSP 1 Score: 202.601 bits (514), Expect = 1.079e-58
Identity = 134/359 (37.33%), Postives = 195/359 (54.32%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
             I GN LVI++V  N +LRT TN+FIV+LA ADLL+G+VV+PF A L  LG   W+FG+++C++W A DVL  TASIL+LC+I+++RY      L     +T +   +++ ++W  SA IS   ++ W++     +SVCS     +P Y   SS+ SFY PL ++LV+Y+++Y  A+R    L+ G +  E G     +  V LRIH    R+L +  L  +               G  +P                         +L  +L+KF+ E+KAA+TL  V+G F+LCWLPFF    L S       F      D +  ++ WLGY NSC+NPIIY  S + F+ AF RLL
Sbjct:   69 AIVGNILVILSVLCNRHLRTVTNFFIVNLAIADLLLGVVVLPFSASLEVLG--CWVFGRVFCNIWAAVDVLCCTASILSLCIISVDRYVGVKYCLRYPTIMTERKAGVILVVIWVASAVISIGPLLGWKEPPPADESVCS--ITEEPGYALFSSLFSFYLPLSVILVMYFRVYVVARRTSRSLEAGVKR-ERG----TSTDVVLRIH---CRSLPEEALEHSRS------------RGRGQPF----------------------RSSLSVRLMKFSREKKAAKTLAIVVGMFVLCWLPFFFVLPLGS------FFPALKPSDMVFKVIFWLGYFNSCINPIIYPCSSKEFQRAFTRLL 375          
BLAST of GCR008 vs. Ensembl Cavefish
Match: adra1ba (adrenoceptor alpha 1B [Source:NCBI gene;Acc:103033427])

HSP 1 Score: 202.216 bits (513), Expect = 1.442e-58
Identity = 127/357 (35.57%), Postives = 189/357 (52.94%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            I GN LVI++V  N +LR  TNYFI++LA ADLL+G  V+P +   E+    W+FG+I+CD+W A DVL  TASI++LC+I+I+RY     PL     +T K  ++ +  VW  +  IS   ++ W++     D++  C    +PFY   SS+ SFY PL ++L +Y ++Y  AKR    L+ G        + +++  + LRIH  G +A ++                                   G + SS ++           KL+KF+ E+KAA+TLG V+G FILCWLPFF+   + S +   +   T         ++ WLGY NSC+NPIIY    R F+ AFIR+L
Sbjct:   60 IVGNILVILSVVCNRHLRIPTNYFIINLAMADLLLGTTVLPVSATLEI-LNYWVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPSIVTEKRALLAMLGVWVLATVISIGPLLGWKEPPSDDDTI--CPITEEPFYALFSSLGSFYIPLAVILAMYCRVYIVAKRTTRNLEAGVM-----KERMDSSELTLRIHCKGAQAQEE-----------------------------CGGAGKGTIRSSLTV-----------KLLKFSREKKAAKTLGVVVGMFILCWLPFFLALPIGSFNANLRPPET------FFKVIFWLGYFNSCLNPIIYPCYSREFKQAFIRIL 362          
BLAST of GCR008 vs. Ensembl Cavefish
Match: adra1ab (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:103037444])

HSP 1 Score: 187.193 bits (474), Expect = 2.125e-53
Identity = 130/365 (35.62%), Postives = 189/365 (51.78%), Query Frame = 3
Query:   81 MFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLR-HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            +F+ FG + GN LVI++VA + +LR+ T+YFI +LA ADLL+   V+PF+  +EL    W+FG++ C  W A DVL  TASIL+L +I+I+R    + PL      T+   +  +  VW  SA IS   +  WR+     +SV  C+   DP Y   S+  SFY PL ++LV+Y ++Y  A+R    L++G Q +  G          LRIH G                                        CS       ++  K R HF+L  +L+KF+ E+KAA+TLG V+G FILCWLPFF+   ++S      +F +    + +  +  WLGY NSC+NPIIY    + F+ AF  LL
Sbjct:   42 LFVIFG-VMGNILVILSVACHRHLRSVTHYFIANLAMADLLLSSTVLPFSAFSELLGR-WVFGRMLCCAWTALDVLCCTASILSLSVISIDRCVAVSYPLRYPSLATSGRGLGAVAAVWGLSAAISVGPLFGWREPMPEDESV--CRVNEDPGYAIFSAACSFYVPLTVILVMYCRVYVVARRKSRSLREGRQ-LGGGS---------LRIHCGN------------------------------------TQRCSDHRDGHITVVGKCRSHFSL-LRLLKFSREKKAAKTLGVVVGCFILCWLPFFLVLPISS------IFPSHRPPETVFKITFWLGYFNSCLNPIIYPCFSQEFKKAFQNLL 349          
BLAST of GCR008 vs. Ensembl Cavefish
Match: adrb2a (adrenoceptor beta 2 [Source:NCBI gene;Acc:103041180])

HSP 1 Score: 174.481 bits (441), Expect = 3.306e-49
Identity = 126/383 (32.90%), Postives = 183/383 (47.78%), Query Frame = 3
Query:   51 VSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAI--IWWRQSSDT-----YDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGF-RALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLC 1175
            + ++ + ++   L    + GN LVI A+A    L+  TN FI+SLACADL+MGL+V+PF  ++ +    W FG+ WC+ W A DVL  TASI  LC+IA++RY   TSP      LT     I++ LVW   A IS+  I   W+  +SD       D+ C C+F  +  Y  ISSI+SFY PLV+M+ +Y ++++ A++ +  + + E                 R H  G  +  Q  N                                S  V  +    F LR             E KA +TLG +MG F LCWLPFF+ N++ S    +K         ++  ++ W+GY NS  NP+IY  S   FR AF  +LC
Sbjct:   26 LQMVLLGTVLSVLVLAIVLGNVLVITAIARFQRLQNVTNCFIMSLACADLVMGLIVVPFGAIHIILNN-WYFGRFWCEFWTATDVLCVTASIETLCIIALDRYLAITSPFRYQSLLTKCKARIVVLLVWIIGALISYLPIHLRWYLSNSDEAQTCMKDASC-CEFQPNRLYTIISSIISFYIPLVIMVFVYSRVFQEARKQLKKIDRSEG----------------RFHHNGIGKGHQDAN-------------------------------SSSDVRIAKKPKFCLR-------------EHKALKTLGIIMGIFTLCWLPFFVLNVVESFYQVDK---------YLYRILNWIGYANSAFNPLIYCRS-PEFRYAFKEILC 336          
BLAST of GCR008 vs. Ensembl Sea Lamprey
Match: adra1bb (adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-041114-51])

HSP 1 Score: 166.777 bits (421), Expect = 1.102e-47
Identity = 114/353 (32.29%), Postives = 178/353 (50.42%), Query Frame = 3
Query:  117 LVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNE-LGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            LV+++V  N +LRT TNYFI++LA ADLL+   V+PF+   E LG   W+FG+I+CD+W A DVL  TASI++LC I +                     ++++  VW  +  IS   ++ W++ +   ++V  C+    P Y   S++ SFY PLV++L +Y ++Y  A+R    L++G +     +++ ++  V L+  K     L+   L++                                  SS S+ F           +KF+ E+KAA+TLG V+G FILCWLPFFI   +         F +      +  +V WLGY NSC+NP+IY  S + F+ AF+R L
Sbjct:   56 LVVLSVVCNKHLRTVTNYFIINLASADLLLSTTVLPFSATFEILGY--WVFGRIFCDIWAALDVLCCTASIMSLCAIRV---------------------LLILIAVWVLAIVISVGPLLGWKEPAPPDETV--CEITEVPGYALFSAMGSFYIPLVILLAMYCRVYVAARRQTKSLEEGIK----RERSSSSEEVTLKEKKAA--VLEIYGLFR----------------------------------SSLSVRF-----------MKFSREKKAAKTLGIVVGVFILCWLPFFIALPI----APGSFFPSVRPSQTVFKVVFWLGYFNSCINPLIYPCSSQEFKRAFLRAL 328          
BLAST of GCR008 vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 159.073 bits (401), Expect = 5.441e-44
Identity = 113/370 (30.54%), Postives = 174/370 (47.03%), Query Frame = 3
Query:  111 NSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLR------------IHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGK----KLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            N+LVI A+++   LR   NY I SLA ADLL+  +VMP A    +  E W  G   CD+W + DV   TASIL+LC IA++R+   T         T     +MI   W  +ACIS P + W R+  D     C  +      Y   S+  +FY PL L+L LY +I+R AKR+    +K E    +         V L                G    L +P     + +  +  +   +     + +S VA      +    S+ F        +    + I  + E++AA+TLG ++G F++CWLPFFI  ++ +      L ++ ++   +  L+TWLGY+NS +NP+IY      F+ AF +L+
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGE-WALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLFWRRR--DPAKPRCIIEH-DHVLYTIYSTFGAFYVPLALLLALYCRIFRAAKRLY---EKRESKQREKLSVSAESAVSLEQPSQSQHQQQQQQPAGKLFRLPQPFCMSETSSSDQTLAQAERSGQHQQSVSAVARRSKRSLRPPRSVRFMSARLDQRRPCLQERISGSRERRAAKTLGLILGAFVVCWLPFFIKELVVN------LCKSCAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV 421          
BLAST of GCR008 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.265 bits (334), Expect = 6.816e-35
Identity = 75/176 (42.61%), Postives = 105/176 (59.66%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAK 626
             IFGNS VI A+A    L+   NY I SLA  DLL+ ++V+P A L ++  + W  GQ+ CD++ A DVL  T+SIL+LC+IA++RY   T+P+      T +  +IMI L W     IS P ++ WR   D  D   +CK   D  Y   S+  +FY PL+LMLVLY +I+R A+
Sbjct:   50 AIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQV-LDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGWRTPEDRADPN-ACKISQDHGYTIYSTFGAFYIPLILMLVLYSRIFRAAR 223          
BLAST of GCR008 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 2.537e-32
Identity = 106/362 (29.28%), Postives = 167/362 (46.13%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSS----ASIAFKLRHFTLGKK--LIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIR 1166
            TI GN LVI+AV+    L+T TNYF++SLA AD+L+G++VMP ++LN L    W      C +W   DVL +TASI++LC I+++RY     P+   R  +    ++ I  VW  S  IS P  +   Q      +  SC+     F I  S   SF+ P    L++    Y +  R++    + + ++ +G    +N       +  G            S   +        P G         D  S P  ++     +   K R  T  +K  +     EQ+A++ LG V   F+  W PFFI N+L++L   +   R       +L +  W+GY++S +NP++Y    R +R AF R
Sbjct:   38 TIAGNVLVILAVSLEKKLQTATNYFLMSLAVADMLVGILVMPISLLNILYGFKWPLPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKKPIEHSRFNSRTKALLKILAVWVISVGISMPVPVLGLQDLAYVYTDGSCQMNISDFIIYGSLS-SFFLP----LIIMVASYVSTTRVL----RQQALLCEGMNGCSNSSSYSSSYSSGGGNNNHGRGRATSLTSATPPEAVGLPGGGPHVALSALDGVSAPPEAALLPHRAGRAKSRSVTPSQKRTMQAITNEQRASKVLGIVFLLFVGMWCPFFITNVLSALCPADACNRHAMAA--LLDVFVWVGYVSSGVNPLVYTLFNRTYRQAFAR 388          
BLAST of GCR008 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008360.1 (pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1 gene:ENSPMAG00000007563.1 transcript:ENSPMAT00000008360.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.405 bits (311), Expect = 3.650e-31
Identity = 75/198 (37.88%), Postives = 114/198 (57.58%), Query Frame = 3
Query:   84 FLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIW----------------WRQSSDTYDSVC-SCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAK 626
            F+   TIFGNSLV IAV ++ +L+   N F+VSLA AD+L+  +VMPF++ NEL    W+FG  WC+M+ A DVL  T+SI++LC I+++RY   T  +      T +     I +VW  +A ISFP ++                  R +S +  SV  +CK   + +Y+  S   SF+ P ++ML++Y +IY+ AK
Sbjct:   42 FIILVTIFGNSLVAIAVFTSKSLKAAQNLFLVSLAAADILVATLVMPFSLANEL-MGYWVFGSFWCEMYLALDVLFCTSSIVHLCAISLDRYWSVTQAVRYNMKRTPRRVKRAIVIVWVIAALISFPPLVGTGRPPANIHRHRHQGSGRNASSSPSSVLPTCKLNEETWYVLSSCTASFFTPCLIMLLVYARIYQVAK 238          

HSP 2 Score: 52.7582 bits (125), Expect = 1.225e-7
Identity = 27/92 (29.35%), Postives = 43/92 (46.74%), Query Frame = 3
Query:  900 LGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLC 1175
            + ++ +    E++    L  VMG F+ CW PFF    L  +        +    +++     W GY NS +NP+IY    + FR AF  +LC
Sbjct:  378 MARRKLTAAREKRFTFVLAVVMGVFVACWFPFFFSYSLTKICEA-----SCKPPEYLFKFFFWCGYCNSSLNPLIYTVFNQDFRRAFKNILC 464          
BLAST of GCR008 vs. Ensembl Nematostella
Match: EDO35211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM55])

HSP 1 Score: 127.487 bits (319), Expect = 2.605e-33
Identity = 112/365 (30.68%), Postives = 160/365 (43.84%), Query Frame = 3
Query:   96 GTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNS-----LDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLC 1175
            GTIFGNSLV  A     +LRT TNYF+VSLA ADLL+G V MP      + Q      +I+  +W  FD+ + TASI+NL +I+++R+   T P    + +T K   + I  VW  +  +S    I +   S   +S     F     Y    +  SF+ PL +M+  Y +I+  A+     +Q  +    D  ++    P       G                                         S PV +S S +F+L+   L       +T+ KAA+TL  VMG F+LCW P+ I  +L       +  Q+K          +   V WL Y NS +NPIIY    R FR AF R+LC
Sbjct:   14 GTIFGNSLVCAAFYLFRDLRTVTNYFVVSLAIADLLVGFVSMPLWFTYLVFQWPPQNSEIYA-LWLCFDIATATASIMNLAVISVDRFYAITLPFQYSQKITKKRACLAIVFVWLYAFAVSSSRAISFAIPSR--ESRAQFSFG----YTFFVATASFFVPLPVMIYCYTRIFSVAR-----VQAAKIRELDSVRSFIESP-----RNGN----------------------------------------SRPVLTSQS-SFRLQRRAL-------STDIKAAKTLAIVMGAFLLCWAPYIIALLLEVSCPRCVPFQDKY--------TLAKAVKWLVYSNSALNPIIYTALNRAFRDAFKRVLC 305          
BLAST of GCR008 vs. Ensembl Nematostella
Match: EDO37207 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGH3])

HSP 1 Score: 126.716 bits (317), Expect = 4.630e-33
Identity = 97/360 (26.94%), Postives = 160/360 (44.44%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISF-PAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLC 1175
            +I GN L+++A+    +L++ T+ FI +LA AD L+ ++ MPF M + +  + WIFG  WC +    + +   AS+L+L  ++I+RY    +PL     +T +   +++  VW  S    F P   W R +  T +S+C+ ++ +   Y        F+APL++M   Y+ I   A+R        +  ++ GD                                            I+ PL     +    + S+ + A + R     ++  KF ++ KAA+TL  VMGTF+ CW P FI            LF +    D      TWL  +NS  NPI+Y    R FR +FI ++C
Sbjct:    1 SILGNILILLAIKRTRSLQSITSVFIANLAVADFLLAVIGMPFTMTSSITYD-WIFGPFWCKLNGMANSVFCIASMLSLAAVSIDRYFAIITPLKYPMLMTPRMAFMLVAWVWLQSLLCGFLPIFGWCRYTYITNESICTAEWGSSIPYTMFIFGACFFAPLLVMFYSYYHILLAARR-----HARQMALKVGD--------------------------------------------IATPLKTAVAI---TLPSADNNAKRKRE----EREAKFKSDTKAAKTLLIVMGTFLFCWSPHFI-------GMTCLLFPSCQWPDWFFATTTWLAMMNSGCNPILYGVLNRRFRRSFIEIIC 296          
BLAST of GCR008 vs. Ensembl Nematostella
Match: EDO34093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQD2])

HSP 1 Score: 122.865 bits (307), Expect = 2.985e-31
Identity = 98/361 (27.15%), Postives = 163/361 (45.15%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLR-TCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRH---LTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            + GN++VI+ +  N++LR   TN FI+SLA +DLL   + MPF +    G   W  G + CD+W    +++   SIL L  +A+ER+K    PL   R    +T++  II IF +W  S   +   +I WR+ SD       C F     Y ++SS+V+F  P++L   LY +I+  A R         Q   D  +       R   HKG   ++ + ++ +  +        K   +   +         S  VT +A      R+              +AART+  ++  F LCW PF + ++  +         T ++   +   +  LGY NS +NP +Y+   + FR+  +R+L
Sbjct:   13 VIGNAIVIVTIVRNTSLRRVTTNLFILSLAFSDLLTASLAMPFDLEALAGSLPWKHGHVICDIWATMYLIAVPTSILTLLAVAVERFKTLKDPLNKFRESHSVTHRRAIIAIFTLWGYSIMFAVVPLIGWRR-SDVSVIDGQCIFNITHVYSALSSVVNFLLPVILTAYLYVRIFMIAHRH--APGAATQQNTDHKRLAKTATFRSEKHKGK-ASVSRISVCRVIRESLCSQGKKKTRIDFHKS--------SASVTRAAEAGAMYRNI-------------RAARTVAVIVFAFFLCWAPFTVLSVTMATCYTC----THAVSSELFSALLLLGYTNSALNPFLYSFKDKRFRVTCVRML 344          
BLAST of GCR008 vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 123.25 bits (308), Expect = 5.361e-31
Identity = 106/415 (25.54%), Postives = 182/415 (43.86%), Query Frame = 3
Query:   42 NETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWI--FGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVI--------------EDGDKALNNPPV-RLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILP----------LVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYRRMIQR 1205
            N   S I+ A   + +   TI GN LV  +V     LR+ TNY +VSLA +DLL+G + +PF +   L +E W    G+  C  W   D+L + AS++NL  I+ +R      PL     +T+K  +I+I +VW  +A  +F + + W +   T  +   C       YI++ ++ +F+ PL+++++ Y  + + A R  + +QK ++ I              E G+ +L +PPV RL+  +    +  + ++                            +  +G            +H            + KA +TL  V+G FILCW PFF+  +     +      T   G+  +P           V  L   NS  NPIIY+   + FR+AF+++   +  +R  Q+
Sbjct:   18 NSVGSTIASACFIVIVMLLTIMGNLLVCYSVFYYRRLRSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEENWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWIYAASCAFLSFVEW-EGESTIAAYPQCGIRAR-VYITLMALAAFFCPLLIVIICYGMVLQVAIRHALQVQKEKEQIALNVSPEPNSNNHEESGETSLASPPVIRLKTSRS---SSHRKDI----------------------------NFANG----------HAKHRNPASSTFHIMKQIKATKTLAVVVGVFILCWFPFFVIFVTFQYCD------TECFGEERIPPAVKRVLLIIFVYVLPVSNSAANPIIYSCFNQEFRVAFLKIFYKMVGKRYRQK 383          
BLAST of GCR008 vs. Ensembl Nematostella
Match: EDO43835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXF3])

HSP 1 Score: 111.694 bits (278), Expect = 3.271e-27
Identity = 96/363 (26.45%), Postives = 165/363 (45.45%), Query Frame = 3
Query:   96 GTIFGNSLVIIAVASNSNLR-TCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRH---LTNKNCIIMIFLVWFCSACISFPAIIWWRQ-SSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRL 1169
             TI GN LV  AV  N+NLR   ++YFIVSLA +DL      MPF M   +   +W  G+ +C +W    +++   SILNL +++I+RYK    P    R    +T +  +I I ++W  S   +   I   +   S  Y    +C F   P Y  + S V+F  P+++M  +Y+KI+R A        + ++   D  + +  P +              P +     +       K+     + P    A L +            +   T+ +K   F    KAART+  ++G F+LCW PF + +I+    N   +    ++  H+  +   +GY+NS +NP+++++    FR A+ ++
Sbjct:    9 ATIVGNLLVCAAVVVNANLRHVVSSYFIVSLAISDLATACFSMPFDMEYLITSGLWPRGEDFCIVWTTVYMIAIPTSILNLLVLSIDRYKTLKDPWDRFRESPFITKRRAVIAILVLWGYSLAFALVPITGVKHYPSSLYQG--TCIFNMAPIYSVVGSFVNFVLPMLIMCCMYYKIFRIAHTKYRMPSRPKR---DMHQVMQLPAMNEESKSPPDAEKVPPAVNNIRNSTKLRSRKKSAKKNNNSPEK--AGLENAGFEEKPMNFGSMEDLTIRRKKY-FVKNAKAARTISVIVGAFLLCWGPFVLFSIVM---NICWMPCAMAVPYHVHHVFLLMGYINSMVNPLLFSYQNHQFRKAYWKI 360          
BLAST of GCR008 vs. Ensembl Medaka
Match: ENSORLT00000006865.2 (alpha-1A adrenergic receptor [Source:NCBI gene;Acc:101159926])

HSP 1 Score: 211.846 bits (538), Expect = 2.960e-62
Identity = 137/361 (37.95%), Postives = 193/361 (53.46%), Query Frame = 3
Query:  102 IFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNK----LFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            I GN LVI++V  N +LRT TNYFI++LA ADLL+G  V+P +   E+    W+FG+I+CD+W A DVL  TASI++LC+I+I+RY   + PL     +T K  ++ +  VW  S  IS   ++ W+Q     D    C    +PFY   SS+ SFY PL ++L +Y ++Y  AKR    L+ G        + +N   + LRIHKG         +++                   EP +  A    G    S          +L  KL+KF+ E+KAA+TLG V+G FILCWLPFF+   L S +   +    LFR          ++ WLGY NSC+NPIIY    R F++AFIR+L
Sbjct:   62 IAGNILVILSVVCNRHLRTPTNYFIINLAMADLLLGTTVLPVSATKEI-LNYWVFGRIFCDIWAALDVLCCTASIMSLCVISIDRYIGVSHPLQYPGIVTEKRALLAMLGVWVLSVVISIGPLLGWKQPPS--DDDMECLITEEPFYALFSSLGSFYIPLAVILAMYCRVYIVAKRTTRNLEAGVM-----RERMNTSELTLRIHKGS-------QMHE-------------------EPGTSNAGKGRGHQARS----------SLTVKLLKFSREKKAAKTLGVVVGMFILCWLPFFLTLPLGSFNENLRPPELLFR----------VIFWLGYFNSCLNPIIYPCYSREFKLAFIRIL 368          
BLAST of GCR008 vs. Ensembl Medaka
Match: adra1d (adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157273])

HSP 1 Score: 205.682 bits (522), Expect = 4.775e-60
Identity = 138/386 (35.75%), Postives = 211/386 (54.66%), Query Frame = 3
Query:   66 IASIKMFLS---FGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL-CPIYYRRMIQRE 1208
            +  + +FLS      I GN LVI++V  N  L+T TN+FIV+LA ADLL+ ++V+PF A L  LG   W+FG+++C++W A DVL  TASIL+LCMI+I+RY      L     +T +  + ++ LVW  S  IS   ++ W++     +S+  C+   +P Y   SS+ SFY PL+++L++Y+++Y  A+R    L+ G  V  + DK++    V LRIH                                    S + D  + P +S +S     R  +L  +L+KF+ E+KAA+TL  V+G FI+CWLPFF+   + S      +F      + +  +V WLGY NSC+NP+IY  S + F+ AFIRLL C  + +R + R 
Sbjct:   42 VVGVGIFLSVFILVAIVGNILVILSVVCNKQLQTVTNFFIVNLAIADLLVSIIVLPFSASLEVLG--CWMFGRVFCNVWAAVDVLCCTASILSLCMISIDRYIGVKHCLKYPSIMTERKAVAILMLVWVSSLVISVGPLLGWKEPPPVDESI--CRITEEPGYALFSSLFSFYLPLLVILIMYFRVYVVARRTTKSLEAG--VKRERDKSVE---VVLRIH----------------------------------CRSVLGD--ARPASSKSSKNHPFRS-SLSVRLMKFSREKKAAKTLAVVVGMFIVCWLPFFLFLPIGS------VFPALKPSETVFKVVFWLGYFNSCINPMIYPCSSKEFQRAFIRLLKCQCHQKRRVLRR 375          
BLAST of GCR008 vs. Ensembl Medaka
Match: adra1aa (alpha-1A adrenergic receptor [Source:NCBI gene;Acc:101157705])

HSP 1 Score: 199.134 bits (505), Expect = 8.658e-58
Identity = 131/389 (33.68%), Postives = 208/389 (53.47%), Query Frame = 3
Query:   42 NETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLR-HFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYRRMIQR 1205
            N   +V+    + +F+ FG I GN LVI++V  + +L+T T YFIV+LA ADLL+   V+PF+ + E+  + W+FG+++C++W A DVL  TASI++LC+I+++RY   + PL     +T +  ++ + L+W  S  IS   +  W++ +   ++V  CK   +P Y   S++ SFY PL ++L +Y ++Y  A++    L++G++  E  D    +  V LR+H+G                                             T S   A + R HF L  +L+KF+ E+KAA+TLG V+G F+LCWLPFF+   + S      +F      D +  +  WLGY NSC+NPIIY  S + F+ AF  LL  ++  RM  R
Sbjct:   29 NTVKAVVLGMVLGIFILFGVI-GNILVILSVVCHRHLQTVTYYFIVNLAVADLLLSSTVLPFSAIFEI-LDRWVFGRVFCNIWAAVDVLCCTASIMSLCVISVDRYIGVSYPLRYPAIMTKRRALLAVMLLWVLSVIISIGPLFGWKEPAPEDETV--CKITEEPGYAIFSAVGSFYLPLAIILAMYCRVYVVAQKESRGLKEGQKT-EKSD----SEQVILRMHRGN-------------------------------------------TTVSEDEALRSRTHFAL--RLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVLPIGS------IFPAYRPSDTVFKITFWLGYFNSCINPIIYPCSNQEFKKAFQSLLG-VHCLRMTPR 356          
BLAST of GCR008 vs. Ensembl Medaka
Match: ENSORLT00000000867.2 (alpha-1A adrenergic receptor-like [Source:NCBI gene;Acc:101159125])

HSP 1 Score: 192.971 bits (489), Expect = 8.899e-55
Identity = 131/361 (36.29%), Postives = 189/361 (52.35%), Query Frame = 3
Query:   84 FLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFF----ICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRM 1154
            F++F  I GN LVI++V  N +LR+ TNYFI++LA ADLL+   V+P +   E+  + W+FG+I+CD+W A DVL  TASI++LC+I+I+RY     PL     +T +  ++ +  VW  S  IS   ++ W++     D+VC      +PFY   SS+ SFY PL ++L +Y ++Y  AKR    L+ G       D+A N+  + LRIH    R  Q                              + +LC     +            L  KL+KF+ E+KAA+TLG V+G FILCWLPFF    I +I +SL     LF+          ++ WLGY NSC+NPIIY    R F+ 
Sbjct:   61 FIAFA-IAGNILVILSVVCNRHLRSPTNYFIINLAIADLLLSTTVLPVSATLEV-LDYWVFGRIFCDIWAAVDVLCCTASIMSLCVISIDRYIGVRYPLQYPMIVTKRRALLAMLGVWILSFVISIGPLLGWKEPPSQDDTVCLIT--AEPFYALFSSLGSFYIPLGVILAMYCRVYVVAKRTTRNLEAGMM----KDRAENSNELTLRIH---CRNQQ------------------------------IQELC-----TQGGGGASSGRSALTVKLLKFSREKKAAKTLGVVVGMFILCWLPFFLVLPIGSISSSLRPPETLFK----------VIFWLGYFNSCLNPIIYPCYSREFKQ 365          
BLAST of GCR008 vs. Ensembl Medaka
Match: adrb3a (adrenoceptor beta 3a [Source:ZFIN;Acc:ZDB-GENE-080917-21])

HSP 1 Score: 188.734 bits (478), Expect = 2.125e-54
Identity = 133/368 (36.14%), Postives = 183/368 (49.73%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPF-AMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAII--WWRQS----SDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL-CP 1178
            T+ GN LVIIAVA    L+T TN FI+SLACADL+MG++V+P  A    +G+  W  G   CD+W + DVL  TASI  LC+IA++RY   T PL     L+     I++ LVW  S  ISF  I+  +W  S    ++ Y +   C F T+P Y   SSIVSFY PL++M+ +Y +++  A R +  + +                 R+R       A    N+                      P  C++       T   S   +     L K       E KA +TLG +MGTF +CWLPFF+ NI+N+       F+    GD +  L+ WLGY+NS +NPIIY  S   FR AF  L+ CP
Sbjct:   29 TVVGNLLVIIAVARTPQLQTSTNIFIMSLACADLIMGVLVVPLGASYVVIGK--WELGTTLCDIWTSIDVLCVTASIETLCVIAVDRYIAITRPLRHKVLLSKLRARIIVCLVWLVSTLISFVPIMQGYWHSSDHKATECYGNTTCCDFVTNPSYAISSSIVSFYIPLLIMIFVYTRVFVIAARQVKLIDRS----------------RMRFQNECPAAQIGANIL---------------------PSVCLSSSICNSATRKKSTKRRPSRLILVK-------EHKALKTLGIIMGTFTVCWLPFFVANIINA-------FKKDIPGDDLFRLLNWLGYINSGLNPIIYCRS-PEFRTAFKNLMGCP 342          
BLAST of GCR008 vs. Planmine SMEST
Match: SMESG000018302.1 (SMESG000018302.1)

HSP 1 Score: 788.875 bits (2036), Expect = 0.000e+0
Identity = 405/406 (99.75%), Postives = 406/406 (100.00%), Query Frame = 3
Query:   18 MNTICCFGNETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYRRMIQREINSSSFQAR 1235
            MNTICCFGNETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYISISSIVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGE+VIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQNSKNKSKWFSWKTKPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYRRMIQREINSSSFQAR
Sbjct:    1 MNTICCFGNETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYISISSIVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGERVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQNSKNKSKWFSWKTKPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYRRMIQREINSSSFQAR 406          
BLAST of GCR008 vs. Planmine SMEST
Match: SMESG000032972.1 (SMESG000032972.1)

HSP 1 Score: 223.016 bits (567), Expect = 6.957e-67
Identity = 116/221 (52.49%), Postives = 151/221 (68.33%), Query Frame = 3
Query:   87 LSFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWR----QSSDT----YDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGG 725
            L   TI GN LVI++V    NLRT TN+FIVSLACADLLMG VVMPF+  +EL    WIFG  WCD+WHAFDVLS+TASILNLCMIAIER+  T +P+  G  +++K CI+MI +VW CS+ ISFPAI+WW     Q + T     D    C+FP D  Y+ ISS +SFY PL++M+V+Y +IYRTA  ++  L  G +++    ++     +RL IH+GG
Sbjct:   28 LVLTTISGNILVIVSVIMERNLRTITNFFIVSLACADLLMGCVVMPFSAYSELSAGYWIFGYHWCDLWHAFDVLSSTASILNLCMIAIERFWATENPITYGSRMSHKRCIVMIAIVWMCSSLISFPAILWWHVMESQKNLTKILLVDRTTLCEFPDDKAYLIISSTISFYIPLIIMIVVYIRIYRTATTVMKTLTTGTKIVYKNSQS--GEVLRLGIHRGG 246          

HSP 2 Score: 117.087 bits (292), Expect = 4.710e-28
Identity = 55/93 (59.14%), Postives = 70/93 (75.27%), Query Frame = 3
Query:  897 TLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLC 1175
            +LGKK  KF  EQKAA+TLG VMG FI+CWLPFF+CNIL+++ N+      G     ++ +VTWLGY+NS +NP+IYAHSMR FR AFI +LC
Sbjct:  356 SLGKKFKKFAREQKAAKTLGIVMGIFIICWLPFFVCNILSAVYNEA----FGQSKGVVMIVVTWLGYINSAVNPMIYAHSMRDFRRAFIHILC 444          
BLAST of GCR008 vs. Planmine SMEST
Match: SMESG000005913.1 (SMESG000005913.1)

HSP 1 Score: 191.815 bits (486), Expect = 7.669e-55
Identity = 104/211 (49.29%), Postives = 139/211 (65.88%), Query Frame = 3
Query:   90 SFGTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKG 722
            S  TI GNSLVIIAV     LR+ TNYFIVSLA ADL+MGL+VMPFA+  E+ Q VWI+G +WCD WHA DV S+T SILNLC IA+ERY  T +P+L    ++ +     I  +W  SA ISFPAI+WW+   D   +   C F  D  Y+ +SSI+SFY PLV+M+ +Y+KIY+ A   +  L+ G +VI+D  +   +  + L +H+G
Sbjct:   37 SLLTILGNSLVIIAVLKERCLRSVTNYFIVSLAAADLVMGLIVMPFAVSEEILQGVWIYGSVWCDFWHATDVWSSTCSILNLCAIAVERYYATHNPILHAARISRQRSGFTIAGIWLFSAIISFPAILWWQARMDYPRNKNECPFTNDSSYLLLSSILSFYMPLVIMVFVYYKIYKIATDTLRSLKSGFRVIKDKSEH-GDTKIILNVHRG 246          

HSP 2 Score: 109.768 bits (273), Expect = 1.798e-25
Identity = 52/97 (53.61%), Postives = 70/97 (72.16%), Query Frame = 3
Query:  882 KLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            KL +   GK+   F  +Q+AA+TLG VMG F+LCWLPFF+CNIL ++D +  L         ++ +VTWLGY+NS +NPIIYAHSMR FRMAF+++L
Sbjct:  362 KLCNIISGKRAKNFLRDQRAAKTLGIVMGIFVLCWLPFFVCNILVAIDGE-ILKPNTKTSKIVITVVTWLGYVNSSINPIIYAHSMRDFRMAFVKIL 457          
BLAST of GCR008 vs. Planmine SMEST
Match: SMESG000022087.1 (SMESG000022087.1)

HSP 1 Score: 191.43 bits (485), Expect = 1.395e-54
Identity = 101/208 (48.56%), Postives = 137/208 (65.87%), Query Frame = 3
Query:   99 TIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKG 722
            TI GNSLVIIAV     LR+ TNYFIVSLA ADL+MGL+VMPFA+  E+ Q VW++G IWCD WHA DV S+T SILNLC IA+ERY  T +P+L    ++ +     I  +W  SA ISFPAI+WW+   D   +  +C F  D  Y+ +SSI+SFY PLV+M+ +Y+KIY+ A   +   + G +VI+   +   +  + L +H+G
Sbjct:   40 TILGNSLVIIAVLKERYLRSVTNYFIVSLAAADLVMGLIVMPFAVSEEILQGVWVYGSIWCDFWHATDVWSSTCSILNLCAIAVERYYATHNPILHAARISRQRSGFTIAGIWLFSAIISFPAILWWQARMDHPRNENACPFTNDSSYLLLSSILSFYMPLVIMIFVYYKIYKIATATLQSFKSGFRVIKSKSEK-GDTKIILNVHRG 246          

HSP 2 Score: 105.531 bits (262), Expect = 4.381e-24
Identity = 50/97 (51.55%), Postives = 68/97 (70.10%), Query Frame = 3
Query:  882 KLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            KL +   GK+      +Q+AA+TLG VMG F+LCWLPFF+CNIL ++D +  L         ++ +VTWLGY+NS +NPIIYAHSMR FR AF+++L
Sbjct:  362 KLFNMISGKRAKSLLRDQRAAKTLGIVMGIFVLCWLPFFVCNILVAIDGE-ILPPNTKTSKIVMSVVTWLGYVNSSINPIIYAHSMRDFRTAFVKIL 457          
BLAST of GCR008 vs. Planmine SMEST
Match: SMESG000017113.1 (SMESG000017113.1)

HSP 1 Score: 174.866 bits (442), Expect = 3.037e-48
Identity = 121/366 (33.06%), Postives = 184/366 (50.27%), Query Frame = 3
Query:   96 GTIFGNSLVIIAVASNSNLRTCTNYFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTTASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPAIIWWRQSSDTYDSVCSCKFPTDPFYXXXXXXVSFYAPLVLMLVLYWKIYRTAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQXXXXXXXXXXXXXXPMGISEPLSCVADLCSGPVTS-------SASIAFKLRHFTLGKKLIKFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDHILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLL 1172
            GT  GN LVI++VA    L+T +N+ IV+LAC+D L+ ++V+P A+   + +  W F +I CD++ +FDV+  T+SILNLC I+I+RY V T PL    + T     +MI + W  SA IS P +  W+++         C +  +  Y   ++  +FY PL++ML+LY +I++ A+ +                A N+  +++ I         +PNL      +       + P G          L SG + S       S S   KL + +  K  IK +TE KA  TLG +MG F +CWLPFFI  I   +     +         ++ +  WLGY NS +NPIIYA   R FR  F ++L
Sbjct:   51 GTAGGNLLVIMSVAIVKKLQTPSNFLIVNLACSDFLVSILVLPGAIHQTINRSRWPFSEILCDVFISFDVILCTSSILNLCAISIDRYLVITRPLQYAVNRTPARISLMIAISWIASALISIPPLFGWKETFIP----GQCSYSENLLYQIYATFGAFYIPLLVMLILYGRIFKLARVL----------------AQNDAKMKIGISPNSSDREHQPNL------RIVDSHLCSTPNG-----QMNLSLYSGSLVSIIKSTNFSESSQNKLNNRSRAK--IKSSTETKAITTLGVIMGCFTICWLPFFIIQIAKPILKVASVNSVNYFPIWLIEICLWLGYFNSFLNPIIYAKFNREFRTPFKQIL 383          
The following BLAST results are available for this feature:
BLAST of GCR008 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRA1B7.634e-6239.28adrenoceptor alpha 1B [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A3.011e-5534.63adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A3.255e-5534.90adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A6.143e-5535.08adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
ADRA1A6.143e-5535.08adrenoceptor alpha 1A [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of GCR008 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dop-42.444e-5832.25Dopamine receptor 4 [Source:UniProtKB/Swiss-Prot;... [more]
ser-22.728e-4029.28Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
octr-19.265e-3929.68OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-11.323e-3830.40OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
ser-21.651e-3729.32Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of GCR008 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop1R21.862e-7139.80gene:FBgn0266137 transcript:FBtr0085467[more]
Dop1R23.232e-7139.80gene:FBgn0266137 transcript:FBtr0085468[more]
Dop1R23.165e-6939.80gene:FBgn0266137 transcript:FBtr0330293[more]
5-HT73.891e-5032.89gene:FBgn0004573 transcript:FBtr0334508[more]
5-HT73.891e-5032.89gene:FBgn0004573 transcript:FBtr0085746[more]
back to top
BLAST of GCR008 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1bb2.154e-6337.33adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1bb2.403e-6237.07adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1aa9.753e-6236.68adrenoceptor alpha 1Aa [Source:ZFIN;Acc:ZDB-GENE-0... [more]
adra1ba6.701e-5835.57adrenoceptor alpha 1Ba [Source:ZFIN;Acc:ZDB-GENE-1... [more]
adra1d1.224e-5636.89adrenoceptor alpha 1D [Source:ZFIN;Acc:ZDB-GENE-09... [more]
back to top
BLAST of GCR008 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRA1D2.069e-5937.15adrenoceptor alpha 1D [Source:NCBI gene;Acc:100495... [more]
ENSXETT00000011711.11.419e-5835.53adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488... [more]
efr3b1.204e-5735.44EFR3 homolog B [Source:Xenbase;Acc:XB-GENE-6033491... [more]
ENSXETT00000046867.13.625e-4831.255-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
HTR1F6.447e-4530.545-hydroxytryptamine (serotonin) receptor 1F, G pro... [more]
back to top
BLAST of GCR008 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adra1b1.986e-6239.39adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
Adra1b7.066e-6239.39adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
Adra1b7.066e-6239.39adrenergic receptor, alpha 1b [Source:MGI Symbol;A... [more]
Adra1a2.224e-5535.00adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
Adra1a4.489e-5535.00adrenergic receptor, alpha 1a [Source:MGI Symbol;A... [more]
back to top
BLAST of GCR008 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q24563|DOPR2_DROME3.240e-7039.80Dopamine receptor 2 OS=Drosophila melanogaster OX=... [more]
sp|P97717|ADA1B_MOUSE3.218e-6138.20Alpha-1B adrenergic receptor OS=Mus musculus OX=10... [more]
sp|P35368|ADA1B_HUMAN3.666e-6139.28Alpha-1B adrenergic receptor OS=Homo sapiens OX=96... [more]
sp|P18841|ADA1B_MESAU4.943e-6139.39Alpha-1B adrenergic receptor OS=Mesocricetus aurat... [more]
sp|P15823|ADA1B_RAT8.330e-6139.39Alpha-1B adrenergic receptor OS=Rattus norvegicus ... [more]
back to top
BLAST of GCR008 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUK00.000e+0100.00GCR008 OS=Schmidtea mediterranea OX=79327 GN=gcr00... [more]
A0A1I8IYG71.944e-9546.13G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1I8FWQ22.161e-9446.45G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A2C9K6951.420e-9042.45G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
R7UH392.212e-8944.95G_PROTEIN_RECEP_F1_2 domain-containing protein (Fr... [more]
back to top
BLAST of GCR008 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1aa6.071e-6335.62alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
ADRA1D1.079e-5837.33adrenoceptor alpha 1D [Source:NCBI gene;Acc:103027... [more]
adra1ba1.442e-5835.57adrenoceptor alpha 1B [Source:NCBI gene;Acc:103033... [more]
adra1ab2.125e-5335.62alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
adrb2a3.306e-4932.90adrenoceptor beta 2 [Source:NCBI gene;Acc:10304118... [more]
back to top
BLAST of GCR008 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra1bb1.102e-4732.29adrenoceptor alpha 1Bb [Source:ZFIN;Acc:ZDB-GENE-0... [more]
HTR1F5.441e-4430.545-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000009127.16.816e-3542.61pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
ENSPMAT00000006953.12.537e-3229.28pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
ENSPMAT00000008360.13.650e-3137.88pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1... [more]
back to top
BLAST of GCR008 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR008 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352112.605e-3330.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372074.630e-3326.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340932.985e-3127.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473595.361e-3125.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438353.271e-2726.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR008 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006865.22.960e-6237.95alpha-1A adrenergic receptor [Source:NCBI gene;Acc... [more]
adra1d4.775e-6035.75adrenoceptor alpha 1D [Source:NCBI gene;Acc:101157... [more]
adra1aa8.658e-5833.68alpha-1A adrenergic receptor [Source:NCBI gene;Acc... [more]
ENSORLT00000000867.28.899e-5536.29alpha-1A adrenergic receptor-like [Source:NCBI gen... [more]
adrb3a2.125e-5436.14adrenoceptor beta 3a [Source:ZFIN;Acc:ZDB-GENE-080... [more]
back to top
BLAST of GCR008 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018302.10.000e+099.75SMESG000018302.1[more]
SMESG000032972.16.957e-6752.49SMESG000032972.1[more]
SMESG000005913.17.669e-5549.29SMESG000005913.1[more]
SMESG000022087.11.395e-5448.56SMESG000022087.1[more]
SMESG000017113.13.037e-4833.06SMESG000017113.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026385 ID=SMED30026385|Name=GCR008|organism=Schmidtea mediterranea sexual|type=transcript|length=1467bp
AGAGAATAAATTGACGGATGAATACGATTTGTTGTTTTGGAAATGAAACT
GTCAGTGTAATCAGCATAGCCTCAATTAAAATGTTCCTGTCATTCGGAAC
AATCTTCGGAAATAGTTTGGTCATTATAGCAGTAGCCAGTAATTCCAATT
TGAGAACTTGTACAAATTATTTCATCGTGTCGTTGGCTTGCGCAGATCTG
CTAATGGGGTTGGTCGTTATGCCTTTTGCAATGCTCAATGAGCTTGGACA
AGAGGTTTGGATATTTGGTCAAATCTGGTGTGACATGTGGCACGCGTTTG
ACGTTCTTAGTACCACTGCAAGTATATTGAATCTTTGTATGATTGCGATA
GAAAGATACAAAGTAACCACAAGTCCTCTTTTGGCCGGCCGTCACTTAAC
AAACAAAAACTGTATAATCATGATTTTTCTCGTATGGTTTTGTTCGGCTT
GCATATCCTTTCCAGCGATCATATGGTGGAGACAAAGTTCTGATACATAT
GATTCAGTTTGTTCTTGTAAATTTCCAACTGATCCATTTTATATTTCTAT
TTCTTCGATTGTTTCCTTCTATGCACCTCTTGTTTTAATGTTGGTTCTTT
ATTGGAAAATATACCGAACCGCAAAACGAATGATAATTTGTCTACAGAAA
GGCGAACAAGTAATTGAAGACGGAGACAAAGCTTTAAACAATCCTCCGGT
AAGATTAAGAATTCATAAAGGCGGATTTAGGGCTCTTCAAAAACCAAATT
TGTATCAAAATAGTAAAAATAAATCAAAATGGTTTTCTTGGAAAACGAAA
CCAATGGGAATATCTGAACCTTTGAGTTGTGTAGCAGATCTATGCAGTGG
TCCCGTAACGTCTTCGGCTTCTATAGCATTTAAATTGAGACATTTCACTT
TAGGTAAAAAATTAATTAAATTTAACACCGAACAAAAAGCAGCAAGAACT
CTTGGATTTGTAATGGGGACTTTTATCTTGTGTTGGTTGCCTTTTTTCAT
TTGCAATATTCTCAATTCACTAGATAATCAGAATAAATTATTTCGAACCG
GATCCATTGGAGATCATATTCTACCGCTCGTCACATGGTTGGGCTATCTC
AACTCATGCATGAATCCAATTATCTATGCCCATTCTATGAGACATTTTAG
AATGGCATTTATACGGCTGCTATGCCCAATATATTATCGTCGAATGATTC
AAAGAGAAATTAACAGTAGTAGTTTTCAAGCCCGTCTATTGTAAATTGTC
CTTGATAATTTGAAATGACTTCAAACTCTTTGAGAAAAACAAACCAAAAG
GTATCCAATAATTAATCTTTTAGGAAAAAGTTGTTTTAATTGAGATTCGT
TTTTGTTTAAATGGATTTTAATAGAAAAATCATGATATATATAAATATAT
ACAGTATACATGTATATATGCTGGTAGTAGAGAACGTGAAAAGAGAAAAT
TATGGCATTTGTCGAAC
back to top

protein sequence of SMED30026385-orf-1

>SMED30026385-orf-1 ID=SMED30026385-orf-1|Name=SMED30026385-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=409bp
MNTICCFGNETVSVISIASIKMFLSFGTIFGNSLVIIAVASNSNLRTCTN
YFIVSLACADLLMGLVVMPFAMLNELGQEVWIFGQIWCDMWHAFDVLSTT
ASILNLCMIAIERYKVTTSPLLAGRHLTNKNCIIMIFLVWFCSACISFPA
IIWWRQSSDTYDSVCSCKFPTDPFYISISSIVSFYAPLVLMLVLYWKIYR
TAKRMIICLQKGEQVIEDGDKALNNPPVRLRIHKGGFRALQKPNLYQNSK
NKSKWFSWKTKPMGISEPLSCVADLCSGPVTSSASIAFKLRHFTLGKKLI
KFNTEQKAARTLGFVMGTFILCWLPFFICNILNSLDNQNKLFRTGSIGDH
ILPLVTWLGYLNSCMNPIIYAHSMRHFRMAFIRLLCPIYYRRMIQREINS
SSFQARLL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 131..152
score: 23.28
coord: 176..199
score: 28.8
coord: 49..70
score: 41.77
coord: 95..117
score: 33.24
coord: 16..40
score: 24.63
coord: 352..378
score: 36.54
coord: 308..332
score: 35.84
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 24..385
e-value: 8.5E-5
score: -38.8
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 31..370
e-value: 2.2E-76
score: 256.6
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 24..382
e-value: 1.7E-99
score: 335.4
NoneNo IPR availableGENE3DG3DSA:1.20.120.10coord: 207..299
e-value: 1.7E-99
score: 335.4
NoneNo IPR availablePANTHERPTHR24247:SF1985-HYDROXYTRYPTAMINE RECEPTOR 2A-RELATEDcoord: 13..386
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 13..386
NoneNo IPR availableCDDcd150677tmA_Dop1R2-likecoord: 23..381
e-value: 1.44819E-104
score: 308.131
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 12..395
NoneNo IPR availableTMHMMTMhelixcoord: 174..196
NoneNo IPR availableTMHMMTMhelixcoord: 350..372
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 132..154
NoneNo IPR availableTMHMMTMhelixcoord: 313..335
NoneNo IPR availableTMHMMTMhelixcoord: 50..72
NoneNo IPR availableTMHMMTMhelixcoord: 92..111
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 31..370
score: 42.378