Bifunctional polynucleotide phosphatase/kinase

Overview
NameBifunctional polynucleotide phosphatase/kinase
Smed IDSMED30026367
Length (bp)2103
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Bifunctional polynucleotide phosphatase/kinase (SMED30026367) t-SNE clustered cells

Violin plots show distribution of expression levels for Bifunctional polynucleotide phosphatase/kinase (SMED30026367) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Bifunctional polynucleotide phosphatase/kinase (SMED30026367) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Bifunctional polynucleotide phosphatase/kinase (SMED30026367) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026367

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026367SMESG000034225.1 SmedASXL_008477SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026367SMESG000034225.1 SmedASXL_008477SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30026367SMESG000034225.1 dd_Smed_v4_1211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026367SMESG000034225.1 dd_Smed_v4_1211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026367SMESG000034225.1 dd_Smed_v4_1211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026367SMESG000034225.1 dd_Smed_v4_1211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026367SMESG000034225.1 dd_Smed_v4_1211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026367SMESG000034225.1 dd_Smed_v4_1211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026367SMESG000034225.1 dd_Smed_v4_1211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026367SMESG000034225.1 Contig7324uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026367SMESG000034225.1 Contig7324newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30026367SMESG000034225.1 dd_Smed_v6_1211_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026367SMESG000034225.1 dd_Smed_v4_1211_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Human
Match: PNKP (polynucleotide kinase 3'-phosphatase [Source:HGNC Symbol;Acc:HGNC:9154])

HSP 1 Score: 310.457 bits (794), Expect = 6.104e-97
Identity = 164/371 (44.20%), Postives = 231/371 (62.26%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W   +  LV+  +G+K   K+A FDLD TLI ++SGK F    +DW+ LY EIP KL+ L+ +GYKL+IF+NQ  IG+GKL  ++FK K+ A+V KLG+  QV VAT ++ +YRKP TGM+D   ++ N G  ++  +  ++GDAAGRPA+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P  V ++                 + + +L   SA   +V+ VG PG+GKSTF KK+L   G+  +NRDTL +WQ+CV        + K V IDNTNPD A+R RY+  A   GV    C +F  + EQ++HN  FR++T  SH  VS+MV   ++ ++  PT  E F+ I +I
Sbjct:  147 WENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVAT-HAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSGP-----------LCLPESRALL---SASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVAIDNTNPDAASRARYVQCARAAGVP-CRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILEI 501          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Human
Match: PNKP (polynucleotide kinase 3'-phosphatase [Source:HGNC Symbol;Acc:HGNC:9154])

HSP 1 Score: 310.457 bits (794), Expect = 6.104e-97
Identity = 164/371 (44.20%), Postives = 231/371 (62.26%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W   +  LV+  +G+K   K+A FDLD TLI ++SGK F    +DW+ LY EIP KL+ L+ +GYKL+IF+NQ  IG+GKL  ++FK K+ A+V KLG+  QV VAT ++ +YRKP TGM+D   ++ N G  ++  +  ++GDAAGRPA+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P  V ++                 + + +L   SA   +V+ VG PG+GKSTF KK+L   G+  +NRDTL +WQ+CV        + K V IDNTNPD A+R RY+  A   GV    C +F  + EQ++HN  FR++T  SH  VS+MV   ++ ++  PT  E F+ I +I
Sbjct:  147 WENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVAT-HAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSGP-----------LCLPESRALL---SASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVAIDNTNPDAASRARYVQCARAAGVP-CRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILEI 501          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Human
Match: PNKP (polynucleotide kinase 3'-phosphatase [Source:HGNC Symbol;Acc:HGNC:9154])

HSP 1 Score: 268.47 bits (685), Expect = 1.724e-81
Identity = 142/371 (38.27%), Postives = 204/371 (54.99%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W   +  LV+  +G+K   K+A FDLD TLI ++SGK F    +DW+ LY EIP KL+ L+ +GYK+++ ++ G                                     +YRKP TGM+D   ++ N G  ++  +  ++GDAAGRPA+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P  V ++                 + + +L   SA   +V+ VG PG+GKSTF KK+L   G+  +NRDTL +WQ+CV        + K V IDNTNPD A+R RY+  A   GV    C +F  + EQ++HN  FR++T  SH  VS+MV   ++ ++  PT  E F+ I +I
Sbjct:  147 WENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKVLVATHAG-------------------------------------LYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSGP-----------LCLPESRALL---SASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVAIDNTNPDAASRARYVQCARAAGVP-CRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILEI 465          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Human
Match: PNKP (polynucleotide kinase 3'-phosphatase [Source:HGNC Symbol;Acc:HGNC:9154])

HSP 1 Score: 267.314 bits (682), Expect = 6.520e-81
Identity = 150/371 (40.43%), Postives = 211/371 (56.87%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W   +  LV+  +G+K   K+A FDLD TLI ++SGK F    +DW+ LY EIP KL+ L+ +GYKL+IF+NQ  IG+GKL  ++FK K+ A+V KLG+  QV VAT ++ +YRKP TGM+D   ++ N G  ++  +  ++GDAAGRPA+WAP +KKKDFS +DRL  ++ +     PE   L                 L  S E                            +V+ VG PG+GKSTF KK+L   G+  +NRDTL +WQ+CV        + K V IDNTNPD A+R RY+  A   GV    C +F  + EQ++HN  FR++T  SH  VS+MV   ++ ++  PT  E F+ I +I
Sbjct:  147 WENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVAT-HAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLRTVSRSGPLCLPESRAL-----------------LSASPE----------------------------VVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVAIDNTNPDAASRARYVQCARAAGVP-CRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILEI 470          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Human
Match: PNKP (polynucleotide kinase 3'-phosphatase [Source:HGNC Symbol;Acc:HGNC:9154])

HSP 1 Score: 218.394 bits (555), Expect = 5.028e-63
Identity = 120/265 (45.28%), Postives = 169/265 (63.77%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINR 1071
            W   +  LV+  +G+K   K+A FDLD TLI ++SGK F    +DW+ LY EIP KL+ L+ +GYKL+IF+NQ  IG+GKL  ++FK K+ A+V KLG+  QV VAT ++ +YRKP TGM+D   ++ N G  ++  +  ++GDAAGRPA+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P  V ++                 + + +L   SA   +V+ VG PG+GKSTF KK+L   G+  +NR
Sbjct:  147 WENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVAT-HAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSGP-----------LCLPESRALL---SASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNR 396          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Celegans
Match: F21D5.5 (pep chromosome:WBcel235:IV:8735695:8739394:-1 gene:WBGene00009010.1 transcript:F21D5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F21D5.5)

HSP 1 Score: 291.197 bits (744), Expect = 1.939e-91
Identity = 170/391 (43.48%), Postives = 237/391 (60.61%), Query Frame = 1
Query:  295 DYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQE-EAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKD----SADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLD 1452
            D +++  S  +  EKIA+FD+D TLI +KSGK F  +  DW+ LYD IP   K L  DG+K++IF+NQ GI  GK+   +F+KKI AIV KLG+ +Q FV+ A    YRKPC GM++  +K  N  VE+N  E  ++GDAAGR      + KKD S +DR FA N  +KF TPE++F + + +  +  P F P  +                  + +I E+ P D    S++  ++LMVG PGSGKSTF K       + I+NRDT+ TWQKCVA TR    + KSVVIDNT+PD+ +R+RYI VA+E GV  I C   + S E ++HN  FR LT  +   +S MV ++HK KY EPT  E F++I K+    +F+ E+H+ LY  YL++
Sbjct:   38 DLMIFTHSECEGKEKIAAFDMDGTLIKTKSGKVFPTNCQDWQLLYDSIPSDFKKLHSDGFKIVIFTNQKGIHAGKVDRNEFRKKIEAIVGKLGIPVQAFVSVA-GGHYRKPCVGMWNE-LKLRNDEVEINEKESIFVGDAAGR-IKTTSRPKKDHSYADRFFAANVGVKFQTPEEFFGKSKVDEPWGPPNFDPKNLF-----------------SEEITELEPHDAQLKSSEKEIILMVGFPGSGKSTFAKMLGHQHDYKIVNRDTIGTWQKCVAATRSYLADGKSVVIDNTSPDLESRKRYIDVAKELGVP-IRCFEMNCSMEHAQHNIRFRVLTDDNAAEISSMVLRIHKGKYVEPTLSEGFSQIVKVNFRPKFEVEEHEKLYKMYLIE 407          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Fly
Match: CG9601 (gene:FBgn0037578 transcript:FBtr0081854)

HSP 1 Score: 279.641 bits (714), Expect = 1.334e-85
Identity = 156/388 (40.21%), Postives = 225/388 (57.99%), Query Frame = 1
Query:  301 LVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRP--ADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVL-KTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLDK 1455
            +++   G+K SEKIA +D+D T+I +KSG  F  + +DW+ ++ E+P KLK+L +DG+K+ +F+NQGGI +GK+   DFK KI  IV+KLG+ IQVF+A      YRKP TGM+     E N GVE+  +  F++GDAAGRP     A K++KD S  DRLFA N  + FYTPE +FL ++   +  P F P  V  + S         + H                  +V+MVG PGSGKS FC  + +P G+ I+N DTL + Q C+   +R  D  +S V+DNTN D A+R++++ +A E  +    C + +V   Q KHN  FR+L+  +   + +MVF M K KY EP   E F  I K+     F +E  + LY  YL++K
Sbjct:  153 VIFTSVGVKGSEKIAGYDMDGTIIKTKSGLVFPKNTDDWQIIFPEVPEKLKNLHKDGFKICLFTNQGGIARGKINLDDFKVKIKHIVAKLGVPIQVFIAIG-DGFYRKPLTGMWQHLKSEMNDGVEIQEDRCFFVGDAAGRPETGKGATKRRKDHSLVDRLFAANVGISFYTPEVHFLGKQVEQWNKPDFEPTSVQDQVSLLDPDDLTLDDHPCE---------------MVIMVGLPGSGKSHFCSSFFQPRGYKIVNADTLGSTQNCLTACKRFLDSGQSCVVDNTNVDAASRKKFLQLASEKMIP-CRCLVMNVPVAQVKHNIAFRELSDSARTKIKDMVFNMMKKKYQEPALDEGFISIHKVNFKPNFADEKQEKLYKMYLVEK 523          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Zebrafish
Match: pnkp (polynucleotide kinase 3'-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061013-433])

HSP 1 Score: 302.368 bits (773), Expect = 3.413e-93
Identity = 170/386 (44.04%), Postives = 239/386 (61.92%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQL--TVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKN 1428
            W +    +++  +G+ +S KIA FD+D  +I +KSGK F    +DW+ LY EI  KL SL + GYK++ F+NQ GI +GKL+ + FK K   I+  L L IQVFV+TA   IYRKP  GM++   ++ NSGV V+ +E FY+GDAAGRPA+WAP KKKKDFS SDRLFALN  L+FYTPE+YFL  + A F+ P F P + L +   L    D +   T  +I             ++ VG PG+GKSTF + ++ P G++ +NRDT+ +WQ CV+   R   E KSV +DNTNPD+ +R+RYI VA+  GV    C  F  S +Q+KHN  FR++  +   H  V++MV   +K K+  P+  E F+E+ +I     F ++ H N
Sbjct:  211 WQQIGSLMLFTAAGVTASSKIAGFDIDGCIITTKSGKVFPTGPDDWRILYPEIQPKLASLLKKGYKVVFFTNQMGISRGKLRPEVFKSKAEDILQTLQLPIQVFVSTA-PGIYRKPVIGMWEHLCEKANSGVMVDVSESFYVGDAAGRPANWAPGKKKKDFSCSDRLFALNIGLQFYTPEEYFLGWKPATFSFPEFDPRK-LDSKARLYDPPDASLTSTKQEI-------------IVAVGFPGAGKSTFFQTHIIPKGYAYVNRDTMGSWQHCVSACERALKEGKSVAVDNTNPDLESRKRYIDVAQSAGVS-CRCFNFTASLDQAKHNNRFREMVPSATKHVPVNDMVIHSYKKKFVVPSLSEGFSEVLQIHFVPSFSDKRHGN 580          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Zebrafish
Match: pnkp (polynucleotide kinase 3'-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061013-433])

HSP 1 Score: 300.442 bits (768), Expect = 1.457e-92
Identity = 167/373 (44.77%), Postives = 234/373 (62.73%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQL--TVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W +    +++  +G+ +S KIA FD+D  +I +KSGK F    +DW+ LY EI  KL SL + GYK++ F+NQ GI +GKL+ + FK K   I+  L L IQVFV+TA   IYRKP  GM++   ++ NSGV V+ +E FY+GDAAGRPA+WAP KKKKDFS SDRLFALN  L+FYTPE+YFL  + A F+ P F P + L +   L    D +   T  +I             ++ VG PG+GKSTF + ++ P G++ +NRDT+ +WQ CV+   R   E KSV +DNTNPD+ +R+RYI VA+  GV    C  F  S +Q+KHN  FR++  +   H  V++MV   +K K+  P+  E F+E+ +I
Sbjct:  211 WQQIGSLMLFTAAGVTASSKIAGFDIDGCIITTKSGKVFPTGPDDWRILYPEIQPKLASLLKKGYKVVFFTNQMGISRGKLRPEVFKSKAEDILQTLQLPIQVFVSTA-PGIYRKPVIGMWEHLCEKANSGVMVDVSESFYVGDAAGRPANWAPGKKKKDFSCSDRLFALNIGLQFYTPEEYFLGWKPATFSFPEFDPRK-LDSKARLYDPPDASLTSTKQEI-------------IVAVGFPGAGKSTFFQTHIIPKGYAYVNRDTMGSWQHCVSACERALKEGKSVAVDNTNPDLESRKRYIDVAQSAGVS-CRCFNFTASLDQAKHNNRFREMVPSATKHVPVNDMVIHSYKKKFVVPSLSEGFSEVLQI 567          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Zebrafish
Match: pnkp (polynucleotide kinase 3'-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061013-433])

HSP 1 Score: 300.442 bits (768), Expect = 1.457e-92
Identity = 167/373 (44.77%), Postives = 234/373 (62.73%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQL--TVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W +    +++  +G+ +S KIA FD+D  +I +KSGK F    +DW+ LY EI  KL SL + GYK++ F+NQ GI +GKL+ + FK K   I+  L L IQVFV+TA   IYRKP  GM++   ++ NSGV V+ +E FY+GDAAGRPA+WAP KKKKDFS SDRLFALN  L+FYTPE+YFL  + A F+ P F P + L +   L    D +   T  +I             ++ VG PG+GKSTF + ++ P G++ +NRDT+ +WQ CV+   R   E KSV +DNTNPD+ +R+RYI VA+  GV    C  F  S +Q+KHN  FR++  +   H  V++MV   +K K+  P+  E F+E+ +I
Sbjct:  211 WQQIGSLMLFTAAGVTASSKIAGFDIDGCIITTKSGKVFPTGPDDWRILYPEIQPKLASLLKKGYKVVFFTNQMGISRGKLRPEVFKSKAEDILQTLQLPIQVFVSTA-PGIYRKPVIGMWEHLCEKANSGVMVDVSESFYVGDAAGRPANWAPGKKKKDFSCSDRLFALNIGLQFYTPEEYFLGWKPATFSFPEFDPRK-LDSKARLYDPPDASLTSTKQEI-------------IVAVGFPGAGKSTFFQTHIIPKGYAYVNRDTMGSWQHCVSACERALKEGKSVAVDNTNPDLESRKRYIDVAQSAGVS-CRCFNFTASLDQAKHNNRFREMVPSATKHVPVNDMVIHSYKKKFVVPSLSEGFSEVLQI 567          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Zebrafish
Match: pnkp (polynucleotide kinase 3'-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061013-433])

HSP 1 Score: 300.442 bits (768), Expect = 1.457e-92
Identity = 167/373 (44.77%), Postives = 234/373 (62.73%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQL--TVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W +    +++  +G+ +S KIA FD+D  +I +KSGK F    +DW+ LY EI  KL SL + GYK++ F+NQ GI +GKL+ + FK K   I+  L L IQVFV+TA   IYRKP  GM++   ++ NSGV V+ +E FY+GDAAGRPA+WAP KKKKDFS SDRLFALN  L+FYTPE+YFL  + A F+ P F P + L +   L    D +   T  +I             ++ VG PG+GKSTF + ++ P G++ +NRDT+ +WQ CV+   R   E KSV +DNTNPD+ +R+RYI VA+  GV    C  F  S +Q+KHN  FR++  +   H  V++MV   +K K+  P+  E F+E+ +I
Sbjct:  211 WQQIGSLMLFTAAGVTASSKIAGFDIDGCIITTKSGKVFPTGPDDWRILYPEIQPKLASLLKKGYKVVFFTNQMGISRGKLRPEVFKSKAEDILQTLQLPIQVFVSTA-PGIYRKPVIGMWEHLCEKANSGVMVDVSESFYVGDAAGRPANWAPGKKKKDFSCSDRLFALNIGLQFYTPEEYFLGWKPATFSFPEFDPRK-LDSKARLYDPPDASLTSTKQEI-------------IVAVGFPGAGKSTFFQTHIIPKGYAYVNRDTMGSWQHCVSACERALKEGKSVAVDNTNPDLESRKRYIDVAQSAGVS-CRCFNFTASLDQAKHNNRFREMVPSATKHVPVNDMVIHSYKKKFVVPSLSEGFSEVLQI 567          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Zebrafish
Match: pnkp (polynucleotide kinase 3'-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061013-433])

HSP 1 Score: 300.442 bits (768), Expect = 1.457e-92
Identity = 167/373 (44.77%), Postives = 234/373 (62.73%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQL--TVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W +    +++  +G+ +S KIA FD+D  +I +KSGK F    +DW+ LY EI  KL SL + GYK++ F+NQ GI +GKL+ + FK K   I+  L L IQVFV+TA   IYRKP  GM++   ++ NSGV V+ +E FY+GDAAGRPA+WAP KKKKDFS SDRLFALN  L+FYTPE+YFL  + A F+ P F P + L +   L    D +   T  +I             ++ VG PG+GKSTF + ++ P G++ +NRDT+ +WQ CV+   R   E KSV +DNTNPD+ +R+RYI VA+  GV    C  F  S +Q+KHN  FR++  +   H  V++MV   +K K+  P+  E F+E+ +I
Sbjct:  211 WQQIGSLMLFTAAGVTASSKIAGFDIDGCIITTKSGKVFPTGPDDWRILYPEIQPKLASLLKKGYKVVFFTNQMGISRGKLRPEVFKSKAEDILQTLQLPIQVFVSTA-PGIYRKPVIGMWEHLCEKANSGVMVDVSESFYVGDAAGRPANWAPGKKKKDFSCSDRLFALNIGLQFYTPEEYFLGWKPATFSFPEFDPRK-LDSKARLYDPPDASLTSTKQEI-------------IVAVGFPGAGKSTFFQTHIIPKGYAYVNRDTMGSWQHCVSACERALKEGKSVAVDNTNPDLESRKRYIDVAQSAGVS-CRCFNFTASLDQAKHNNRFREMVPSATKHVPVNDMVIHSYKKKFVVPSLSEGFSEVLQI 567          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Xenopus
Match: clmp (CXADR-like membrane protein [Source:Xenbase;Acc:XB-GENE-973667])

HSP 1 Score: 324.324 bits (830), Expect = 1.786e-101
Identity = 178/378 (47.09%), Postives = 242/378 (64.02%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLV-----LVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTV--KSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W +    L++N  G+++S KIA FD+D T+I +KSG+ F  + +DWK LY E+P KLK L  +GYK+I  +NQ GI +GKLK + FK K+ AI+  LG+ +QVFVAT    IYRKP TGM+D    + N G+EV   +  Y+GDAAGRPA+WAP +KKKDFS SDRLFALN  +KF+TPE++FL  ++AAF  PVF P                   +T N   ++    SA LV     +V+ VG PG+GKSTF K+++ P G+   NRDTL TWQKCVA         KS+VIDNTNPD+ +R RYI  A++ GV    C +F  + E++KHN  FR++T   K H +V++MV   ++ K+ EP+A E F+EI KI
Sbjct:  211 WEEHGKLLLFNKKGVQASSKIAGFDIDGTIITTKSGRVFPVNADDWKILYPEVPRKLKELLANGYKVIFITNQMGISRGKLKPEVFKAKVEAILDHLGIPVQVFVATGM-GIYRKPVTGMWDHLCNKANDGIEVKKEDCLYVGDAAGRPANWAPDRKKKDFSCSDRLFALNIGIKFFTPEEFFLGWKKAAFNFPVFDP-------------------RTINPSGQLYEPPSASLVSPSPEVVVAVGFPGAGKSTFFKEHMIPKGYECANRDTLGTWQKCVAACEAALKRGKSIVIDNTNPDLESRSRYIDCAKKAGVP-ARCFLFTATIEEAKHNNRFREMTYTGKGHVSVNDMVINSYRTKFVEPSASEGFSEILKI 567          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Xenopus
Match: clmp (CXADR-like membrane protein [Source:Xenbase;Acc:XB-GENE-973667])

HSP 1 Score: 324.324 bits (830), Expect = 5.070e-101
Identity = 178/378 (47.09%), Postives = 242/378 (64.02%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLV-----LVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTV--KSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W +    L++N  G+++S KIA FD+D T+I +KSG+ F  + +DWK LY E+P KLK L  +GYK+I  +NQ GI +GKLK + FK K+ AI+  LG+ +QVFVAT    IYRKP TGM+D    + N G+EV   +  Y+GDAAGRPA+WAP +KKKDFS SDRLFALN  +KF+TPE++FL  ++AAF  PVF P                   +T N   ++    SA LV     +V+ VG PG+GKSTF K+++ P G+   NRDTL TWQKCVA         KS+VIDNTNPD+ +R RYI  A++ GV    C +F  + E++KHN  FR++T   K H +V++MV   ++ K+ EP+A E F+EI KI
Sbjct:  252 WEEHGKLLLFNKKGVQASSKIAGFDIDGTIITTKSGRVFPVNADDWKILYPEVPRKLKELLANGYKVIFITNQMGISRGKLKPEVFKAKVEAILDHLGIPVQVFVATGM-GIYRKPVTGMWDHLCNKANDGIEVKKEDCLYVGDAAGRPANWAPDRKKKDFSCSDRLFALNIGIKFFTPEEFFLGWKKAAFNFPVFDP-------------------RTINPSGQLYEPPSASLVSPSPEVVVAVGFPGAGKSTFFKEHMIPKGYECANRDTLGTWQKCVAACEAALKRGKSIVIDNTNPDLESRSRYIDCAKKAGVP-ARCFLFTATIEEAKHNNRFREMTYTGKGHVSVNDMVINSYRTKFVEPSASEGFSEILKI 608          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Xenopus
Match: clmp (CXADR-like membrane protein [Source:Xenbase;Acc:XB-GENE-973667])

HSP 1 Score: 290.426 bits (742), Expect = 3.083e-89
Identity = 160/335 (47.76%), Postives = 214/335 (63.88%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLV-----LVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHN 1266
            W +    L++N  G+++S KIA FD+D T+I +KSG+ F  + +DWK LY E+P KLK L  +GYK+I  +NQ GI +GKLK + FK K+ AI+  LG+ +QVFVAT    IYRKP TGM+D    + N G+EV   +  Y+GDAAGRPA+WAP +KKKDFS SDRLFALN  +KF+TPE++FL  ++AAF  PVF P                   +T N   ++    SA LV     +V+ VG PG+GKSTF K+++ P G+   NRDTL TWQKCVA         KS+VIDNTNPD+ +R RYI  A++ GV    C +F  + E++KHN
Sbjct:  221 WEEHGKLLLFNKKGVQASSKIAGFDIDGTIITTKSGRVFPVNADDWKILYPEVPRKLKELLANGYKVIFITNQMGISRGKLKPEVFKAKVEAILDHLGIPVQVFVATGM-GIYRKPVTGMWDHLCNKANDGIEVKKEDCLYVGDAAGRPANWAPDRKKKDFSCSDRLFALNIGIKFFTPEEFFLGWKKAAFNFPVFDP-------------------RTINPSGQLYEPPSASLVSPSPEVVVAVGFPGAGKSTFFKEHMIPKGYECANRDTLGTWQKCVAACEAALKRGKSIVIDNTNPDLESRSRYIDCAKKAGVP-ARCFLFTATIEEAKHN 534          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Xenopus
Match: clmp (CXADR-like membrane protein [Source:Xenbase;Acc:XB-GENE-973667])

HSP 1 Score: 274.633 bits (701), Expect = 9.928e-83
Identity = 161/378 (42.59%), Postives = 222/378 (58.73%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLV-----LVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTV--KSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W +    L++N  G+++S KIA FD+D T+I +KSG+ F              PG L    +    L   + +G +     K + FK K+ AI+  LG+ +QVFVAT    IYRKP TGM+D    + N G+EV   +  Y+GDAAGRPA+WAP +KKKDFS SDRLFALN  +KF+TPE++FL  ++AAF  PVF P                   +T N   ++    SA LV     +V+ VG PG+GKSTF K+++ P G+   NRDTL TWQKCVA         KS+VIDNTNPD+ +R RYI  A++ GV    C +F  + E++KHN  FR++T   K H +V++MV   ++ K+ EP+A E F+EI KI
Sbjct:  223 WEEHGKLLLFNKKGVQASSKIAGFDIDGTIITTKSGRVF--------------PGPLHVASQ---LLTAATFRGKL-----KPEVFKAKVEAILDHLGIPVQVFVATGMG-IYRKPVTGMWDHLCNKANDGIEVKKEDCLYVGDAAGRPANWAPDRKKKDFSCSDRLFALNIGIKFFTPEEFFLGWKKAAFNFPVFDP-------------------RTINPSGQLYEPPSASLVSPSPEVVVAVGFPGAGKSTFFKEHMIPKGYECANRDTLGTWQKCVAACEAALKRGKSIVIDNTNPDLESRSRYIDCAKKAGVP-ARCFLFTATIEEAKHNNRFREMTYTGKGHVSVNDMVINSYRTKFVEPSASEGFSEILKI 557          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Xenopus
Match: clmp (CXADR-like membrane protein [Source:Xenbase;Acc:XB-GENE-973667])

HSP 1 Score: 250.366 bits (638), Expect = 1.623e-74
Identity = 156/378 (41.27%), Postives = 217/378 (57.41%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLV-----LVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTV--KSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W +    L++N  G+++S KIA FD+D T+I +KSG+ F  + +DWK LY E+P KLK L  +GYK+I  +NQ GI +GKLK + FK K+ AI+  LG+ +QVFVAT    IYR               +  + + + + Y   AAGRPA+WAP +KKKDFS SDRLFALN  +KF+TPE++FL  ++AAF  PVF P                   +T N   ++    SA LV     +V+ VG PG  ++                 DTL TWQKCVA         KS+VIDNTNPD+ +R RYI  A++ GV    C +F  + E++KHN  FR++T   K H +V++MV   ++ K+ EP+A E F+EI KI
Sbjct:  155 WEEHGKLLLFNKKGVQASSKIAGFDIDGTIITTKSGRVFPVNADDWKILYPEVPRKLKELLANGYKVIFITNQMGISRGKLKPEVFKAKVEAILDHLGIPVQVFVATGM-GIYR--------------GNSFKTHLSVIIY---AAGRPANWAPDRKKKDFSCSDRLFALNIGIKFFTPEEFFLGWKKAAFNFPVFDP-------------------RTINPSGQLYEPPSASLVSPSPEVVVAVGFPGGDENI---------------PDTLGTWQKCVAACEAALKRGKSIVIDNTNPDLESRSRYIDCAKKAGVP-ARCFLFTATIEEAKHNNRFREMTYTGKGHVSVNDMVINSYRTKFVEPSASEGFSEILKI 479          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Mouse
Match: Pnkp (polynucleotide kinase 3'- phosphatase [Source:MGI Symbol;Acc:MGI:1891698])

HSP 1 Score: 304.679 bits (779), Expect = 5.801e-95
Identity = 166/394 (42.13%), Postives = 243/394 (61.68%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDH-----KNLYSKY 1443
            W   K  LV+  SG+K   K+A+FDLD TLI ++SGK F  S +DW+ LY EIP KL+ L  +GYKL+IF+NQ GIG+GKL  + FK K+ A++ KLG+  QV VAT ++ + RKP +GM+D   ++ N G+ ++  +  ++GDAAGR A+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P   + ++  L +   ++      ++             V+ VG PG+GKSTF +++L   G+  +NRDTL +WQ+CV+  +    + K VVIDNTNPDV +R RYI  A++ GV    C  F  + EQ++HN  FR++T  SH  VS+MV   ++ ++  PT  E F EI +I     F  ++H     + LY ++
Sbjct:  146 WESLKKLLVFTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKLVIFTNQMGIGRGKLPAEVFKGKVEAVLEKLGVPFQVLVAT-HAGLNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFATPEEFFLKWPAARFELPAFDP-RTISSAGPLYLPESSSLLSPNPEV-------------VVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVP-CRCFNFCATIEQARHNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEILEI----PFRLQEHLDPALQRLYRQF 519          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Mouse
Match: Pnkp (polynucleotide kinase 3'- phosphatase [Source:MGI Symbol;Acc:MGI:1891698])

HSP 1 Score: 304.679 bits (779), Expect = 5.801e-95
Identity = 166/394 (42.13%), Postives = 243/394 (61.68%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDH-----KNLYSKY 1443
            W   K  LV+  SG+K   K+A+FDLD TLI ++SGK F  S +DW+ LY EIP KL+ L  +GYKL+IF+NQ GIG+GKL  + FK K+ A++ KLG+  QV VAT ++ + RKP +GM+D   ++ N G+ ++  +  ++GDAAGR A+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P   + ++  L +   ++      ++             V+ VG PG+GKSTF +++L   G+  +NRDTL +WQ+CV+  +    + K VVIDNTNPDV +R RYI  A++ GV    C  F  + EQ++HN  FR++T  SH  VS+MV   ++ ++  PT  E F EI +I     F  ++H     + LY ++
Sbjct:  146 WESLKKLLVFTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKLVIFTNQMGIGRGKLPAEVFKGKVEAVLEKLGVPFQVLVAT-HAGLNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFATPEEFFLKWPAARFELPAFDP-RTISSAGPLYLPESSSLLSPNPEV-------------VVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVP-CRCFNFCATIEQARHNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEILEI----PFRLQEHLDPALQRLYRQF 519          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Mouse
Match: Pnkp (polynucleotide kinase 3'- phosphatase [Source:MGI Symbol;Acc:MGI:1891698])

HSP 1 Score: 261.922 bits (668), Expect = 4.572e-79
Identity = 144/394 (36.55%), Postives = 216/394 (54.82%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDH-----KNLYSKY 1443
            W   K  LV+  SG+K   K+A+FDLD TLI ++SGK F  S +DW+ LY EIP KL+ L  +GYK+++ ++ G                                     + RKP +GM+D   ++ N G+ ++  +  ++GDAAGR A+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P   + ++  L +   ++      ++             V+ VG PG+GKSTF +++L   G+  +NRDTL +WQ+CV+  +    + K VVIDNTNPDV +R RYI  A++ GV    C  F  + EQ++HN  FR++T  SH  VS+MV   ++ ++  PT  E F EI +I     F  ++H     + LY ++
Sbjct:  146 WESLKKLLVFTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKVLVATHAG-------------------------------------LNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFATPEEFFLKWPAARFELPAFDP-RTISSAGPLYLPESSSLLSPNPEV-------------VVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVP-CRCFNFCATIEQARHNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEILEI----PFRLQEHLDPALQRLYRQF 483          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Mouse
Match: Pnkp (polynucleotide kinase 3'- phosphatase [Source:MGI Symbol;Acc:MGI:1891698])

HSP 1 Score: 209.534 bits (532), Expect = 3.154e-60
Identity = 115/265 (43.40%), Postives = 168/265 (63.40%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINR 1071
            W   K  LV+  SG+K   K+A+FDLD TLI ++SGK F  S +DW+ LY EIP KL+ L  +GYKL+IF+NQ GIG+GKL  + FK K+ A++ KLG+  QV VAT ++ + RKP +GM+D   ++ N G+ ++  +  ++GDAAGR A+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P   + ++  L +   ++      ++             V+ VG PG+GKSTF +++L   G+  +NR
Sbjct:  146 WESLKKLLVFTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKLVIFTNQMGIGRGKLPAEVFKGKVEAVLEKLGVPFQVLVAT-HAGLNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFATPEEFFLKWPAARFELPAFDP-RTISSAGPLYLPESSSLLSPNPEV-------------VVAVGFPGAGKSTFIQEHLVSAGYVHVNR 395          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Mouse
Match: Pnkp (polynucleotide kinase 3'- phosphatase [Source:MGI Symbol;Acc:MGI:1891698])

HSP 1 Score: 134.806 bits (338), Expect = 4.216e-35
Identity = 78/186 (41.94%), Postives = 116/186 (62.37%), Query Frame = 1
Query:  475 KLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFC 1029
            KL+IF+NQ GIG+GKL  + FK K+ A++ KLG+  QV VAT ++ + RKP +GM+D   ++ N G+ ++  +  ++GDAAGR A+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P   + ++  L +   ++      ++             V+ VG PG+GKSTF 
Sbjct:   85 KLVIFTNQMGIGRGKLPAEVFKGKVEAVLEKLGVPFQVLVAT-HAGLNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFATPEEFFLKWPAARFELPAFDP-RTISSAGPLYLPESSSLLSPNPEV-------------VVAVGFPGAGKSTFI 255          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. UniProt/SwissProt
Match: sp|Q96T60|PNKP_HUMAN (Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP PE=1 SV=1)

HSP 1 Score: 310.457 bits (794), Expect = 2.931e-96
Identity = 164/371 (44.20%), Postives = 231/371 (62.26%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W   +  LV+  +G+K   K+A FDLD TLI ++SGK F    +DW+ LY EIP KL+ L+ +GYKL+IF+NQ  IG+GKL  ++FK K+ A+V KLG+  QV VAT ++ +YRKP TGM+D   ++ N G  ++  +  ++GDAAGRPA+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P  V ++                 + + +L   SA   +V+ VG PG+GKSTF KK+L   G+  +NRDTL +WQ+CV        + K V IDNTNPD A+R RY+  A   GV    C +F  + EQ++HN  FR++T  SH  VS+MV   ++ ++  PT  E F+ I +I
Sbjct:  147 WENLEKLLVFTAAGVKPQGKVAGFDLDGTLITTRSGKVFPTGPSDWRILYPEIPRKLRELEAEGYKLVIFTNQMSIGRGKLPAEEFKAKVEAVVEKLGVPFQVLVAT-HAGLYRKPVTGMWDHLQEQANDGTPISIGDSIFVGDAAGRPANWAPGRKKKDFSCADRLFALNLGLPFATPEEFFLKWPAAGFELPAFDPRTVSRSGP-----------LCLPESRALL---SASPEVVVAVGFPGAGKSTFLKKHLVSAGYVHVNRDTLGSWQRCVTTCETALKQGKRVAIDNTNPDAASRARYVQCARAAGVP-CRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILEI 501          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. UniProt/SwissProt
Match: sp|Q9JLV6|PNKP_MOUSE (Bifunctional polynucleotide phosphatase/kinase OS=Mus musculus OX=10090 GN=Pnkp PE=1 SV=2)

HSP 1 Score: 304.679 bits (779), Expect = 3.973e-94
Identity = 166/394 (42.13%), Postives = 243/394 (61.68%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDH-----KNLYSKY 1443
            W   K  LV+  SG+K   K+A+FDLD TLI ++SGK F  S +DW+ LY EIP KL+ L  +GYKL+IF+NQ GIG+GKL  + FK K+ A++ KLG+  QV VAT ++ + RKP +GM+D   ++ N G+ ++  +  ++GDAAGR A+WAP +KKKDFS +DRLFALN  L F TPE++FL+   A F +P F P   + ++  L +   ++      ++             V+ VG PG+GKSTF +++L   G+  +NRDTL +WQ+CV+  +    + K VVIDNTNPDV +R RYI  A++ GV    C  F  + EQ++HN  FR++T  SH  VS+MV   ++ ++  PT  E F EI +I     F  ++H     + LY ++
Sbjct:  146 WESLKKLLVFTASGVKPQGKVAAFDLDGTLITTRSGKVFPTSPSDWRILYPEIPKKLQELAAEGYKLVIFTNQMGIGRGKLPAEVFKGKVEAVLEKLGVPFQVLVAT-HAGLNRKPVSGMWDHLQEQANEGIPISVEDSVFVGDAAGRLANWAPGRKKKDFSCADRLFALNVGLPFATPEEFFLKWPAARFELPAFDP-RTISSAGPLYLPESSSLLSPNPEV-------------VVAVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAKDAGVP-CRCFNFCATIEQARHNNRFREMTDPSHAPVSDMVMFSYRKQFEPPTLAEGFLEILEI----PFRLQEHLDPALQRLYRQF 519          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. UniProt/SwissProt
Match: sp|Q19683|YZR5_CAEEL (Uncharacterized protein F21D5.5 OS=Caenorhabditis elegans OX=6239 GN=F21D5.5 PE=2 SV=2)

HSP 1 Score: 291.197 bits (744), Expect = 2.467e-90
Identity = 170/391 (43.48%), Postives = 237/391 (60.61%), Query Frame = 1
Query:  295 DYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQE-EAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKD----SADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLD 1452
            D +++  S  +  EKIA+FD+D TLI +KSGK F  +  DW+ LYD IP   K L  DG+K++IF+NQ GI  GK+   +F+KKI AIV KLG+ +Q FV+ A    YRKPC GM++  +K  N  VE+N  E  ++GDAAGR      + KKD S +DR FA N  +KF TPE++F + + +  +  P F P  +                  + +I E+ P D    S++  ++LMVG PGSGKSTF K       + I+NRDT+ TWQKCVA TR    + KSVVIDNT+PD+ +R+RYI VA+E GV  I C   + S E ++HN  FR LT  +   +S MV ++HK KY EPT  E F++I K+    +F+ E+H+ LY  YL++
Sbjct:   38 DLMIFTHSECEGKEKIAAFDMDGTLIKTKSGKVFPTNCQDWQLLYDSIPSDFKKLHSDGFKIVIFTNQKGIHAGKVDRNEFRKKIEAIVGKLGIPVQAFVSVA-GGHYRKPCVGMWNE-LKLRNDEVEINEKESIFVGDAAGR-IKTTSRPKKDHSYADRFFAANVGVKFQTPEEFFGKSKVDEPWGPPNFDPKNLF-----------------SEEITELEPHDAQLKSSEKEIILMVGFPGSGKSTFAKMLGHQHDYKIVNRDTIGTWQKCVAATRSYLADGKSVVIDNTSPDLESRKRYIDVAKELGVP-IRCFEMNCSMEHAQHNIRFRVLTDDNAAEISSMVLRIHKGKYVEPTLSEGFSQIVKVNFRPKFEVEEHEKLYKMYLIE 407          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. UniProt/SwissProt
Match: sp|O13911|PNK1_SCHPO (Bifunctional polynucleotide phosphatase/kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pnk1 PE=1 SV=2)

HSP 1 Score: 184.882 bits (468), Expect = 1.397e-50
Identity = 123/363 (33.88%), Postives = 189/363 (52.07%), Query Frame = 1
Query:  346 SFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLY 1434
            +FDLD TLI +KSG+ F+    DW + +  +  KLK+L +D Y L+IFSNQ GI +       F+ KI AI   L L I V  A      +RKP TGM++ F+K+ N  ++++   + Y+GDAAGRP D         +++D  FA N  +KF TPE++FL           F P   L  ++       + +H   ++ +EI          V++VG P SGKST  +  +   G+  +N+D LKT  KC+        + KSVVIDNTNP + +R+ +I +A+E  +  I C     S+E ++HN  FR +   +   + E+ F   K+++  PT  E FT + ++      D ED  N +
Sbjct:   72 AFDLDGTLIKTKSGRVFSKDAADWTWWHPSVVPKLKALYQDNYSLVIFSNQNGIPRKPSAGHTFQMKIRAIFESLDLPI-VLYAAILKDKFRKPLTGMWNSFLKDVNRSIDLSF--IKYVGDAAGRPGD--------HNSTDLKFAENIGIKFETPEQFFLGHSFVPPNFESFHPKNYLVRNSS-----SHPYHFKKSEHQEI----------VVLVGFPSSGKSTLAESQIVTQGYERVNQDILKTKSKCIKAAIEALKKEKSVVIDNTNPTIESRKMWIDIAQEFEIP-IRCIHLQSSEELARHNNVFRYIH-HNQKQLPEIAFNSFKSRFQMPTVEEGFTNVEEVPFKCLKDYEDTWNYW 406          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. UniProt/SwissProt
Match: sp|Q5UQD2|PNKP_MIMIV (Putative bifunctional polynucleotide phosphatase/kinase OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L469 PE=3 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 7.275e-47
Identity = 135/401 (33.67%), Postives = 204/401 (50.87%), Query Frame = 1
Query:  277 DWIKGKDYL---VYNPSGIKSSEKIASFDLDDTLIV-SKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXX-XXXINAIVSKLG------LKIQVFVATAYSSIYRKPCTGMFDLFVK----EYNSGVEVNHNEMFYIGDAAGR--PADWAPK-----KKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLV----------LVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQL-TVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEI 1380
            DWI+   YL   + N   +    ++ASFDLDDTLIV SK  +K       WK +   I  K+  L E+ Y +I+F+NQGG+   K  +K   +K ++ +V  L           ++VA  Y  IYRKP  G+++L  +    E+N        + F+ GDAAGR  P+ +  K     K  DFS++DR FALN  +KF TPE+++L                  K S  L+  Y  +    T  I EI   ++  LV          +++M+G PGSGKS F K Y+ P G+  IN+D  KT  KC++ET     + KSVVIDNTNPDV +R  Y ++A+E    H+   I +  DE +KH  + R + +  +   V+++ + +++  +  P   E F +I
Sbjct:   20 DWIESDSYLKGIINNKPKLHDPVRVASFDLDDTLIVRSKKTQK-------WKLVDSSIKQKIAELIENKYIIIVFTNQGGMSLNKKFDKPLWRKAMDDLVKILTSETDNDFYFAIYVAKKYD-IYRKPNIGLWNLMKQDIKDEFNLDSVQISTKSFFCGDAAGRIYPSMFKKKLYPTSKGGDFSDTDRKFALNIGIKFLTPEEFYLDS----------------KNSENLKTNYKLSGVNPTEIIDEI---ENTKLVNYKFKPRKKEMIVMIGQPGSGKSFFVKNYILPNGYVHINQDKCKTKAKCLSETENALSKGKSVVIDNTNPDVISRMTYTNLAKENNYDHVRAIIMETPDELAKHLNNVRHIYSSGTVPKVTDIAYNIYRKNFVLPQYEENFDKI 393          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. TrEMBL
Match: A0A0P4WYG0 (FHA_2 domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.058e-106
Identity = 190/387 (49.10%), Postives = 250/387 (64.60%), Query Frame = 1
Query:  295 DYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLDK 1455
            D LVY  + +  SEKIA +D+D TLI ++SGK FA S++DWK LY E+PGKLK L + GYK++IF+NQ GIG GK   +  +KKI +I+ KLG+ IQVFV+T     YRKP  GM+  F  E N GVEV+ ++  Y+GDAAGRPA+   KKKKDFS SDRLFALN  LKFYTPE++FL  +  AF MP F P EV   S  L   YD +  K      E+          +++VG PGSGKS FC   L PLG+   NRDT+ +WQKC++   +   + K VVIDNTNPD+ +R+RYI  A++CGV  + C IF  S + S+HN  FR+ + + H  VS+MVF M+K+KY EPT  E F +I K+     F N+  + LY  +LL+K
Sbjct:  135 DLLVYQKN-MSGSEKIAGYDMDGTLIATQSGKVFATSYDDWKILYSEVPGKLKKLHDSGYKIVIFTNQAGIGTGKHTVEGIQKKIESIIQKLGVPIQVFVSTGKGE-YRKPAIGMWKFFQNEANGGVEVDLDKSIYVGDAAGRPAEG--KKKKDFSFSDRLFALNVGLKFYTPEEHFLDVKPQAFNMPDFDPREV-DASLPL---YDPSTTKVPGHKLEV----------IILVGFPGSGKSFFCSTQLVPLGYVSANRDTIGSWQKCMSLMEQSLKDGKHVVIDNTNPDLDSRKRYIEAAKKCGVP-VRCFIFATSKDHSRHNNKFREFSGEDHSKVSDMVFNMYKSKYVEPTLKEGFHDIVKVNFIPHFKNKSEEKLYRMFLLEK 502          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. TrEMBL
Match: A0A0P4WQL4 (FHA_2 domain-containing protein OS=Scylla olivacea OX=85551 PE=4 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 3.092e-106
Identity = 190/387 (49.10%), Postives = 250/387 (64.60%), Query Frame = 1
Query:  295 DYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLDK 1455
            D LVY  + +  SEKIA +D+D TLI ++SGK FA S++DWK LY E+PGKLK L + GYK++IF+NQ GIG GK   +  +KKI +I+ KLG+ IQVFV+T     YRKP  GM+  F  E N GVEV+ ++  Y+GDAAGRPA+   KKKKDFS SDRLFALN  LKFYTPE++FL  +  AF MP F P EV   S  L   YD +  K               L ++++VG PGSGKS FC   L PLG+   NRDT+ +WQKC++   +   + K VVIDNTNPD+ +R+RYI  A++CGV  + C IF  S + S+HN  FR+ + + H  VS+MVF M+K+KY EPT  E F +I K+     F N+  + LY  +LL+K
Sbjct:  157 DLLVYQKN-MSGSEKIAGYDMDGTLIATQSGKVFATSYDDWKILYSEVPGKLKKLHDSGYKIVIFTNQAGIGTGKHTVEGIQKKIESIIQKLGVPIQVFVSTGKGE-YRKPAIGMWKFFQNEANGGVEVDLDKSIYVGDAAGRPAEG--KKKKDFSFSDRLFALNVGLKFYTPEEHFLDVKPQAFNMPDFDPREV-DASLPL---YDPSTTKVPGH----------KLEVIILVGFPGSGKSFFCSTQLVPLGYVSANRDTIGSWQKCMSLMEQSLKDGKHVVIDNTNPDLDSRKRYIEAAKKCGVP-VRCFIFATSKDHSRHNNKFREFSGEDHSKVSDMVFNMYKSKYVEPTLKEGFHDIVKVNFIPHFKNKSEEKLYRMFLLEK 524          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. TrEMBL
Match: A0A0C9QEX3 (PNKP_0 protein OS=Fopius arisanus OX=64838 GN=PNKP_0 PE=4 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 2.093e-102
Identity = 176/385 (45.71%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  301 LVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLDK 1455
            +++   G++S  KIA++D+D TLI ++SG  F    NDWK L+  IPGKLK L  DGYK++IF+NQGG+G GK K  DFK+KI  +V +L + IQVF+ATA  S YRKP TGM+D  VK  N GV ++ ++ F++GDAAGRP DWAPKKKKD S +DRLFALN +L FYTPE++FL Q+   + +PVF P  V   +       D    + ++ I+E+          +LMVG+PG+GK+   + YL+   +  INRD L +WQKCVAE  ++  + KSVVIDNTNPD  +R+R++ VA+   +  + C +   S E +KHN  FR+LT  SH  +SE++   +   + EP+  E F+EI KI    +F +E  + LY+ YLL+K
Sbjct:   63 MIFTAEGVQSRSKIAAYDMDGTLITTQSGLVFPKDLNDWKILFPGIPGKLKELHSDGYKIVIFTNQGGLGLGKSKPNDFKQKIERVVKRLAVPIQVFIATARDS-YRKPVTGMWDRLVKFCNDGVPIDKDKSFFVGDAAGRPKDWAPKKKKDHSLADRLFALNVDLTFYTPEEHFLGQKPVKYNLPVFDPKRVEDNADVC----DPPIAQLSSKIQEV----------ILMVGAPGTGKTHVVQNYLK--DYHHINRDRLGSWQKCVAEMEKILSKGKSVVIDNTNPDPTSRQRFLHVAKSKNIP-VRCFLMKTSVEHAKHNNRFRELTDPSHMVISEIIINSYVKNFVEPSMDEGFSEIVKINFVPKFQSEKERELYTMYLLEK 429          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. TrEMBL
Match: A0A0C9R1P0 (PNKP_2 protein OS=Fopius arisanus OX=64838 GN=PNKP_2 PE=4 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 4.293e-100
Identity = 176/385 (45.71%), Postives = 249/385 (64.68%), Query Frame = 1
Query:  301 LVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLDK 1455
            +++   G++S  KIA++D+D TLI ++SG  F    NDWK L+  IPGKLK L  DGYK++IF+NQGG+G GK K  DFK+KI  +V +L + IQVF+ATA  S YRKP TGM+D  VK  N GV ++ ++ F++GDAAGRP DWAPKKKKD S +DRLFALN +L FYTPE++FL Q+   + +PVF P  V   +       D    + ++ I+E+          +LMVG+PG+GK+   + YL+   +  INRD L +WQKCVAE  ++  + KSVVIDNTNPD  +R+R++ VA+   +  + C +   S E +KHN  FR+LT  SH  +SE++   +   + EP+  E F+EI KI    +F +E  + LY+ YLL+K
Sbjct:  178 MIFTAEGVQSRSKIAAYDMDGTLITTQSGLVFPKDLNDWKILFPGIPGKLKELHSDGYKIVIFTNQGGLGLGKSKPNDFKQKIERVVKRLAVPIQVFIATARDS-YRKPVTGMWDRLVKFCNDGVPIDKDKSFFVGDAAGRPKDWAPKKKKDHSLADRLFALNVDLTFYTPEEHFLGQKPVKYNLPVFDPKRVEDNADVC----DPPIAQLSSKIQEV----------ILMVGAPGTGKTHVVQNYLK--DYHHINRDRLGSWQKCVAEMEKILSKGKSVVIDNTNPDPTSRQRFLHVAKSKNIP-VRCFLMKTSVEHAKHNNRFRELTDPSHMVISEIIINSYVKNFVEPSMDEGFSEIVKINFVPKFQSEKERELYTMYLLEK 544          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. TrEMBL
Match: A0A087UUB5 (Bifunctional polynucleotide phosphatase/kinase (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_03106 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.435e-99
Identity = 175/387 (45.22%), Postives = 250/387 (64.60%), Query Frame = 1
Query:  301 LVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVK--SHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLDK 1455
             ++ P+G++   KIA+FD+D T+I +KSGK F    +DWK LY EIPGK+K L E+GYK+++F+NQ GI +G+    +FKKK+  IV KLGL IQV V+T  S  YRKP TGM+D FV++ N G+ V+ +   Y+GDAAGRP +WAPKKKKDFS +DRLFALN  +KFYTPE++FL Q+ A + MPVF P ++  +   ++ +       T + I       S+   +V+ VG P +GK+ F   YL P G+  INRDTL +WQ CV+E  +   +++ VVIDNTNPD  +R RYI +A++ GV    C  F  S EQ++HN  +R+L      H  V++MV   +K+K+ EPT  E FTE+  I    +F +   + L+ ++LL+K
Sbjct:  215 FIFTPAGLRGQNKIAAFDMDHTIITTKSGKVFPTDMSDWKILYAEIPGKMKKLYEEGYKIVVFTNQKGISRGRTSAPEFKKKVERIVQKLGLPIQVLVSTG-SGRYRKPNTGMWDYFVQKCNQGISVDVSSCLYVGDAAGRPQNWAPKKKKDFSCADRLFALNIGIKFYTPEEFFLGQKPAPYNMPVFDPRKLGASPLAVKCQPPPQKELTADAIV------SSTSEVVIFVGYPAAGKTHFALTYLVPKGYIHINRDTLGSWQNCVSECSKSLSKHQKVVIDNTNPDPESRSRYIEIAKKFGVP-CRCFFFVCSLEQARHNNVYRELQGPDDKHAGVNDMVMNSYKSKFKEPTLKEGFTEVININFIPKFKSIHEEKLFKRFLLEK 593          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Cavefish
Match: pnkp (polynucleotide kinase 3'-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061013-433])

HSP 1 Score: 223.016 bits (567), Expect = 4.052e-64
Identity = 145/393 (36.90%), Postives = 211/393 (53.69%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSV--VIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQL--TVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKY 1443
            W +  + ++Y  +G+ +S KIA FD+D  +I +KSGK F  + +DW+ L+ EI  KL SL + G+K++ F+NQ GI +GKL+ + FK K+  I+  L L +QVFVA A   IYRKP  GM++   ++ N GV V+ ++ FY+GDAAGRP +WAP KKKKDFS SDRLFALN  LKF TPE++FL  + A + MP F+PV              ++F                                 FC   L  +G     RD++  WQ CV+     F     +  +  N      +  RY+ V+ + GV    C  F  S EQSKHN  FR++  +   H  V++MVF  +KNK+A P+  E F+EI +I     F +   + L+ ++
Sbjct:  203 WQQIGNLMLYTAAGVTASSKIAGFDIDGCIITTKSGKVFPTAPDDWRILFPEIQPKLASLLKKGFKVVFFTNQLGIARGKLRPEVFKSKVEDILQTLKLPVQVFVA-AGPGIYRKPVIGMWEHLREKANDGVTVDTSQSFYVGDAAGRPVNWAPGKKKKDFSCSDRLFALNLGLKFSTPEEFFLGWKAAPYNMPSFNPVSF------------SDF---------------------------------FC---LFVIGLVTTYRDSISIWQCCVSFCLPWFGVKIMLLFLFRNIISSHHSLHRYVDVSRKAGVP-CRCFNFTASLEQSKHNNRFREMVPSATKHAPVNDMVFHSYKNKFAAPSLSEGFSEILQIHFVPSFSDSRSEALFRQF 545          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Sea Lamprey
Match: pnkp (polynucleotide kinase 3'-phosphatase [Source:ZFIN;Acc:ZDB-GENE-061013-433])

HSP 1 Score: 248.825 bits (634), Expect = 9.877e-75
Identity = 136/302 (45.03%), Postives = 194/302 (64.24%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRER 1182
            W K  + L++   G+++S K+A FD+D T+I +KSG+ FA   +DWK LY E+P KLK L EDGYK++ F+NQ GI +GKL+  +F+ K+ +I++ LGL +QVFVA+    + RKP  GM+   +++ N G+EV+  +  Y+GDAAGRPA+WAP KKKKDFS SDRLFALN  L F+TPE+ FL  + A +++P F P  ++  S+ L       F   T  +    P+      +V+ VG P +GKSTF K+++   G+S +NRDTL  WQKCVA           VV+DNTN +V  R+R
Sbjct:  219 WEKEGNLLLFTAKGVRASAKVAGFDIDSTIITTKSGRVFATGPDDWKILYPEVPKKLKHLLEDGYKVVFFTNQMGIARGKLRADEFQAKVESIIATLGLPVQVFVASG-PGLIRKPMLGMWHHLIQKANDGIEVDIGKSLYVGDAAGRPANWAPGKKKKDFSCSDRLFALNVGLPFHTPEEIFLGWKTAPYSLPDFDP-RMVSPSSPL-------FLPATATLCHEEPE------VVVAVGFPAAGKSTFFKEHMVSKGYSYVNRDTLGNWQKCVAACEEALRGGHGVVVDNTNLEVDARKR 505          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Yeast
Match: TPP1 (DNA 3'-phosphatase; functions in repair of endogenous damage of double-stranded DNA, activity is specific for removal of 3' phosphates at strand breaks; similar to the l-2-haloacid dehalogenase superfamily; homolog of human polynucleotide kinase/3'-phosphatase [Source:SGD;Acc:S000004765])

HSP 1 Score: 59.3066 bits (142), Expect = 3.050e-10
Identity = 62/214 (28.97%), Postives = 90/214 (42.06%), Query Frame = 1
Query:  340 IASFDLDDTLIVSKSGK-KFADSWNDWKFL-YDEIPGKLKSL----DEDGYKLI-IFSNQGGIGXXXXXXXXXXXXINAIV------------SKLGLKIQVFVATAYSSIY--------------------------RKPCTGMFDLFVKEYNSGVEVNH-------NEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYF 825
            + +FDLD T+I  KS    F+ S +DW+F+ ++     L  L    D D   +I IFSNQGG+       K   K  N I+              L  ++ ++ A      +                          RKP TGM + F ++  S   V+        N ++Y GDAAGR        KKDFS+SD  FA N +++F  PE+ F
Sbjct:   31 VYAFDLDHTIIKPKSPNISFSRSASDWQFINFNSKKSTLDYLCNIIDNDPTAVIVIFSNQGGVITVPRTSKSCTKYTNKILLFLKAIKNDERGETLSHRLWLYAAPKRPKTFAANHSKITFASLGESYNNDPNIFEKVRKPMTGMVEFFKRDLESAYRVSEQISPIKLNWIYYCGDAAGR--------KKDFSDSDIKFAENLHVEFKYPEEIF 236          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Nematostella
Match: EDO33039 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STD7])

HSP 1 Score: 295.434 bits (755), Expect = 2.439e-94
Identity = 160/349 (45.85%), Postives = 220/349 (63.04%), Query Frame = 1
Query:  295 DYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTV--KSHDNVSEMVFKMHK 1335
            + LV+   G++  +KIA FDLD T+I +KSGK F  +  DW  ++ +IPGKLK L  DGYK++ F+NQ GI K K+   DFK KI  I+  LG+  QV ++   +  YRKPCTGM+   +++ N  V VN  E  YIGDAAGRP +W  KKKKDFS SDR FA   ++KFYTPE++FL ++ A F  PVF+P ++L     L       F  T++++    P+      L++MVGSPGSGK+TF K+YL P G++ INRDTL TWQKCV+  R    + K VV+DNTNPD  +R+RYI  A+   V  + C + D+S E +KHN   R++T    S+ +V  M F  +K
Sbjct:    7 ELLVFTSKGVEGRKKIAGFDLDGTIITTKSGKVFPTNTADWTIIFPQIPGKLKQLWRDGYKIVFFTNQNGIAKKKVSVPDFKVKIQRILDLLGVPTQVLISPG-TGHYRKPCTGMWKYLLEKANQSVPVNKEECMYIGDAAGRPVNWETKKKKDFSCSDRTFAAKIDIKFYTPEEFFLGKKPAPFNWPVFNPRKLLDGDRPL-------FTPTSSNLTSNTPE------LIVMVGSPGSGKTTFAKEYLVPKGYTRINRDTLGTWQKCVSACRAALSQGKHVVVDNTNPDQESRKRYIECAKHAKVP-VRCFVMDISLEHAKHNNAVREMTNTDSSYKHVGFMAFNSYK 340          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Nematostella
Match: EDO31131 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYT3])

HSP 1 Score: 143.28 bits (360), Expect = 7.318e-40
Identity = 73/157 (46.50%), Postives = 101/157 (64.33%), Query Frame = 1
Query:  982 LVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTV--KSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYL 1446
            +++MVGSPGSGK+TF K+YL P G++ INRDTL TWQKCV+  R    + K VV+DNTNPD  +R+RYI  A+   V  + C + D+S E +KHN   R++T    S+ NV  M F  +K+ Y EP+  E F EI KI     F N++ ++LY + L
Sbjct:    1 MIVMVGSPGSGKTTFAKEYLVPKGYTRINRDTLGTWQKCVSACRAALSQGKHVVVDNTNPDQESRKRYIECAKHAKVP-VRCFVMDISLEHAKHNNAVREMTNTDSSYKNVGFMAFNSYKSSYKEPSVSEGFDEILKIHFKAVFKNQETRDLYMQCL 156          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Medaka
Match: pnkp (polynucleotide kinase 3'-phosphatase [Source:NCBI gene;Acc:101167386])

HSP 1 Score: 304.294 bits (778), Expect = 5.293e-94
Identity = 173/373 (46.38%), Postives = 233/373 (62.47%), Query Frame = 1
Query:  280 WIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAP-KKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVK--SHDNVSEMVFKMHKNKYAEPTAGEKFTEICKI 1389
            W +  + LVY  +G+ +SEKIA FD+D  +I +KSGK F  + +DWK LY EI  KL SL + GYK++ F+NQ GI KGKL+ + FK K+  +++ L L +QVFVA A   IYRKP TGM+D   ++ N GV V+  + FY+GDAAGRP +WAP KKKKDFS SDRLFALN  L+F+TPE+YFL  + A F +P F P + L ++  L   YD       + + E+          ++ VG P SGKSTF   ++ P G+  +NRDTL +WQKCVA   R   E +SV +DNTNPD  +R+RY+ VA+  GV    C  F  S EQ+KHN  FR++      H  V+EMVF  +K  +  P   E F+EI +I
Sbjct:  225 WEQTGNLLVYTAAGVTASEKIAGFDIDGCIITTKSGKVFPTAPDDWKILYVEIQPKLSSLLKKGYKVVFFTNQLGIAKGKLRPEVFKSKVEDVLATLQLPVQVFVA-AGPGIYRKPVTGMWDHLCEKANDGVTVDLKQSFYVGDAAGRPENWAPGKKKKDFSCSDRLFALNIGLQFHTPEEYFLGWKNAPFNLPDFDPRK-LDSAARL---YDPPSASLISSLTEV----------IVAVGYPASGKSTFFHAHVIPKGYFYVNRDTLGSWQKCVAVCERALSEGRSVAVDNTNPDPESRKRYVDVAKAAGVS-CRCFHFSASLEQAKHNNRFREMAPSDGKHAKVNEMVFHSYKKHFVAPALSEGFSEILQI 581          
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Planmine SMEST
Match: SMESG000034225.1 (SMESG000034225.1)

HSP 1 Score: 852.047 bits (2200), Expect = 0.000e+0
Identity = 455/455 (100.00%), Postives = 455/455 (100.00%), Query Frame = 1
Query:   91 MGXXXXXXXXXXXXXIAKLEKDDKVEDVSEHDTVPETFDXXXXXXXXXXXXFGMVKSDEDFKDWIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGXXXXXXXXXXXXINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLDK 1455
            MGKRKRTASKTKASKIAKLEKDDKVEDVSEHDTVPETFDLKEEKLENVKKKFGMVKSDEDFKDWIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGKGKLKEKDFKKKINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLDK
Sbjct:    1 MGKRKRTASKTKASKIAKLEKDDKVEDVSEHDTVPETFDLKEEKLENVKKKFGMVKSDEDFKDWIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGKKFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGKGKLKEKDFKKKINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHNEMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEEAAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVLMVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSVVIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTVKSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSKYLLDK 455          
The following BLAST results are available for this feature:
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PNKP6.104e-9744.20polynucleotide kinase 3'-phosphatase [Source:HGNC ... [more]
PNKP6.104e-9744.20polynucleotide kinase 3'-phosphatase [Source:HGNC ... [more]
PNKP1.724e-8138.27polynucleotide kinase 3'-phosphatase [Source:HGNC ... [more]
PNKP6.520e-8140.43polynucleotide kinase 3'-phosphatase [Source:HGNC ... [more]
PNKP5.028e-6345.28polynucleotide kinase 3'-phosphatase [Source:HGNC ... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F21D5.51.939e-9143.48pep chromosome:WBcel235:IV:8735695:8739394:-1 gene... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG96011.334e-8540.21gene:FBgn0037578 transcript:FBtr0081854[more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnkp3.413e-9344.04polynucleotide kinase 3'-phosphatase [Source:ZFIN;... [more]
pnkp1.457e-9244.77polynucleotide kinase 3'-phosphatase [Source:ZFIN;... [more]
pnkp1.457e-9244.77polynucleotide kinase 3'-phosphatase [Source:ZFIN;... [more]
pnkp1.457e-9244.77polynucleotide kinase 3'-phosphatase [Source:ZFIN;... [more]
pnkp1.457e-9244.77polynucleotide kinase 3'-phosphatase [Source:ZFIN;... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clmp1.786e-10147.09CXADR-like membrane protein [Source:Xenbase;Acc:XB... [more]
clmp5.070e-10147.09CXADR-like membrane protein [Source:Xenbase;Acc:XB... [more]
clmp3.083e-8947.76CXADR-like membrane protein [Source:Xenbase;Acc:XB... [more]
clmp9.928e-8342.59CXADR-like membrane protein [Source:Xenbase;Acc:XB... [more]
clmp1.623e-7441.27CXADR-like membrane protein [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pnkp5.801e-9542.13polynucleotide kinase 3'- phosphatase [Source:MGI ... [more]
Pnkp5.801e-9542.13polynucleotide kinase 3'- phosphatase [Source:MGI ... [more]
Pnkp4.572e-7936.55polynucleotide kinase 3'- phosphatase [Source:MGI ... [more]
Pnkp3.154e-6043.40polynucleotide kinase 3'- phosphatase [Source:MGI ... [more]
Pnkp4.216e-3541.94polynucleotide kinase 3'- phosphatase [Source:MGI ... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96T60|PNKP_HUMAN2.931e-9644.20Bifunctional polynucleotide phosphatase/kinase OS=... [more]
sp|Q9JLV6|PNKP_MOUSE3.973e-9442.13Bifunctional polynucleotide phosphatase/kinase OS=... [more]
sp|Q19683|YZR5_CAEEL2.467e-9043.48Uncharacterized protein F21D5.5 OS=Caenorhabditis ... [more]
sp|O13911|PNK1_SCHPO1.397e-5033.88Bifunctional polynucleotide phosphatase/kinase OS=... [more]
sp|Q5UQD2|PNKP_MIMIV7.275e-4733.67Putative bifunctional polynucleotide phosphatase/k... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0P4WYG01.058e-10649.10FHA_2 domain-containing protein OS=Scylla olivacea... [more]
A0A0P4WQL43.092e-10649.10FHA_2 domain-containing protein OS=Scylla olivacea... [more]
A0A0C9QEX32.093e-10245.71PNKP_0 protein OS=Fopius arisanus OX=64838 GN=PNKP... [more]
A0A0C9R1P04.293e-10045.71PNKP_2 protein OS=Fopius arisanus OX=64838 GN=PNKP... [more]
A0A087UUB51.435e-9945.22Bifunctional polynucleotide phosphatase/kinase (Fr... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pnkp4.052e-6436.90polynucleotide kinase 3'-phosphatase [Source:ZFIN;... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pnkp9.877e-7545.03polynucleotide kinase 3'-phosphatase [Source:ZFIN;... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TPP13.050e-1028.97DNA 3'-phosphatase; functions in repair of endogen... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO330392.439e-9445.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311317.318e-4046.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pnkp5.293e-9446.38polynucleotide kinase 3'-phosphatase [Source:NCBI ... [more]
back to top
BLAST of Bifunctional polynucleotide phosphatase/kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000034225.10.000e+0100.00SMESG000034225.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026367 ID=SMED30026367|Name=Bifunctional polynucleotide phosphatase/kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2103bp
GTAGATTAAGATTTATAATAAAGACTTAAATGAAACACTATTTTTATATA
TAAAATTGTTTTATTAAATTACATTTTTCATCAAATAATTATGGGGAAAA
GAAAACGTACAGCTTCTAAAACAAAAGCAAGTAAAATTGCTAAATTAGAG
AAAGATGATAAAGTTGAAGATGTTAGTGAACATGACACTGTGCCAGAAAC
TTTCGATTTAAAAGAAGAGAAATTAGAAAACGTCAAAAAGAAATTTGGAA
TGGTTAAATCAGATGAAGATTTTAAGGATTGGATCAAAGGAAAAGATTAC
TTAGTGTATAATCCAAGTGGCATTAAATCGTCAGAGAAGATTGCCTCTTT
TGATCTGGATGATACTCTTATCGTGTCTAAATCTGGGAAAAAATTTGCTG
ATTCTTGGAATGATTGGAAATTTTTGTACGATGAAATTCCGGGCAAATTG
AAATCATTAGACGAAGATGGATATAAGCTGATTATATTCTCAAATCAAGG
AGGTATTGGAAAAGGAAAATTGAAAGAAAAAGATTTCAAAAAGAAAATAA
ATGCCATTGTTTCAAAATTGGGGTTAAAAATACAAGTGTTTGTAGCAACG
GCATACTCGAGTATTTATCGCAAGCCCTGTACAGGGATGTTTGATTTATT
TGTCAAGGAATATAATTCTGGAGTAGAAGTGAACCATAACGAAATGTTTT
ATATTGGAGATGCCGCTGGTCGACCTGCTGATTGGGCTCCGAAAAAGAAA
AAAGATTTCAGTAACAGTGATAGATTGTTTGCTCTTAATTGCAATCTGAA
ATTCTATACTCCCGAAAAGTATTTCCTCCAACAAGAGGAAGCTGCATTCA
CGATGCCCGTGTTCAGTCCAGTTGAAGTGTTGAAAACCAGCACTGAACTT
CAGATCAAATATGACAACAATTTCCATAAAACTACAAATGATATAAAAGA
AATTTTACCAAAAGATTCTGCTGATTTAGTGCTGGTATTAATGGTCGGGT
CACCCGGATCCGGGAAAAGTACATTCTGTAAAAAATACCTAGAACCGCTG
GGATTCAGCATTATCAATAGGGATACGCTAAAAACCTGGCAGAAATGTGT
GGCTGAAACCAGGCGATTGTTCGACGAAAACAAATCTGTTGTAATAGATA
ACACGAATCCTGATGTTGCCACACGAGAGCGATACATATCGGTAGCGGAG
GAGTGTGGCGTCAAGCATATAATCTGCTGTATTTTTGACGTGTCCGACGA
GCAATCGAAACACAATGAACATTTCAGGCAACTCACAGTGAAATCGCACG
ATAACGTCAGTGAAATGGTGTTCAAAATGCACAAGAATAAATACGCCGAG
CCGACTGCTGGGGAAAAGTTCACTGAAATCTGCAAAATTGTGCCTGGTCT
AGAATTCGATAATGAGGACCACAAGAATCTTTATTCGAAATATCTACTCG
ACAAATAGGCTCGGTGGCAACGACGGCCTTGGATTCAATGTTTTTAAATC
GATGTTTTTGCTATACTAATAATATTTATTAGCTTGAATATTGTTTTAAT
ATTATATTTTAGAATTTCAGTGTTTCTTTGTTTTGGTTCTGTTGTTATTT
TTATCAATTATTATATCCGATTGTTGCTGTAACTGTGTGTACCTGGGTTT
TGGTTTGAATTTGTCAATGACGGGGATATGTATAATTACTGTGCAGCTGT
AATCATTCTTCTACTTTTATCGCTATGACTACTAATGTATTTCAATGTCG
GGGAGCATTGATATGGCTCAATTCTAACTGCATATCCTCAATGAAAACAC
GTTTTAGTAATTCTAAACCAGTTATAATTGACATTGGTTCTGTAAAGCTA
GTAGGTGGTGTCAACAAGGAGTGAGATTAATTTATAAGTTTGTTAATGTC
TTTGGATTAAAAAGTTTATGATTATTTTGCTCTAAACCACTAATTGCCTT
GGTAATCTACATAGTTGATGAAAATCAATGAATTTCGGGTTCTTAACTGT
TAATGGAAGGTCTAGCGCTTTACTTTTCTAAGTGAGATTAATTATTTTCT
ATAATTCTTGCTTTAAAGGTTTACTTTATTCACTATTGTTTAATGTAACT
TTC
back to top

protein sequence of SMED30026367-orf-1

>SMED30026367-orf-1 ID=SMED30026367-orf-1|Name=SMED30026367-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=456bp
MGKRKRTASKTKASKIAKLEKDDKVEDVSEHDTVPETFDLKEEKLENVKK
KFGMVKSDEDFKDWIKGKDYLVYNPSGIKSSEKIASFDLDDTLIVSKSGK
KFADSWNDWKFLYDEIPGKLKSLDEDGYKLIIFSNQGGIGKGKLKEKDFK
KKINAIVSKLGLKIQVFVATAYSSIYRKPCTGMFDLFVKEYNSGVEVNHN
EMFYIGDAAGRPADWAPKKKKDFSNSDRLFALNCNLKFYTPEKYFLQQEE
AAFTMPVFSPVEVLKTSTELQIKYDNNFHKTTNDIKEILPKDSADLVLVL
MVGSPGSGKSTFCKKYLEPLGFSIINRDTLKTWQKCVAETRRLFDENKSV
VIDNTNPDVATRERYISVAEECGVKHIICCIFDVSDEQSKHNEHFRQLTV
KSHDNVSEMVFKMHKNKYAEPTAGEKFTEICKIVPGLEFDNEDHKNLYSK
YLLDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0098506polynucleotide 3' dephosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0046403polynucleotide 3'-phosphatase activity
GO:0046404ATP-dependent polydeoxyribonucleotide 5'-hydroxyl-kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006551Polynucleotide_phosphatase
IPR006549HAD-SF_hydro_IIIA
IPR036412HAD-like_sf
IPR013954PNK3P
IPR027417P-loop_NTPase
IPR023214HAD_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023214HAD superfamilyGENE3DG3DSA:3.40.50.1000coord: 61..255
e-value: 2.2E-68
score: 231.2
IPR013954Polynucleotide kinase 3 phosphatasePFAMPF08645PNK3Pcoord: 83..245
e-value: 1.2E-54
score: 184.4
IPR006551Polynucleotide 3'-phosphataseTIGRFAMTIGR01664TIGR01664coord: 71..245
e-value: 1.6E-51
score: 172.5
NoneNo IPR availablePFAMPF13671AAA_33coord: 344..421
e-value: 3.7E-6
score: 27.1
coord: 298..337
e-value: 1.1E-7
score: 32.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 272..452
e-value: 1.2E-50
score: 173.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 13..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availablePANTHERPTHR12083:SF9BIFUNCTIONAL POLYNUCLEOTIDE PHOSPHATASE/KINASEcoord: 12..453
NoneNo IPR availablePANTHERPTHR12083POLYNUCLEOTIDE KINASE- 3'-PHOSPHATASEcoord: 12..453
NoneNo IPR availableCDDcd17871GPN2coord: 300..328
e-value: 0.00300382
score: 36.7453
IPR006549HAD-superfamily hydrolase,subfamily IIIATIGRFAMTIGR01662TIGR01662coord: 83..217
e-value: 1.1E-27
score: 94.8
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 297..427
IPR036412HAD-like superfamilySUPERFAMILYSSF56784HAD-likecoord: 69..254