Thiosulfate sulfurtransferase rhodanese-like domain-containing 1

Overview
NameThiosulfate sulfurtransferase rhodanese-like domain-containing 1
Smed IDSMED30026369
Length (bp)2118
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 (SMED30026369) t-SNE clustered cells

Violin plots show distribution of expression levels for Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 (SMED30026369) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 (SMED30026369) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 (SMED30026369) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026369

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30026369h1SMcG0001945 Contig42188uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026369h1SMcG0001945 Contig42188newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30026369h1SMcG0001945 dd_Smed_v4_530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026369h1SMcG0001945 dd_Smed_v4_530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026369h1SMcG0001945 dd_Smed_v4_530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026369h1SMcG0001945 dd_Smed_v4_530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026369h1SMcG0001945 dd_Smed_v4_530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30026369h1SMcG0001945 dd_Smed_v4_530_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Human
Match: TSTD1 (thiosulfate sulfurtransferase like domain containing 1 [Source:HGNC Symbol;Acc:HGNC:35410])

HSP 1 Score: 80.1073 bits (196), Expect = 2.300e-17
Identity = 37/108 (34.26%), Postives = 69/108 (63.89%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            +S  +L +L+  GR  L DVR + +   +G IP A++IP+++L+S+LQ+    F+  +  +KP+L+ E+++F+     +   A ++A S+GY  AR++ G ++EW EK
Sbjct:    7 VSLPELRSLLASGRARLFDVRSREE-AAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEK 113          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Human
Match: TSTD1 (thiosulfate sulfurtransferase like domain containing 1 [Source:HGNC Symbol;Acc:HGNC:35410])

HSP 1 Score: 80.1073 bits (196), Expect = 2.579e-17
Identity = 37/108 (34.26%), Postives = 69/108 (63.89%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            +S  +L +L+  GR  L DVR + +   +G IP A++IP+++L+S+LQ+    F+  +  +KP+L+ E+++F+     +   A ++A S+GY  AR++ G ++EW EK
Sbjct:   14 VSLPELRSLLASGRARLFDVRSREE-AAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEK 120          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Human
Match: B3GNT5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:15684])

HSP 1 Score: 72.0182 bits (175), Expect = 8.497e-13
Identity = 54/171 (31.58%), Postives = 89/171 (52.05%), Query Frame = 3
Query:  333 RTAIRQTWA------SRLDANI--IFVTGYFSKSQGE-LSR-LSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSE---SYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            R+ IR+TW       S+L+ANI  +F  G  +  +GE L R L+ E + + DI+  D  +  +  T+K++  F+   +     K     L+  +DD+FI+  NL  +L+S      +D   G++      +RD   KYYVS+  Y  PA+P Y  G   VI+GD+  +V++
Sbjct:  104 RSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKF----LMTADDDIFIHMPNLIEYLQSLEQIGVQDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYE 270          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Human
Match: B3GNT5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:15684])

HSP 1 Score: 72.0182 bits (175), Expect = 8.497e-13
Identity = 54/171 (31.58%), Postives = 89/171 (52.05%), Query Frame = 3
Query:  333 RTAIRQTWA------SRLDANI--IFVTGYFSKSQGE-LSR-LSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSE---SYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            R+ IR+TW       S+L+ANI  +F  G  +  +GE L R L+ E + + DI+  D  +  +  T+K++  F+   +     K     L+  +DD+FI+  NL  +L+S      +D   G++      +RD   KYYVS+  Y  PA+P Y  G   VI+GD+  +V++
Sbjct:  104 RSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKF----LMTADDDIFIHMPNLIEYLQSLEQIGVQDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYE 270          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Human
Match: B3GNT5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:HGNC Symbol;Acc:HGNC:15684])

HSP 1 Score: 72.0182 bits (175), Expect = 8.497e-13
Identity = 54/171 (31.58%), Postives = 89/171 (52.05%), Query Frame = 3
Query:  333 RTAIRQTWA------SRLDANI--IFVTGYFSKSQGE-LSR-LSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSE---SYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            R+ IR+TW       S+L+ANI  +F  G  +  +GE L R L+ E + + DI+  D  +  +  T+K++  F+   +     K     L+  +DD+FI+  NL  +L+S      +D   G++      +RD   KYYVS+  Y  PA+P Y  G   VI+GD+  +V++
Sbjct:  104 RSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKF----LMTADDDIFIHMPNLIEYLQSLEQIGVQDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYE 270          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 63.5438 bits (153), Expect = 1.487e-10
Identity = 54/186 (29.03%), Postives = 99/186 (53.23%), Query Frame = 3
Query:  282 HSNIYIYVLSSSVRRGIRTAIRQTWAS-----RLDANIIFVTGYFSKSQGELSR--LSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTH-FLSLKETE-KLSEFRLIITEDDVFINPWNLENFL--KSESYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            ++ + I +LS++    IR AIR+TWA+      +  N + ++   SK+  E     L +E E F D++V D      + + +++ +  H  LS K++  +L++F+L I +DD+ ++   L   L  K ++  + I G I +N   VR+ K ++YV    YS   FPPY +G + +I  + V R+ +
Sbjct:   84 NTKLQITILSTAGNFDIRQAIRETWANPNNSEHVANNDVRISFIISKTSNEFLNFALQKEIEKFDDMIVTD-----LYESYELLILKVHAILSYKQSHCQLADFQLKI-DDDMAVDMDGLYRSLEDKKQASINGISGIIWKNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLE 263          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Celegans
Match: B0024.15 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q8MQG4])

HSP 1 Score: 63.5438 bits (153), Expect = 1.487e-10
Identity = 54/186 (29.03%), Postives = 99/186 (53.23%), Query Frame = 3
Query:  282 HSNIYIYVLSSSVRRGIRTAIRQTWAS-----RLDANIIFVTGYFSKSQGELSR--LSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTH-FLSLKETE-KLSEFRLIITEDDVFINPWNLENFL--KSESYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            ++ + I +LS++    IR AIR+TWA+      +  N + ++   SK+  E     L +E E F D++V D      + + +++ +  H  LS K++  +L++F+L I +DD+ ++   L   L  K ++  + I G I +N   VR+ K ++YV    YS   FPPY +G + +I  + V R+ +
Sbjct:   84 NTKLQITILSTAGNFDIRQAIRETWANPNNSEHVANNDVRISFIISKTSNEFLNFALQKEIEKFDDMIVTD-----LYESYELLILKVHAILSYKQSHCQLADFQLKI-DDDMAVDMDGLYRSLEDKKQASINGISGIIWKNSPPVREKKHRWYVPKTLYSEKFFPPYIDGPIYLIGKNAVPRMLE 263          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Celegans
Match: F14B6.4 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O62163])

HSP 1 Score: 58.151 bits (139), Expect = 9.583e-9
Identity = 56/195 (28.72%), Postives = 90/195 (46.15%), Query Frame = 3
Query:  285 SNIYIYVLSSSVRRGIRTAIRQTWASRLDANII--------FVTGYFSKSQGELSRLS----EEAEVFKDILVVD---SEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLI--ITEDDVF----INPWNLENFLKSESYKDEIYGQII-ENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVF 803
            S I + V S +     R  +R+TW +  ++ II        F+ G    + G+ SR+     EEA ++ D++VVD   + E+  F ++  +        L  T K SEF+LI  I ED +F    I P   +N +   S  + IYG +  E   V RD + +++V    Y    FPPY  G   ++  D  K++ 
Sbjct:   88 SEILMIVASRTDSFARRNVLRKTWMNPENSEIIKDGRMKALFLVGM---TDGDDSRMRKVVMEEARIYGDMVVVDLKDTYEELPFKSLTTL--------LYGTSKASEFKLIGKIDEDIMFFPDKILPLLEQNLIDPSS--ESIYGMLFAEGGYVYRDKEHRWFVPDSTYGCDMFPPYTGGLFYLVTQDAAKKIL 269          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Celegans
Match: T15D6.5 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q9XU74])

HSP 1 Score: 57.7658 bits (138), Expect = 1.571e-8
Identity = 50/171 (29.24%), Postives = 84/171 (49.12%), Query Frame = 3
Query:  312 SSVRRGIRTAIRQTWASRLDANII--------FVTGYFSKSQGELSRLSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIIT-EDDVFINPWNL-----ENFLKSESYKDEIYGQIIENDQ-VVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVIN 779
             SV R  R  +R+TW ++ ++ II        F+ G  +  +  +  + +EAE F DI+V++ E+       K++++      L  T K S+F++I   +DDV   P  L     EN + S SY   IYG + ++D+ VVR+    +YV    Y+   +P Y  G   +I 
Sbjct:  137 GSVSR--RKVLRKTWMNKANSKIIRNGRMQVLFLVGMVAGDRDLMKAVKKEAESFGDIIVMNLEDTYDNLPFKVLSLL-----LYGTNKASDFKIIGKIDDDVIFFPDRLTPLLDENVIDSSSY--SIYGYLSQDDELVVRNETKPWYVPETAYNCTKYPVYALGPFYLIT 298          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Celegans
Match: C47F8.3 (Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:G5ECA6])

HSP 1 Score: 52.373 bits (124), Expect = 6.619e-7
Identity = 48/181 (26.52%), Postives = 83/181 (45.86%), Query Frame = 3
Query:  288 NIYIYVLSSSVRRGIRTAIRQTWASRLDANI--------IFVTGYFSKSQGELSRLSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIIT-EDDVFINPWNL-----ENFLKSESYKDEIYGQIIENDQ-VVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGD 785
            +I + V+S +     R  +R TW ++ ++ +        +F  G     Q     + EEAE+  D++VVD E+     T   +   T  L L  T K S+F++I   +DDV   P  L      NF+ S +    IYG +   ++ V+R+  + +YV    Y+   +P Y  G + ++  D
Sbjct:   89 DILMLVVSKTKNFARRNVLRSTWMNKENSEMMKSGRMHALFFVGLVPGDQNLKKLVLEEAEIHGDMVVVDLED-----TYDNLPFKTLALLLYGTSKASQFKIIGKIDDDVMFFPDQLLPMLDRNFVNSNTL--SIYGHLSTAEELVLRNKTEPWYVPETAYNCTVYPVYVMGPIYLVTKD 262          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Fly
Match: CG4456 (gene:FBgn0001228 transcript:FBtr0100655)

HSP 1 Score: 70.0922 bits (170), Expect = 2.794e-14
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 2
Query: 1322 EDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            E + ++ +   + LIDVR K +++++G IP++I+IPL++L  +L L  + FK+ +G  KPE QS  IIF      +   A +IA S GY     + G + EW++K
Sbjct:    5 EQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSP-IIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQK 108          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Fly
Match: CG4456 (gene:FBgn0001228 transcript:FBtr0303474)

HSP 1 Score: 70.0922 bits (170), Expect = 2.794e-14
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 2
Query: 1322 EDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            E + ++ +   + LIDVR K +++++G IP++I+IPL++L  +L L  + FK+ +G  KPE QS  IIF      +   A +IA S GY     + G + EW++K
Sbjct:    5 EQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSP-IIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQK 108          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Fly
Match: CG4456 (gene:FBgn0001228 transcript:FBtr0100653)

HSP 1 Score: 70.0922 bits (170), Expect = 2.794e-14
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 2
Query: 1322 EDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            E + ++ +   + LIDVR K +++++G IP++I+IPL++L  +L L  + FK+ +G  KPE QS  IIF      +   A +IA S GY     + G + EW++K
Sbjct:    5 EQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSP-IIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQK 108          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Fly
Match: CG4456 (gene:FBgn0001228 transcript:FBtr0303473)

HSP 1 Score: 70.0922 bits (170), Expect = 2.794e-14
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 2
Query: 1322 EDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            E + ++ +   + LIDVR K +++++G IP++I+IPL++L  +L L  + FK+ +G  KPE QS  IIF      +   A +IA S GY     + G + EW++K
Sbjct:    5 EQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSP-IIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQK 108          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Fly
Match: CG8673 (gene:FBgn0031986 transcript:FBtr0079575)

HSP 1 Score: 69.3218 bits (168), Expect = 4.819e-12
Identity = 48/185 (25.95%), Postives = 87/185 (47.03%), Query Frame = 3
Query:  267 PQRIRHSNIYIYVLSSSVRRGIRTAIRQTW---ASRLDANIIFVTGYFSKSQGELSRLSEEAEVFKDIL---VVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSESYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVF 803
            PQ+   + + + + SS      R +IRQTW    SR D  + FV G   K++     + +E  +++D++    +DS       TI +       L   +        ++ T+DD+FIN   L   + +      IYG+  EN + +R+   KY++S+ +Y  P FP +  G   ++ GD+V  ++
Sbjct:  166 PQKGLSTQLLVLITSSLRHSAARMSIRQTWMHYGSRRDVGMAFVLGK-GKNKSVKKAIDQEDFMYQDLIRGHFIDSYNNLTLKTISL-------LEWADLHCPKAKYVLKTDDDMFINVPKLLTLISTLKANRTIYGRRAENWKPIRNRWSKYHISNAQYGKPTFPYFTTGPAYLLTGDIVHALY 342          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Zebrafish
Match: si:dkey-165n16.1 (si:dkey-165n16.1 [Source:ZFIN;Acc:ZDB-GENE-100922-224])

HSP 1 Score: 95.5153 bits (236), Expect = 3.155e-22
Identity = 45/111 (40.54%), Postives = 73/111 (65.77%), Query Frame = 2
Query: 1310 EISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEKGL 1642
            ++S E L  L+  G  ++IDVRE  ++ + G I  +I++PL ++  +LQL+  EFK+ +G D P  +S+NI+F  L  ++S  A E A S+GY K + FPGG++EW+E+ L
Sbjct:   65 DVSYEQLKKLLVSGSSVVIDVREPWELREYGNIQGSINVPLGQVNGALQLTPDEFKEKYGGDMPS-KSQNIVFSCLAGVRSKHALEAAVSLGYTKVQHFPGGWQEWAEREL 174          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Zebrafish
Match: BX537102.2 (si:dkey-34l15.1 [Source:NCBI gene;Acc:563265])

HSP 1 Score: 88.5817 bits (218), Expect = 1.330e-20
Identity = 42/110 (38.18%), Postives = 65/110 (59.09%), Query Frame = 2
Query: 1307 NEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            N+IS  DL +++  G  +L+DVR   ++ + G IP +IHIP+  +   L L   EF+  FG  KP L    ++F+     +  +A E A S+G+K AR++ G +KEWSEK
Sbjct:    6 NDISYSDLKSILAKGSAVLVDVRTNEEVAR-GTIPGSIHIPVGNIGQDLSLDAAEFQSKFGVGKPPLDCTELVFFCQLGRRGAAATEKAKSLGFKNARNYAGAYKEWSEK 114          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Zebrafish
Match: TSTD1 (si:dkey-34l15.1 [Source:ZFIN;Acc:ZDB-GENE-081107-63])

HSP 1 Score: 88.5817 bits (218), Expect = 1.583e-20
Identity = 43/110 (39.09%), Postives = 66/110 (60.00%), Query Frame = 2
Query: 1307 NEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            N+IS  DL +L+  G ++L+DVR   ++ + G IP +IHIP+  +   L L   EF+  FG  KP L    ++F+     +  +A E A S+G+K AR++ G +KEWSEK
Sbjct:    6 NDISYSDLKSLLAKGSVVLVDVRTNEEVAR-GTIPGSIHIPVGNVGQDLSLDAAEFQSKFGVGKPPLDCTELVFFCQLGRRGAAATEKAKSLGFKNARNYAGAYKEWSEK 114          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Zebrafish
Match: CABZ01058650.1 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 [Source:NCBI gene;Acc:561325])

HSP 1 Score: 86.6557 bits (213), Expect = 1.890e-19
Identity = 39/108 (36.11%), Postives = 67/108 (62.04%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            ++ E L +++  GR+ LIDVRE  ++  +G IP A +IPL +L+ +L L   +F+  +G  KP     +I+ Y  + ++S +A EIA  + Y +AR + GG+ EW+E+
Sbjct:   49 VTYEQLKHMMSTGRVQLIDVREPDEL-TAGFIPGATNIPLGELEEALTLDPDQFRQRYGVSKPHPDDSDIVLYCQRGVRSLNALEIAIRLEYSRARHYVGGYSEWAER 155          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Zebrafish
Match: si:ch211-161h7.8 (si:ch211-161h7.8 [Source:ZFIN;Acc:ZDB-GENE-091204-302])

HSP 1 Score: 73.559 bits (179), Expect = 1.315e-14
Identity = 34/108 (31.48%), Postives = 65/108 (60.19%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            ++ E L  ++ +  + L DVR   D  ++G IP ++++PL +L+ SL+L   +F++ F    P+   +NI+F+     +S +A E A+ +G+ KAR + GG+ +W E+
Sbjct:   71 VTYEQLKGMLANHSVQLFDVRNP-DEFQAGRIPDSVNVPLGELEVSLKLPAEKFEEQFKVKAPQKADDNIVFHCRSGKRSLTALETAHRLGFSKARHYAGGYIDWEER 177          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000042802.1 (thiosulfate sulfurtransferase (rhodanese)-like domain containing 3 [Source:NCBI gene;Acc:100486879])

HSP 1 Score: 74.3294 bits (181), Expect = 8.189e-15
Identity = 35/106 (33.02%), Postives = 66/106 (62.26%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWS 1630
            I  E+L +L+ +  +++IDVRE  ++++ G+I  ++ IP+  L S+LQL    F+  +    PE ++  +IF  L  I+S  A ++A S+G+K+   + GGF++W+
Sbjct:   53 IKYEELKDLLKEEGVVIIDVREPWEVKEYGVIKGSLSIPMGDLASALQLDPLTFEKKYQVKMPE-KTSTLIFSCLAGIRSKKAVDVAGSLGFKRVHHYAGGFEDWA 157          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Xenopus
Match: B3GNT9 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 9 [Source:HGNC Symbol;Acc:HGNC:28714])

HSP 1 Score: 65.855 bits (159), Expect = 1.109e-10
Identity = 50/167 (29.94%), Postives = 87/167 (52.10%), Query Frame = 3
Query:  333 RTAIRQTWA-----SRLDANIIFVTGYFSKSQGELSR----LSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITED-DVFINPWNLENFLKSESYKDEIY-GQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRV 800
            R ++R+TW      S +    +F+ G   K++  +S     + +E+  +KDIL+ D  +  F  T+K I    HFLS  E E     + I   D DVF+N  NL N+L++++  ++++ G II   + +R  K KYY+    Y    +PPY  G   +++G  +K++
Sbjct:  146 RESVRKTWGREGMISGVRVQRVFLLGT-PKNKTAVSMWESLMHQESHYYKDILLWDFIDTFFNLTLKEI----HFLSWAE-EFCGNVKFIFKGDADVFVNVENLINYLQNQNASEDLFVGDIINQARPIRSKKSKYYIPETMYGLGLYPPYAGGGGFLMSGITMKKL 306          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Xenopus
Match: B3GNT4 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Source:NCBI gene;Acc:100491670])

HSP 1 Score: 62.3882 bits (150), Expect = 1.019e-9
Identity = 54/168 (32.14%), Postives = 79/168 (47.02%), Query Frame = 3
Query:  333 RTAIRQTWASRLDAN-----IIFVTG-----YFSKSQGELSRLSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKS-ESYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVF 803
            R AIR TW  + D       ++F+ G       +KS  +L  LS E+  FKD++  D  +  F  T+K I    H L     E      ++  +DDVFIN +N+  FL      KD   G +I N   +R+TK KY++ H  YS P +P Y  G   V++    K + 
Sbjct:  118 RIAIRNTWGKQQDIQSKKIKLLFLLGKTDSTLPAKSLRQL--LSYESIEFKDLIQWDFVDNFFNLTLKEI----HLLRWLNKECSHAKFVLKGDDDVFINTFNIVEFLDGLNPDKDLFVGDVITNAVPIRNTKVKYFIPHSMYSAPHYPLYAGGGGYVMSRKTTKGLL 279          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Xenopus
Match: ENSXETT00000027493.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:7556014:7559433:-1 gene:ENSXETG00000012877.1 transcript:ENSXETT00000027493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 3.068e-9
Identity = 46/161 (28.57%), Postives = 73/161 (45.34%), Query Frame = 3
Query:  333 RTAIRQTWASRLDANIIFVTGYFSKSQGELSRLSEE----AEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNL-ENFLKSESYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRV 800
            R  IRQTW          V+ YF    G   RL EE    +  + DI+  D  +  +  T+K I M   ++    T       ++ T+ D+F+NP  L E  +K     D   G +  +D  +RD   K+Y+S  EY    +PP+ +G   V + D+ +R+
Sbjct:   49 RNVIRQTWGKERLIGDKLVSTYFLLGAGTNPRLQEELIEESNTYNDIIQRDFIDSYYNLTLKTI-MGIEWIC---THCPQTTFVMKTDTDMFVNPLYLVELLVKKNQTTDLFTGSLRLHDAPIRDINSKWYISTAEYPQAKYPPFCSGTGYVFSVDVAQRI 205          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Xenopus
Match: wdr19 (WD repeat domain 19 [Source:Xenbase;Acc:XB-GENE-920013])

HSP 1 Score: 57.3806 bits (137), Expect = 2.138e-8
Identity = 45/175 (25.71%), Postives = 80/175 (45.71%), Query Frame = 3
Query:  291 IYIYVLSSSVRRGIRTAIRQTWASRLDANIIFVTGYFSKSQGELSRLSEE----AEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSESYKDEIY-GQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRV 800
            + + V ++  ++  R  IRQTW          V+ YF    G   RL EE    +  + DI+  D  +  +  T+K I M   ++    T       ++ T+ D+F+NP  L   L  ++    ++ G +  +D  VRD   K+Y+S  EY    +PP+ +G     + D+ +R+
Sbjct:   18 LVLLVTTTHSQKEERNVIRQTWGKERLIGDKLVSTYFLLGAGTNPRLQEELTGESNTYNDIIQRDFIDSYYNLTLKTI-MGIEWIC---THCPQTTFVMKTDTDMFVNPLYLVELLVKKNQTTNLFTGSLKPHDAPVRDINSKWYISTTEYPLAKYPPFCSGTGYAFSVDVAQRI 188          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Mouse
Match: Tstd3 (thiosulfate sulfurtransferase (rhodanese)-like domain containing 3 [Source:MGI Symbol;Acc:MGI:1924282])

HSP 1 Score: 77.0258 bits (188), Expect = 5.609e-16
Identity = 36/105 (34.29%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEW 1627
            ++  +L +L++   I+LIDVR  ++I + G IP +I+IPL+++  +LQ++  +FK+ +   KP  +S+ ++F  L  ++S  A + A S+G+  A+ + GG+KEW
Sbjct:   42 VTYRELKSLLNSKDIMLIDVRNTLEILEQGKIPGSINIPLDEVGEALQMNPVDFKEKYCQVKPS-KSDRLVFSCLAGVRSKKAMDTAISLGFNSAQHYAGGWKEW 145          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Mouse
Match: Tstd1 (thiosulfate sulfurtransferase (rhodanese)-like domain containing 1 [Source:MGI Symbol;Acc:MGI:3648482])

HSP 1 Score: 74.7146 bits (182), Expect = 1.918e-15
Identity = 36/108 (33.33%), Postives = 65/108 (60.19%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            +S  +L +L+  GR  L DVR   +   +G IP A++IP+++L+ +L +    F+  +  +KP+L+ +N+IF+     +   A ++A  +GY  AR++ G +KEW EK
Sbjct:   25 VSFSELRSLVASGRARLFDVRSPEE-AAAGTIPGALNIPVSELEIALNMDPAAFQTLYCAEKPKLEDKNLIFFCQMGRRGLQATQLAQGLGYTGARNYAGAYKEWLEK 131          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Mouse
Match: B3gnt5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:MGI Symbol;Acc:MGI:2137302])

HSP 1 Score: 67.781 bits (164), Expect = 1.420e-11
Identity = 56/185 (30.27%), Postives = 91/185 (49.19%), Query Frame = 3
Query:  297 IYVLSSSVRRGIRTAIRQTWA------SRLDANI--IFVTGYFSKSQG-ELS-RLSEEAEVFKDILVVDSEEQCFFH--TIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSE---SYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            +++ ++    G R+AIR+TW       S+L+ANI  +F  G     +G EL  RL  E +V+KDI+  D  +   FH  T K +  F+   +     K     L+  +DD+FI+  NL  +L+       +D   G +      VRD   KYYV +  Y  PA+P Y  G   V++ D+  ++++
Sbjct:   90 LFIKTAPENYGRRSAIRKTWGNENYVQSQLNANIKILFALGTPGPLKGKELQKRLIGEDQVYKDIIQQDFIDS--FHNLTSKFLLQFSWANTFCPHAKF----LMTADDDIFIHMPNLIEYLQGLEQIGVRDFWIGHVHRGGPPVRDKSSKYYVPYEMYKWPAYPDYTAGAAYVVSRDVAAKIYE 268          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Mouse
Match: B3gnt5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:MGI Symbol;Acc:MGI:2137302])

HSP 1 Score: 67.781 bits (164), Expect = 1.420e-11
Identity = 56/185 (30.27%), Postives = 91/185 (49.19%), Query Frame = 3
Query:  297 IYVLSSSVRRGIRTAIRQTWA------SRLDANI--IFVTGYFSKSQG-ELS-RLSEEAEVFKDILVVDSEEQCFFH--TIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSE---SYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            +++ ++    G R+AIR+TW       S+L+ANI  +F  G     +G EL  RL  E +V+KDI+  D  +   FH  T K +  F+   +     K     L+  +DD+FI+  NL  +L+       +D   G +      VRD   KYYV +  Y  PA+P Y  G   V++ D+  ++++
Sbjct:   90 LFIKTAPENYGRRSAIRKTWGNENYVQSQLNANIKILFALGTPGPLKGKELQKRLIGEDQVYKDIIQQDFIDS--FHNLTSKFLLQFSWANTFCPHAKF----LMTADDDIFIHMPNLIEYLQGLEQIGVRDFWIGHVHRGGPPVRDKSSKYYVPYEMYKWPAYPDYTAGAAYVVSRDVAAKIYE 268          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Mouse
Match: B3gnt5 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Source:MGI Symbol;Acc:MGI:2137302])

HSP 1 Score: 67.781 bits (164), Expect = 1.420e-11
Identity = 56/185 (30.27%), Postives = 91/185 (49.19%), Query Frame = 3
Query:  297 IYVLSSSVRRGIRTAIRQTWA------SRLDANI--IFVTGYFSKSQG-ELS-RLSEEAEVFKDILVVDSEEQCFFH--TIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSE---SYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            +++ ++    G R+AIR+TW       S+L+ANI  +F  G     +G EL  RL  E +V+KDI+  D  +   FH  T K +  F+   +     K     L+  +DD+FI+  NL  +L+       +D   G +      VRD   KYYV +  Y  PA+P Y  G   V++ D+  ++++
Sbjct:   90 LFIKTAPENYGRRSAIRKTWGNENYVQSQLNANIKILFALGTPGPLKGKELQKRLIGEDQVYKDIIQQDFIDS--FHNLTSKFLLQFSWANTFCPHAKF----LMTADDDIFIHMPNLIEYLQGLEQIGVRDFWIGHVHRGGPPVRDKSSKYYVPYEMYKWPAYPDYTAGAAYVVSRDVAAKIYE 268          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. UniProt/SwissProt
Match: sp|Q8NFU3|TSTD1_HUMAN (Thiosulfate:glutathione sulfurtransferase OS=Homo sapiens OX=9606 GN=TSTD1 PE=1 SV=3)

HSP 1 Score: 80.1073 bits (196), Expect = 1.105e-16
Identity = 37/108 (34.26%), Postives = 69/108 (63.89%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            +S  +L +L+  GR  L DVR + +   +G IP A++IP+++L+S+LQ+    F+  +  +KP+L+ E+++F+     +   A ++A S+GY  AR++ G ++EW EK
Sbjct:    7 VSLPELRSLLASGRARLFDVRSREE-AAAGTIPGALNIPVSELESALQMEPAAFQALYSAEKPKLEDEHLVFFCQMGKRGLQATQLARSLGYTGARNYAGAYREWLEK 113          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. UniProt/SwissProt
Match: sp|Q9D0B5|TSTD3_MOUSE (Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Tstd3 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 3.923e-15
Identity = 36/105 (34.29%), Postives = 69/105 (65.71%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEW 1627
            ++  +L +L++   I+LIDVR  ++I + G IP +I+IPL+++  +LQ++  +FK+ +   KP  +S+ ++F  L  ++S  A + A S+G+  A+ + GG+KEW
Sbjct:   42 VTYRELKSLLNSKDIMLIDVRNTLEILEQGKIPGSINIPLDEVGEALQMNPVDFKEKYCQVKPS-KSDRLVFSCLAGVRSKKAMDTAISLGFNSAQHYAGGWKEW 145          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. UniProt/SwissProt
Match: sp|P22978|CG445_DROME (Rhodanese domain-containing protein CG4456 OS=Drosophila melanogaster OX=7227 GN=CG4456 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.801e-13
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 2
Query: 1322 EDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            E + ++ +   + LIDVR K +++++G IP++I+IPL++L  +L L  + FK+ +G  KPE QS  IIF      +   A +IA S GY     + G + EW++K
Sbjct:    5 EQVKDVPNHPDVYLIDVRRKEELQQTGFIPASINIPLDELDKALNLDGSAFKNKYGRSKPEKQSP-IIFTCRSGNRVLEAEKIAKSQGYSNVVIYKGSWNEWAQK 108          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. UniProt/SwissProt
Match: sp|Q9BYG0|B3GN5_HUMAN (Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.080e-12
Identity = 54/171 (31.58%), Postives = 89/171 (52.05%), Query Frame = 3
Query:  333 RTAIRQTWA------SRLDANI--IFVTGYFSKSQGE-LSR-LSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSE---SYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            R+ IR+TW       S+L+ANI  +F  G  +  +GE L R L+ E + + DI+  D  +  +  T+K++  F+   +     K     L+  +DD+FI+  NL  +L+S      +D   G++      +RD   KYYVS+  Y  PA+P Y  G   VI+GD+  +V++
Sbjct:  104 RSGIRRTWGNENYVRSQLNANIKTLFALGTPNPLEGEELQRKLAWEDQRYNDIIQQDFVDSFYNLTLKLLMQFSWANTYCPHAKF----LMTADDDIFIHMPNLIEYLQSLEQIGVQDFWIGRVHRGAPPIRDKSSKYYVSYEMYQWPAYPDYTAGAAYVISGDVAAKVYE 270          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. UniProt/SwissProt
Match: sp|Q864U8|B3GN5_PIG (Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Sus scrofa OX=9823 GN=B3GNT5 PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 2.090e-11
Identity = 56/172 (32.56%), Postives = 84/172 (48.84%), Query Frame = 3
Query:  333 RTAIRQTWA------SRLDANI--IFVTGYFSKS---QGELSRLSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKS---ESYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            R+AIR TW       S+L+ANI  +FV G  S     +    RL  E  ++ DI+  D  +  +  T+K +  F    S     K     L+  +DD+FI+  NL  +L+S      +D   G++      VRD   KYYVS+  Y  PA+P Y  G   VI+GD+  +V++
Sbjct:  102 RSAIRNTWGNEKYVQSQLNANIKTLFVLGTPSDPLMRERLQRRLVWEDHMYSDIIQQDFVDSFYNLTLKFLLQFKWANSFCPHAKF----LMTADDDIFIHMPNLIEYLQSLEQMGVQDFWIGRVHHGAPPVRDKSSKYYVSYDMYQWPAYPDYTAGAAYVISGDVATKVYE 269          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. TrEMBL
Match: A0A4S2MG64 (Rhodanese domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_000189 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.005e-22
Identity = 52/116 (44.83%), Postives = 78/116 (67.24%), Query Frame = 2
Query: 1283 PEIKVNKRNEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWS 1630
            PE    KR+ I+  +L +L+ D  ++LIDVR+  D  + G IP AI+IPL  LKS+L+L+   F   +G +KP+   ENI+FYGL ++ ST+A EIA+ +GYKK++ +P G+  WS
Sbjct:   87 PETLCGKRS-INYNELASLLTDYTVVLIDVRDPTDFLEVGHIPGAINIPLADLKSALKLTDEAFYAKYGIEKPKYTDENIVFYGLSDVLSTAASEIAHGLGYKKSKFYPEGWTGWS 201          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. TrEMBL
Match: A0A430QS82 (Rhodanese domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0010086 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 4.243e-22
Identity = 47/106 (44.34%), Postives = 71/106 (66.98%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWS 1630
            ++ ++L + +  G + L DVR   D+E +G IP +++IPL  LK +L LS +EF   +G  KP+    NIIFYGL ++ S SACEIA+S+GYK+A+ +  G+ EWS
Sbjct:   72 VTYDELSSQLSKGTVQLFDVRSGDDVESTGRIPGSVNIPLTDLKKALILSDSEFLQKYGVSKPKTSDNNIIFYGLSDVSSASACEIAHSMGYKRAKYYLNGWTEWS 177          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. TrEMBL
Match: A0A1S8WN24 (Rhodanese-like protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_08392 PE=4 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 1.114e-21
Identity = 51/116 (43.97%), Postives = 77/116 (66.38%), Query Frame = 2
Query: 1283 PEIKVNKRNEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWS 1630
            P+    KR+ I+  +L  L+ D  ++LIDVR+  D  + G IP AI+IPL  LKS+L+L+   F   +G +KP+   ENI+FYGL ++ ST+A EIA+ +GYKK++ +P G+  WS
Sbjct:   64 PDALCGKRS-INYNELALLLTDYSVVLIDVRDPTDFLEVGHIPGAINIPLADLKSALKLTDEAFHAKYGIEKPKYTDENIVFYGLSDVLSTAASEIAHGLGYKKSKFYPEGWTGWS 178          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. TrEMBL
Match: A0A0V1DH41 (Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 OS=Trichinella britovi OX=45882 GN=Tstd3 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.048e-21
Identity = 46/108 (42.59%), Postives = 73/108 (67.59%), Query Frame = 2
Query: 1310 EISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSE 1633
            E++ E+L  L D   +++IDVR+  +I+K G I  + +IPL +L  +L+L+   F+  + +DKP     NI+F+GL  IKST+A EIA+  GYKK+R +P G++EWS+
Sbjct:   51 ELTYEELKALYDANDVLIIDVRDPEEIKKQGKIEGSYNIPLGQLSEALKLTPEAFRKQYHFDKPTKYDANIVFHGLSHIKSTAALEIAHKYGYKKSRHYPAGWEEWSK 158          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. TrEMBL
Match: G4V9X4 (Rhodanese domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_006560 PE=4 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 3.686e-21
Identity = 47/106 (44.34%), Postives = 71/106 (66.98%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWS 1630
            I+ ++L + I  G + L DVR   D++ +G IP +++IPL  LK SL LS +EF   +G  KP+    N+IFYGL ++ S SACEIA+S+G+K+A+ +  G+ EWS
Sbjct:   72 ITYDELSSQISKGTVQLFDVRSSDDVKSTGSIPGSVNIPLADLKKSLILSDSEFFQKYGVSKPKTSDSNVIFYGLSDVSSASACEIAHSLGFKRAKYYLKGWTEWS 177          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Cavefish
Match: ENSAMXT00000037356.1 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 [Source:NCBI gene;Acc:103030362])

HSP 1 Score: 84.7297 bits (208), Expect = 1.162e-18
Identity = 41/107 (38.32%), Postives = 70/107 (65.42%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSE 1633
            I+ E+L  L+     ++IDVRE  ++ + G IPSAI++PL ++ S+LQL   EFK+ +G D P   +EN++F  L  ++S  A + A S+GY  A+ + GG+++W++
Sbjct:   62 ITYEELKKLLVAKSGVVIDVREPWELREYGNIPSAINVPLGQVTSALQLEPEEFKEKYGGDMPS-TTENVVFTCLAGMRSIKALQAATSLGYSNAQHYLGGWQDWAK 167          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Cavefish
Match: si:dkey-34l15.1 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 [Source:NCBI gene;Acc:103030441])

HSP 1 Score: 82.0333 bits (201), Expect = 3.691e-18
Identity = 43/109 (39.45%), Postives = 69/109 (63.30%), Query Frame = 2
Query: 1313 ISCEDLMNLID-DGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            IS  DL +L+  D  ++L+DVR K +++K G IP +IHIPL+ ++  L L    F+  FG  KP L + N++F+     +  +A + A S+G++ AR++ G +KEWSEK
Sbjct:   25 ISYSDLKSLVGRDKGLVLVDVRNKDEVDK-GRIPGSIHIPLSDVERDLSLDPDAFQTKFGVAKPPLDTPNLVFHCQLGRRGQAATDKAKSLGFENARNYVGAYKEWSEK 132          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Cavefish
Match: si:ch211-161h7.8 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 [Source:NCBI gene;Acc:103025070])

HSP 1 Score: 75.485 bits (184), Expect = 1.471e-15
Identity = 34/107 (31.78%), Postives = 68/107 (63.55%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSE 1633
            ++ E L  ++    + L D+R + D  ++G I  +++IPL++L+ SL+LS+  F+  F    P+ + +NI+F+  +  +S +A +IA+ +G+ +AR + GG+ EW+E
Sbjct:   50 VTREQLKAMLASHSVQLFDIRNR-DEFQAGHIAGSVNIPLDQLEESLKLSSKTFEKCFKVKAPKKEDDNIVFHCQRGRRSLTALDIAWRLGFSRARHYAGGYSEWAE 155          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Cavefish
Match: si:dkey-34l15.1 (thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 1 [Source:NCBI gene;Acc:103030441])

HSP 1 Score: 64.6994 bits (156), Expect = 3.872e-12
Identity = 36/99 (36.36%), Postives = 60/99 (60.61%), Query Frame = 2
Query: 1313 ISCEDLMNLID-DGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSF 1606
            IS  DL +L+  D  ++L+DVR K +++K G IP +IHIPL+ ++  L L    F+  FG  KP L + N++F+     +  +A + A S+G++K  S+
Sbjct:   25 ISYSDLKSLVGRDKGLVLVDVRNKDEVDK-GRIPGSIHIPLSDVERDLSLDPDAFQTKFGVAKPPLDTPNLVFHCQLGRRGQAATDKAKSLGFEKYESY 122          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Cavefish
Match: b3galt1a (beta-1,3-galactosyltransferase 1-like [Source:NCBI gene;Acc:103046152])

HSP 1 Score: 61.6178 bits (148), Expect = 1.005e-9
Identity = 47/167 (28.14%), Postives = 88/167 (52.69%), Query Frame = 3
Query:  333 RTAIRQTWA-----SRLDANIIFVTGYFSKSQGELSRLSE-EAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLE-NFLKSESYKDEIY--GQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            R AIR+TW      S +    +F+ G+   S+  L+++ E E+++F DI+V D E+   +H + +  M    +    +   +   ++ T+ D+F+N  NL  N L+  +   + +  G +I N   +RDT+ K+Y+S   Y    +PP+ +G   V +GD+ + +FK
Sbjct:   97 RQAIRETWGEENMYSDIRIVTLFLLGH--NSEPVLNQMVEQESQIFHDIIVEDFEDS--YHNLTLKTMMG--MRWVSSFCPNAHYVMKTDSDIFVNMDNLVLNLLRPNAKPRQRFFTGHVI-NGGPIRDTRSKWYMSREMYPESKYPPFCSGTGYVFSGDMAELIFK 256          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006076.1 (pep scaffold:Pmarinus_7.0:GL476493:725894:734457:1 gene:ENSPMAG00000005492.1 transcript:ENSPMAT00000006076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.3294 bits (181), Expect = 4.530e-16
Identity = 38/117 (32.48%), Postives = 68/117 (58.12%), Query Frame = 2
Query: 1298 NKRNEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEKGLKI 1648
            ++ N++S E+L  L+ +  + + DVRE  + E+ G+IPSAI+IP+ K+  +    +  FK  +G D P  + +NI+ Y    ++  +A      +GY K+R++ GG+ EW  K  K+
Sbjct:   23 SQTNKVSYEELKRLLQNRDVSVFDVREPCETEE-GMIPSAINIPVGKINEAFIRDSGTFKGLYGVDMPH-KEDNIVVYCRSGMRGQTALYSLRRLGYTKSRNYTGGYTEWKSKAKKL 137          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Sea Lamprey
Match: si:ch211-161h7.8 (si:ch211-161h7.8 [Source:ZFIN;Acc:ZDB-GENE-091204-302])

HSP 1 Score: 64.3142 bits (155), Expect = 6.165e-13
Identity = 34/105 (32.38%), Postives = 59/105 (56.19%), Query Frame = 2
Query: 1322 EDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            E+L  L+    + L+DVRE  +++++G I   +++PL +L  +LQLS  EF+  +G D     + N +F      +S  A  IA  +GY +AR + GG+ +W  +
Sbjct:    5 EELKALLAAAAVWLVDVREPSELKENGAIEGCVNVPLGELGEALQLSPREFRARYGSDLVGPSAPNTVFLCRAGRRSKEALLIAQKLGYTRARHYGGGWLDWERR 109          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Sea Lamprey
Match: b3gnt2a (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2a [Source:ZFIN;Acc:ZDB-GENE-090312-192])

HSP 1 Score: 56.9954 bits (136), Expect = 7.953e-9
Identity = 48/168 (28.57%), Postives = 79/168 (47.02%), Query Frame = 3
Query:  333 RTAIRQTWASRLDANI----IFVTGYFSKSQGELSR---LSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLII-TEDDVFINPWN----LENFLKSESYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRV 800
            R AIR++W +    N+    +F+ G  +    E +    L  E++ + DIL  D  +  F  T+K +     FL   E ++ S+ R I   +DDVF+N       L N    +  ++   G +I N    RD K KYY+    +   A+PPY  G   V +G++ +R+
Sbjct:  167 RQAIRESWGAETSGNVTVRRVFLLGRPANPDLEPNLQHLLDLESKRYSDILQWDFRDSFFNLTLKELL----FLKWVE-QRCSDVRFIFKGDDDVFVNTDRTVALLSNITAPDKVQNLFLGDVIVNAGPHRDKKVKYYIPESVFEG-AYPPYAGGGGYVYSGEMARRI 328          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Sea Lamprey
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 51.6026 bits (122), Expect = 3.716e-7
Identity = 49/168 (29.17%), Postives = 71/168 (42.26%), Query Frame = 3
Query:  333 RTAIRQTWA-----SRLDANIIFVTGYFSKSQGELSR------LSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSESYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVF 803
            R AIRQTW        L   +IF+ G    S  E  R      L EEA    DIL     +     T+K +  F H+L+  ++   + F +   +DD+F++  NL   L      D   G II++   VR    KYYV    + H  +P Y  G  + + G    + F
Sbjct:  128 RHAIRQTWGQEVAVGGLQVRLIFLIGV---SDNEARRPFYNHFLQEEAAKNGDILQWGFLDTFLNLTVKQVN-FLHWLN--QSCPHAAF-IYNGDDDMFLHIANLVELLLGYPQGDFYVGHIIDDTPPVRYVPSKYYVPTQLWPHSTYPAYVGGGGLAMAGSTALKFF 288          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Sea Lamprey
Match: B3GNT3 (UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3 [Source:HGNC Symbol;Acc:HGNC:13528])

HSP 1 Score: 48.521 bits (114), Expect = 3.209e-6
Identity = 41/162 (25.31%), Postives = 79/162 (48.77%), Query Frame = 3
Query:  333 RTAIRQTWASRLDANIIFVTGYF---SKSQGELSRLSE-EAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSESYKDEIY-GQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVF 803
            R AIR ++  + + + + V   F     S  +  RL   E+  +KD+L    +E  F  T+K + +F  +   + T+  +   +   +DD+F+N   L + L+     +++Y G +I + + V     KYYV    +S  A+PPY +G  I++    V++ +
Sbjct:  134 RMAIRHSYGQQRETSGVVVRRLFIMGLSSNKDFQRLVRYESATYKDVLQWAFDEAFFNLTLKQV-LFMAWFQRRCTDNATF--VYNGDDDMFLNTERLASELRFLPMSEDLYAGLVIRDTERVNTRMSKYYVPEEMHSSNAYPPYVSGGSILMTAATVRKFY 292          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Yeast
Match: RDL2 (Protein with rhodanese activity; contains a rhodanese-like domain similar to Rdl1p, Uba4p, Tum1p, and Ych1p; overexpression causes a cell cycle delay; null mutant displays elevated frequency of mitochondrial genome loss [Source:SGD;Acc:S000005812])

HSP 1 Score: 60.077 bits (144), Expect = 2.966e-11
Identity = 36/108 (33.33%), Postives = 60/108 (55.56%), Query Frame = 2
Query: 1322 EDLMNLID--DGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEKG 1639
            + + NL++  + + +L+DVRE  ++ K   +P+ I+IP+N    +L L   EF   F + KP    E +IF   K +++ +A E+A S GY+    +PG   EW  KG
Sbjct:   36 DQVRNLVEHPNDKKLLVDVREPKEV-KDYKMPTTINIPVNSAPGALGLPEKEFHKVFQFAKPPHDKE-LIFLCAKGVRAKTAEELARSYGYENTGIYPGSITEWLAKG 141          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Yeast
Match: RDL1 (Thiosulfate sulfurtransferase; contains a rhodanese-like domain; localized to the mitochondrial outer membrane; protein abundance increases in response to DNA replication stress; similar to the human TSTD gene [Source:SGD;Acc:S000005811])

HSP 1 Score: 50.8322 bits (120), Expect = 4.042e-8
Identity = 31/110 (28.18%), Postives = 53/110 (48.18%), Query Frame = 2
Query: 1316 SCEDLMNLI--DDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEKG 1639
            S ED+  ++   D  ++L+DVRE  +      IP++I++P      +  L   EF+   G  KP+  ++ +IFY     +   A ++A S GY     +PG   +W   G
Sbjct:   26 SFEDMKRIVGKHDPNVVLVDVREPSEYSIVH-IPASINVPYRSHPDAFALDPLEFEKQIGIPKPD-SAKELIFYCASGKRGGEAQKVASSHGYSNTSLYPGSMNDWVSHG 133          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Nematostella
Match: EDO34076 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG5])

HSP 1 Score: 88.9669 bits (219), Expect = 4.469e-20
Identity = 42/107 (39.25%), Postives = 67/107 (62.62%), Query Frame = 2
Query: 1307 NEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEW 1627
             E+S E+L  LI    I L DVRE  ++E+SG IP +I+IPL ++  +  +   EFK  +G  KP+ +  +I+F+    I+S +A +   S+G++KA+ +PGGF EW
Sbjct:  103 TEVSIEELQLLIKQQAIQLFDVREPYELEESGKIPFSINIPLRQVPEAFTMKPKEFKLKYGAKKPKRKDTDIVFHCKAGIRSKTALKAVRSMGFRKAKHYPGGFDEW 209          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Nematostella
Match: EDO26397 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC43])

HSP 1 Score: 83.5741 bits (205), Expect = 2.531e-19
Identity = 40/105 (38.10%), Postives = 65/105 (61.90%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEW 1627
            +S E+L  LI    I L DVRE  ++E+SG IP +I+IP  ++  +  +   EFK  +G  KP+ +  +I+F+    I+S +A +   S+G++KA+ +PGGF EW
Sbjct:    1 MSIEELQLLIKQQAIQLFDVREPYELEESGKIPFSINIPCEQVPEAFTMKPKEFKLKYGAKKPKRKDTDIVFHCKAGIRSKTALKAVRSMGFRKAKHYPGGFDEW 105          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Nematostella
Match: EDO33449 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS41])

HSP 1 Score: 72.0182 bits (175), Expect = 2.296e-14
Identity = 56/181 (30.94%), Postives = 104/181 (57.46%), Query Frame = 3
Query:  294 YIYVLSSSVRRGI--RTAIRQTWA-------SRLDANIIFVTGYFSKSQGELSRLSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSESYKDEIY-GQIIENDQVVRDTKDKYYVSHYEYSHPAFPPYPNGKLIVINGDLVKRVFK 806
            ++ +L SS+   I  R AIR+TWA       ++LD+ +IFV G  SKS      + EEA+ + DI      ++   H I  I    ++++  E +      +I T+DDV+I   ++  +LK    K+++Y G++I + +V+RD KD++YVS  E+S   +P Y +G++ V +G++++++ +
Sbjct:    1 FLVILVSSLPNAIESREAIRETWAKSLIANDTKLDSCLIFVVG-SSKSTHLDIEVEEEAKQYGDIFRSKYLDKPR-HEIAKIWKSYYWVAKYEPK-----YVIKTKDDVYIYLPSVMRWLKQRDPKEQLYAGKLINHARVIRDKKDEFYVSWNEFSETFYPDYCSGEIYVFSGNILEKLIR 174          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Nematostella
Match: EDO29885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2D3])

HSP 1 Score: 60.077 bits (144), Expect = 3.860e-11
Identity = 29/106 (27.36%), Postives = 56/106 (52.83%), Query Frame = 2
Query: 1328 LMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEKGLK 1645
            L  L+    I L DVR   ++ ++G IP A++IPL+ + ++  L    F+  +    P     NI+F+    +++ +A +   ++G+K   ++ GG+ EW E  +K
Sbjct:    6 LKELLSKADIQLFDVRNPEELLETGQIPGAVNIPLSDITAAFSLPPAIFEQIYDVPMPSKTDNNIVFHCRTGVRAQNAIDTLKNLGFKGTHNYTGGWVEWQEAMMK 111          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Nematostella
Match: EDO34075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG4])

HSP 1 Score: 61.6178 bits (148), Expect = 4.561e-11
Identity = 29/108 (26.85%), Postives = 57/108 (52.78%), Query Frame = 2
Query: 1310 EISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSE 1633
            E++   L  L+    I L DVR   ++ ++G IP A++IPL+ + ++  L    F+  +    P     NI+F+    +++ +A +   ++G+K   ++ GG+ EW E
Sbjct:   60 EVTLTCLKELLSKADIQLFDVRNPEELLETGQIPGAVNIPLSDITAAFMLPPAIFEQIYDVPMPSKTDNNIVFHCKTGVRAQNAIDTLKNLGFKGTHNYTGGWVEWQE 167          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Medaka
Match: ENSORLT00000035140.1 (thiosulfate sulfurtransferase like domain containing 3 [Source:NCBI gene;Acc:101159218])

HSP 1 Score: 94.3597 bits (233), Expect = 5.615e-22
Identity = 40/110 (36.36%), Postives = 74/110 (67.27%), Query Frame = 2
Query: 1307 NEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
             E+S E L   ++DG  ++IDVRE  ++ + G IP ++++PL ++ ++LQLS  +F++ FG + P  + +NI+F  L  I+S +A + A S+G+K A+ +P G++ W+E+
Sbjct:   59 TEVSYEQLKQRLNDGNAVVIDVREPWELREYGFIPGSVNVPLGQVNTALQLSPEDFREKFGAEMPR-RRDNIVFLCLAGIRSKAALDTAASLGFKDAQHYPDGWQGWAER 167          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Medaka
Match: ENSORLT00000032973.1 (thiosulfate sulfurtransferase like domain containing 3 [Source:NCBI gene;Acc:101159218])

HSP 1 Score: 93.5893 bits (231), Expect = 1.815e-21
Identity = 40/110 (36.36%), Postives = 74/110 (67.27%), Query Frame = 2
Query: 1307 NEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
             E+S E L   ++DG  ++IDVRE  ++ + G IP ++++PL ++ ++LQLS  +F++ FG + P  + +NI+F  L  I+S +A + A S+G+K A+ +P G++ W+E+
Sbjct:   87 TEVSYEQLKQRLNDGNAVVIDVREPWELREYGFIPGSVNVPLGQVNTALQLSPEDFREKFGAEMPR-RRDNIVFLCLAGIRSKAALDTAASLGFKDAQHYPDGWQGWAER 195          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Medaka
Match: ENSORLT00000003636.2 (thiosulfate:glutathione sulfurtransferase [Source:NCBI gene;Acc:101160420])

HSP 1 Score: 84.3445 bits (207), Expect = 4.217e-19
Identity = 41/112 (36.61%), Postives = 75/112 (66.96%), Query Frame = 2
Query: 1304 RNEISCEDLMNLIDDGR-IILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            ++ IS EDL  L+ + + ++L+DVR K +++ +G IP +I+IPL+ ++S+ +L   +FK  +G  KPE  S++++F+     +  +A + A  +GY KAR++ GG+ EWS+K
Sbjct:    6 KDNISYEDLQVLLKENQNLVLVDVRSKGEVD-NGHIPGSINIPLDTVESAFKLPPEDFKSKYGKTKPEKDSQDLVFHCQMGRRGETATKQARQLGYSKARNYAGGYMEWSKK 116          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Medaka
Match: ENSORLT00000037448.1 (thiosulfate:glutathione sulfurtransferase [Source:NCBI gene;Acc:101160420])

HSP 1 Score: 83.5741 bits (205), Expect = 6.259e-19
Identity = 41/109 (37.61%), Postives = 73/109 (66.97%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGR-IILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            IS EDL  L+ + + ++L+DVR K +++ +G IP +I+IPL+ ++S+ +L   +FK  +G  KPE  S++++F+     +  +A + A  +GY KAR++ GG+ EWS+K
Sbjct:    4 ISYEDLQVLLKENQNLVLVDVRSKGEVD-NGHIPGSINIPLDTVESAFKLPPEDFKSKYGKTKPEKDSQDLVFHCQMGRRGETATKQARQLGYSKARNYAGGYMEWSKK 111          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Medaka
Match: ENSORLT00000029861.1 (thiosulfate:glutathione sulfurtransferase [Source:NCBI gene;Acc:101160420])

HSP 1 Score: 83.5741 bits (205), Expect = 6.259e-19
Identity = 41/109 (37.61%), Postives = 73/109 (66.97%), Query Frame = 2
Query: 1313 ISCEDLMNLIDDGR-IILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEK 1636
            IS EDL  L+ + + ++L+DVR K +++ +G IP +I+IPL+ ++S+ +L   +FK  +G  KPE  S++++F+     +  +A + A  +GY KAR++ GG+ EWS+K
Sbjct:    4 ISYEDLQVLLKENQNLVLVDVRSKGEVD-NGHIPGSINIPLDTVESAFKLPPEDFKSKYGKTKPEKDSQDLVFHCQMGRRGETATKQARQLGYSKARNYAGGYMEWSKK 111          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Planmine SMEST
Match: SMESG000003839.1 (SMESG000003839.1)

HSP 1 Score: 352.443 bits (903), Expect = 3.556e-118
Identity = 189/190 (99.47%), Postives = 190/190 (100.00%), Query Frame = 2
Query: 1112 MFLNRIAIKIFCNPNVFRTVKITAISTLKLTRVQCYSSNIKEAXXXXXXXXXXXXLEPEIKVNKRNEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEKGLKIIKINVAENASE 1681
            MFLNRIAIKIFCNPNV+RTVKITAISTLKLTRVQCYSSNIKEAIDPKKKIIDSIKLEPEIKVNKRNEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEKGLKIIKINVAENASE
Sbjct:    1 MFLNRIAIKIFCNPNVYRTVKITAISTLKLTRVQCYSSNIKEAIDPKKKIIDSIKLEPEIKVNKRNEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSEKGLKIIKINVAENASE 190          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Planmine SMEST
Match: SMESG000030828.1 (SMESG000030828.1)

HSP 1 Score: 71.2478 bits (173), Expect = 1.532e-14
Identity = 41/112 (36.61%), Postives = 58/112 (51.79%), Query Frame = 2
Query: 1295 VNKRNEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWS 1630
            V   + IS  DL   I    + +IDVR   ++ K G I  AI+IP+ ++K + +LS  EF+  FG  KPE  S NII   L   +S  A  + + +GY   R   GG+  WS
Sbjct:   14 VATTHAISVADLKAAIKTSELQVIDVRSPEEV-KEGKIEGAINIPIGEIKEAFELSNEEFEKKFGMPKPEKTSRNIILNCLGGGRSGKALRLLHEMGYTNFRHLAGGYGAWS 124          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Planmine SMEST
Match: SMESG000079774.1 (SMESG000079774.1)

HSP 1 Score: 65.855 bits (159), Expect = 2.566e-12
Identity = 31/92 (33.70%), Postives = 58/92 (63.04%), Query Frame = 2
Query: 1358 ILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEWSE 1633
            ++IDVRE+ +  +S  I  +I+IPL++LK++ +L   +F+  FG +KP+   +N+I +  K I+S    +I + +G+ ++R   GG  +W E
Sbjct:   67 VIIDVREENEHRESK-INGSINIPLSQLKAAFELPAEDFRKRFGVEKPDKTDDNLILHCRKGIRSFDGLKILHELGFTRSRHLDGGINDWFE 157          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Planmine SMEST
Match: SMESG000054524.1 (SMESG000054524.1)

HSP 1 Score: 67.781 bits (164), Expect = 7.082e-12
Identity = 71/256 (27.73%), Postives = 126/256 (49.22%), Query Frame = 3
Query:  249 VRIIFSPQRIR---HSNIYIYVLSSSVRRGIRTAIRQTWASRLDANIIFVTGYFSKSQGELSRLSEEAEVFKDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFINPWNLENFLKSESYKDEIYGQIIENDQVVRDTKDKYYVS--HYEYSHPAFPPYPNGKLIVINGDLVKRVFKCFPVVKIVKFXXXXXXXXXXXXXXXXRSLQSEIENEQLNSIENFNKIALHNIKHDIVFQFFWNQT 1001
            V  +   Q+I       + IY+LS      +R +IR TWA+ +  N+IFV G  +    + + + +E   + DIL+++ +E  F    K+ A+  HF         S+F L+I EDDVF+N   LEN+L     +  I G +IEN+ +  + K  Y ++     Y+    PP+   K  +I+    K++ +    +      +I++G+I Y+    +  L ++I   + +S E+   IA+  I  D+ F+ FW Q+
Sbjct:   71 VEYLIGKQKINDRLEGKVKIYILSHPYNARVRQSIRTTWATEI--NVIFVMGLQADWFYDRNVVIKEKRKYNDILIINEKETKFHSGCKVEAILQHF----NQSNSSKF-LLILEDDVFLNTEILENYLSEIEDEYFIGGYLIENETIA-NIKKTYKINFEQSNYNFNTLPPFILMKFTLISKGYAKKLQEQSRHLTKTIAADIFVGLITYSSGGEMTKLNTQIIINRTSSNEDRKIIAISKIYLDMAFRLFWIQS 318          
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Planmine SMEST
Match: SMESG000079781.1 (SMESG000079781.1)

HSP 1 Score: 61.6178 bits (148), Expect = 5.873e-11
Identity = 37/109 (33.94%), Postives = 59/109 (54.13%), Query Frame = 2
Query: 1301 KRNEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIPSAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSACEIAYSVGYKKARSFPGGFKEW 1627
            + N I+   L +++ +   ILIDVRE  +  + G I  A++IPL+++K S  LS   F + F   KP +++ NII Y     +S  A  I + +GY  +R   GG  +W
Sbjct:   46 QMNTINSSTLHHILLNENPILIDVREISEFNQ-GNIEGALNIPLSRVKKSFNLSEINFLNKFSLTKP-VKNSNIILYCRSGRRSLDALRILHKLGYTDSRHLEGGILDW 152          
The following BLAST results are available for this feature:
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSTD12.300e-1734.26thiosulfate sulfurtransferase like domain containi... [more]
TSTD12.579e-1734.26thiosulfate sulfurtransferase like domain containi... [more]
B3GNT58.497e-1331.58UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT58.497e-1331.58UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT58.497e-1331.58UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
B0024.151.487e-1029.03Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
B0024.151.487e-1029.03Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
F14B6.49.583e-928.72Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:O... [more]
T15D6.51.571e-829.24Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:Q... [more]
C47F8.36.619e-726.52Hexosyltransferase [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG44562.794e-1436.19gene:FBgn0001228 transcript:FBtr0100655[more]
CG44562.794e-1436.19gene:FBgn0001228 transcript:FBtr0303474[more]
CG44562.794e-1436.19gene:FBgn0001228 transcript:FBtr0100653[more]
CG44562.794e-1436.19gene:FBgn0001228 transcript:FBtr0303473[more]
CG86734.819e-1225.95gene:FBgn0031986 transcript:FBtr0079575[more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-165n16.13.155e-2240.54si:dkey-165n16.1 [Source:ZFIN;Acc:ZDB-GENE-100922-... [more]
BX537102.21.330e-2038.18si:dkey-34l15.1 [Source:NCBI gene;Acc:563265][more]
TSTD11.583e-2039.09si:dkey-34l15.1 [Source:ZFIN;Acc:ZDB-GENE-081107-6... [more]
CABZ01058650.11.890e-1936.11thiosulfate sulfurtransferase/rhodanese-like domai... [more]
si:ch211-161h7.81.315e-1431.48si:ch211-161h7.8 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000042802.18.189e-1533.02thiosulfate sulfurtransferase (rhodanese)-like dom... [more]
B3GNT91.109e-1029.94UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT41.019e-932.14UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
ENSXETT00000027493.13.068e-928.57pep primary_assembly:Xenopus_tropicalis_v9.1:2:755... [more]
wdr192.138e-825.71WD repeat domain 19 [Source:Xenbase;Acc:XB-GENE-92... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tstd35.609e-1634.29thiosulfate sulfurtransferase (rhodanese)-like dom... [more]
Tstd11.918e-1533.33thiosulfate sulfurtransferase (rhodanese)-like dom... [more]
B3gnt51.420e-1130.27UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3gnt51.420e-1130.27UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3gnt51.420e-1130.27UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NFU3|TSTD1_HUMAN1.105e-1634.26Thiosulfate:glutathione sulfurtransferase OS=Homo ... [more]
sp|Q9D0B5|TSTD3_MOUSE3.923e-1534.29Thiosulfate sulfurtransferase/rhodanese-like domai... [more]
sp|P22978|CG445_DROME2.801e-1336.19Rhodanese domain-containing protein CG4456 OS=Dros... [more]
sp|Q9BYG0|B3GN5_HUMAN4.080e-1231.58Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminylt... [more]
sp|Q864U8|B3GN5_PIG2.090e-1132.56Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminylt... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MG643.005e-2244.83Rhodanese domain-containing protein OS=Opisthorchi... [more]
A0A430QS824.243e-2244.34Rhodanese domain-containing protein OS=Schistosoma... [more]
A0A1S8WN241.114e-2143.97Rhodanese-like protein (Fragment) OS=Opisthorchis ... [more]
A0A0V1DH412.048e-2142.59Thiosulfate sulfurtransferase/rhodanese-like domai... [more]
G4V9X43.686e-2144.34Rhodanese domain-containing protein OS=Schistosoma... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037356.11.162e-1838.32thiosulfate sulfurtransferase/rhodanese-like domai... [more]
si:dkey-34l15.13.691e-1839.45thiosulfate sulfurtransferase/rhodanese-like domai... [more]
si:ch211-161h7.81.471e-1531.78thiosulfate sulfurtransferase/rhodanese-like domai... [more]
si:dkey-34l15.13.872e-1236.36thiosulfate sulfurtransferase/rhodanese-like domai... [more]
b3galt1a1.005e-928.14beta-1,3-galactosyltransferase 1-like [Source:NCBI... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006076.14.530e-1632.48pep scaffold:Pmarinus_7.0:GL476493:725894:734457:1... [more]
si:ch211-161h7.86.165e-1332.38si:ch211-161h7.8 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
b3gnt2a7.953e-928.57UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT33.716e-729.17UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
B3GNT33.209e-625.31UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltr... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RDL22.966e-1133.33Protein with rhodanese activity; contains a rhodan... [more]
RDL14.042e-828.18Thiosulfate sulfurtransferase; contains a rhodanes... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO340764.469e-2039.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO263972.531e-1938.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334492.296e-1430.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298853.860e-1127.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340754.561e-1126.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035140.15.615e-2236.36thiosulfate sulfurtransferase like domain containi... [more]
ENSORLT00000032973.11.815e-2136.36thiosulfate sulfurtransferase like domain containi... [more]
ENSORLT00000003636.24.217e-1936.61thiosulfate:glutathione sulfurtransferase [Source:... [more]
ENSORLT00000037448.16.259e-1937.61thiosulfate:glutathione sulfurtransferase [Source:... [more]
ENSORLT00000029861.16.259e-1937.61thiosulfate:glutathione sulfurtransferase [Source:... [more]
back to top
BLAST of Thiosulfate sulfurtransferase rhodanese-like domain-containing 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003839.13.556e-11899.47SMESG000003839.1[more]
SMESG000030828.11.532e-1436.61SMESG000030828.1[more]
SMESG000079774.12.566e-1233.70SMESG000079774.1[more]
SMESG000054524.17.082e-1227.73SMESG000054524.1[more]
SMESG000079781.15.873e-1133.94SMESG000079781.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026369 ID=SMED30026369|Name=Thiosulfate sulfurtransferase rhodanese-like domain-containing 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2118bp
TGAAAAGTCTTTTTCGGTTTGCAAATATCAGCGAATCTCCCATCAAAAAT
AACGCTGATAAGAAGGACTTTGTCAGTGTTTCTCTGATTATATTTCTAAT
GCTCATATTAACCTATCCAATATTCAATGAAGAAAAGCGAACCTTTCATA
ATTTTTCCAATGTCAAGTTTGAATACACAGTGAATTTGTCCCAGAATGAC
ATTTTGAATAATCAGAATTATACAAATTACTCTTTGAATAATCCCAATGT
GCGCATTATATTTTCTCCACAAAGAATAAGACATTCAAATATTTATATAT
ACGTTTTATCCTCCTCCGTTCGTCGAGGAATTAGAACAGCTATTCGACAG
ACTTGGGCATCCAGGCTGGATGCAAACATTATATTTGTAACTGGCTATTT
TTCAAAATCACAAGGTGAATTATCTCGTCTTTCGGAGGAAGCTGAAGTAT
TTAAAGATATTTTAGTTGTTGATAGTGAAGAGCAATGTTTTTTTCATACT
ATTAAAATGATTGCGATGTTTACTCATTTTCTTTCTTTAAAAGAAACGGA
AAAGTTATCGGAATTTCGATTAATAATAACAGAAGATGATGTTTTTATAA
ATCCATGGAATCTGGAAAACTTTTTAAAAAGTGAAAGTTATAAAGATGAA
ATTTATGGTCAAATAATTGAGAATGATCAAGTAGTTCGAGATACCAAGGA
TAAATATTACGTAAGTCATTACGAATACTCACATCCTGCTTTCCCACCAT
ATCCCAATGGTAAATTAATTGTAATCAATGGAGATTTAGTGAAACGCGTT
TTTAAATGTTTTCCAGTAGTAAAAATCGTGAAATTTTACGAAATATATTT
GGGTATAATTCTTTATAATTTAAATATTTCCATTCGTTCACTGCAAAGTG
AAATTGAAAATGAGCAATTAAACTCTATAGAAAATTTTAACAAAATTGCT
TTACATAATATTAAGCACGATATTGTTTTCCAGTTCTTTTGGAATCAAAC
AATGAATAATTATCCAACAATGTAGTAAATCTTTAAACAAATATTATTTG
GGGTAATCTAATGAGATTTGTTTAACCACTTATAAAAGTTCAATTTTTGA
TTTTGTAAATAATGTTTTTGAATAGAATTGCTATCAAAATATTTTGTAAT
CCTAATGTATTCAGAACGGTGAAAATTACTGCCATTTCCACTTTAAAATT
AACGAGAGTACAATGTTATAGTAGTAATATAAAAGAAGCCATAGATCCGA
AAAAGAAAATTATAGATTCTATTAAATTGGAACCAGAAATCAAAGTCAAT
AAAAGAAATGAAATCTCATGTGAGGATTTAATGAATTTAATAGACGATGG
AAGAATCATATTAATTGATGTACGTGAAAAAATTGACATAGAGAAATCTG
GGTTAATACCATCAGCAATACATATACCATTGAATAAGCTCAAATCCTCT
TTACAGTTATCGACCACGGAATTTAAAGATGCCTTTGGCTATGACAAACC
AGAATTACAAAGTGAAAATATCATATTTTATGGTTTAAAAGAAATAAAGA
GTACAAGTGCTTGCGAAATAGCTTATTCTGTCGGATATAAGAAGGCTAGA
TCATTTCCTGGTGGATTTAAAGAGTGGTCTGAAAAAGGATTAAAAATTAT
CAAAATTAATGTGGCTGAAAATGCTTCTGAATAAAATAATTTTCCTTATT
CAATTTTCCAATTTATTCTTGAGATTTAAGTTATTTGATCTGGCTTGTTT
GATCTGTCAATTCGAATGCGTCAACACTTTACGATATTTAAGTGTAATAC
TGAATTTTAAATACATTTCCATTGAAATTTTGGAAATATTGTTTTATATT
TCGTTTTGTTAAAGAAATTCTAAAAAATTTCATTAAATAGCGACGTCTTT
GCTGATGAATTACTCAGCCGGTGTTGCTTTTGTAACAAATTGCCTAAATT
TGTAAAATTAATTACACTTGTATAACTGTGGAATAAGGTTTAAATGAGAT
GAGTGATACTGTTAATTTAAGAATCGCAGCGTATTTTTATCAAAGTTTGG
AACATTTAAGTTACAGTTATTAGTTTTATTTTGTGTAATTAACGTCATTT
CATAAAAGTGCAAATGCT
back to top

protein sequence of SMED30026369-orf-1

>SMED30026369-orf-1 ID=SMED30026369-orf-1|Name=SMED30026369-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=341bp
KSLFRFANISESPIKNNADKKDFVSVSLIIFLMLILTYPIFNEEKRTFHN
FSNVKFEYTVNLSQNDILNNQNYTNYSLNNPNVRIIFSPQRIRHSNIYIY
VLSSSVRRGIRTAIRQTWASRLDANIIFVTGYFSKSQGELSRLSEEAEVF
KDILVVDSEEQCFFHTIKMIAMFTHFLSLKETEKLSEFRLIITEDDVFIN
PWNLENFLKSESYKDEIYGQIIENDQVVRDTKDKYYVSHYEYSHPAFPPY
PNGKLIVINGDLVKRVFKCFPVVKIVKFYEIYLGIILYNLNISIRSLQSE
IENEQLNSIENFNKIALHNIKHDIVFQFFWNQTMNNYPTM*
back to top

protein sequence of SMED30026369-orf-2

>SMED30026369-orf-2 ID=SMED30026369-orf-2|Name=SMED30026369-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=191bp
MFLNRIAIKIFCNPNVFRTVKITAISTLKLTRVQCYSSNIKEAIDPKKKI
IDSIKLEPEIKVNKRNEISCEDLMNLIDDGRIILIDVREKIDIEKSGLIP
SAIHIPLNKLKSSLQLSTTEFKDAFGYDKPELQSENIIFYGLKEIKSTSA
CEIAYSVGYKKARSFPGGFKEWSEKGLKIIKINVAENASE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR002659Glyco_trans_31
IPR001763Rhodanese-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0008378galactosyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002659Glycosyl transferase, family 31PFAMPF01762Galactosyl_Tcoord: 111..296
e-value: 7.6E-27
score: 94.4
IPR002659Glycosyl transferase, family 31PANTHERPTHR11214BETA-1,3-N-ACETYLGLUCOSAMINYLTRANSFERASEcoord: 65..322
NoneNo IPR availablePANTHERPTHR11214:SF247BETA-1,3-GALACTOSYLTRANSFERASE BRNcoord: 65..322
NoneNo IPR availableTMHMMTMhelixcoord: 23..41