SMED-P53

Overview
NameSMED-P53 (ACN51391.1)
Smed IDSMED30026364
Uniprot Best hitCellular tumor antigen p53 OS=Platichthys flesus OX=8260 GN=tp53 PE=2 SV=1 (E=4.13202e-13)
Length (bp)2047
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED-P53 (SMED30026364) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED-P53 (SMED30026364) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED-P53 (SMED30026364) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED-P53 (SMED30026364) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

SMED-P53 ( p53 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the Category 2 cell, integumental system and zeta neoblast

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Definitive epidermal progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and p53 (green). Definitive epidermal progenitors, coexpressing piwi-1 and p53, are dispersed in the embryonic wall.  As definitive epidermal progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of p53.

Anatomical Expression

PAGE et. al., 2020




SMED30026364

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 67

  
PLANA TermReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30026364SMESG000078256.1 SMESG000078255.1 dd_Smed_v4_5563_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
pharynxSMED30026364SMESG000078256.1 SMESG000078255.1 dd_Smed_v4_5563_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
enteric muscle cellSMED30026364SMESG000078256.1 SMESG000078255.1 dd_Smed_v4_5563_0_1dd_Smed_v4PMID:30471994FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
medial muscle cellSMED30026364SMESG000078256.1 SMESG000078255.1 dd_Smed_v4_5563_0_1dd_Smed_v4PMID:29674431whole organismasexual adultsingle-cell RNA-sequencing evidence
Category 2 cellSMED30026364SMESG000078256.1 SMESG000078255.1 dd_Smed_v6_5563_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
Category 3 cellSMED30026364SMESG000078256.1 SMESG000078255.1 dd_Smed_v6_5563_0dd_Smed_v6PMID:29674432FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
neoblastSMED30026364SMESG000078256.1 SMED_20048_V2_1GPL14150_gene_modelsPMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
neoblastSMED30026364SMESG000078256.1 SMED_20048_V2_1GPL14150PMID:22385657whole organismasexual adultcDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026364SMESG000078256.1 SMESG000078255.1 Contig4473newmark_estsPMID:23079596FACS sorted cell populationasexual adultcDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026364SMESG000078256.1 SMESG000078255.1 Contig4473uc_Smed_v2PMID:23079596FACS sorted cell populationasexual adultcDNA to DNA expression microarray evidence
X1 cellSMED30026364SMESG000078256.1 SMESG000078255.1 SmedASXL_008454SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
X2 cellSMED30026364SMESG000078256.1 SMESG000078255.1 SmedASXL_008454SmedAsxl_ww_GCZZ01PMID:26114597FACS sorted cell populationasexual adultRNA-sequencing evidence
neoblastSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:20040488FACS sorted cell populationasexual adultfluorescence in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:20040488whole organismasexual adultfluorescence in situ hybridization evidence
neoblastSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:20040488whole organismasexual adultfluorescence in situ hybridization evidence
Xins cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:20040488FACS sorted cell populationasexual adultfluorescence in situ hybridization evidence
parenchymaSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:20040488whole organismasexual adultcolorimetric in situ hybridization evidence
X2 cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:20040488FACS sorted cell populationasexual adultfluorescence in situ hybridization evidence
X1 cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:20040488FACS sorted cell populationasexual adultfluorescence in situ hybridization evidence
Category 3 cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:20040488whole organismasexual adultfluorescence in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
parenchymaSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:26457503whole organismasexual adultfluorescence in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 AY068713.3smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:29100657whole organismasexual adultfluorescence in situ hybridization evidence
neoblastSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:29100657whole organismasexual adultfluorescence in situ hybridization evidence
Category 3 cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:29100657whole organismasexual adultfluorescence in situ hybridization evidence
X1 cellSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:29100657FACS sorted cell populationasexual adultRNA-sequencing evidence
zeta neoblastSMED30026364SMESG000078256.1 SMESG000078255.1 SMED30026364smed_20140614PMID:29906446FACS sorted cell populationasexual adultsingle-cell RNA-sequencing evidence
intestinal phagocyteSMED30026364SMESG000017005.1 Contig4473newmark_estsPMID:23079596FACS sorted cell populationasexual adultcDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026364SMESG000017005.1 Contig4473uc_Smed_v2PMID:23079596FACS sorted cell populationasexual adultcDNA to DNA expression microarray evidence
zeta neoblastSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 6colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 8colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
epidermal progenitor cellSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 5fluorescence in situ hybridization evidence
Category 2 cellSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 7colorimetric in situ hybridization evidence
zeta neoblastSMED30026364SMESG000078256.1 ACN51391.1smed_ncbi_20200123PMID:28072387whole organismStage 5colorimetric in situ hybridization evidence
Homology
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 76.6406 bits (187), Expect = 4.068e-14
Identity = 62/221 (28.05%), Postives = 104/221 (47.06%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++  +  P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKV-MTPPP----QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 76.6406 bits (187), Expect = 4.558e-14
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 74.7146 bits (182), Expect = 1.330e-13
Identity = 61/220 (27.73%), Postives = 101/220 (45.91%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 75.485 bits (184), Expect = 1.471e-13
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 75.485 bits (184), Expect = 1.630e-13
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 77.7962 bits (190), Expect = 1.079e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   27 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 244          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 77.411 bits (189), Expect = 1.410e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   40 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 257          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 77.411 bits (189), Expect = 2.840e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   96 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 313          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 77.411 bits (189), Expect = 2.840e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   96 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 313          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 77.0258 bits (188), Expect = 3.274e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   40 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 257          
BLAST of SMED-P53 vs. Ensembl Xenopus
Match: TP63 (tumor protein p63 [Source:NCBI gene;Acc:100497737])

HSP 1 Score: 77.411 bits (189), Expect = 2.962e-14
Identity = 64/239 (26.78%), Postives = 111/239 (46.44%), Query Frame = 2
Query:  245 SNNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            +N+H   ++  P      S+T      S  +P+ + YPGP++F +      F +S   K  T  + TD    +    K  P   ++  +  P    +   +R +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   37 ANDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCPIQVKV-MTPPP----QGAVVRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 255          
BLAST of SMED-P53 vs. Ensembl Xenopus
Match: TP63 (tumor protein p63 [Source:NCBI gene;Acc:100497737])

HSP 1 Score: 77.411 bits (189), Expect = 3.034e-14
Identity = 64/239 (26.78%), Postives = 111/239 (46.44%), Query Frame = 2
Query:  245 SNNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            +N+H   ++  P      S+T      S  +P+ + YPGP++F +      F +S   K  T  + TD    +    K  P   ++  +  P    +   +R +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   41 ANDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCPIQVKV-MTPPP----QGAVVRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Xenopus
Match: TP63 (tumor protein p63 [Source:NCBI gene;Acc:100497737])

HSP 1 Score: 77.411 bits (189), Expect = 3.377e-14
Identity = 64/239 (26.78%), Postives = 111/239 (46.44%), Query Frame = 2
Query:  245 SNNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            +N+H   ++  P      S+T      S  +P+ + YPGP++F +      F +S   K  T  + TD    +    K  P   ++  +  P    +   +R +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   16 ANDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCPIQVKV-MTPPP----QGAVVRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 234          
BLAST of SMED-P53 vs. Ensembl Xenopus
Match: TP63 (tumor protein p63 [Source:NCBI gene;Acc:100497737])

HSP 1 Score: 77.411 bits (189), Expect = 3.894e-14
Identity = 64/239 (26.78%), Postives = 111/239 (46.44%), Query Frame = 2
Query:  245 SNNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            +N+H   ++  P      S+T      S  +P+ + YPGP++F +      F +S   K  T  + TD    +    K  P   ++  +  P    +   +R +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   52 ANDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCPIQVKV-MTPPP----QGAVVRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 270          
BLAST of SMED-P53 vs. Ensembl Xenopus
Match: TP63 (tumor protein p63 [Source:NCBI gene;Acc:100497737])

HSP 1 Score: 76.6406 bits (187), Expect = 4.833e-14
Identity = 62/238 (26.05%), Postives = 108/238 (45.38%), Query Frame = 2
Query:  245 SNNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            +N+H   ++  P      S+T      S  +P+ + YPGP++F +         S  K  T  + TD    +    K  P   ++      +   +   +R +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   22 ANDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTDLKKLYCQIAKTCPIQVKVM-----TPPPQGAVVRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 240          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 75.485 bits (184), Expect = 2.107e-14
Identity = 61/221 (27.60%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++      +   +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVM-----TPPPQGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 74.7146 bits (182), Expect = 8.498e-14
Identity = 61/220 (27.73%), Postives = 101/220 (45.91%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 75.485 bits (184), Expect = 1.130e-13
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 75.0998 bits (183), Expect = 1.253e-13
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 75.0998 bits (183), Expect = 1.403e-13
Identity = 61/221 (27.60%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++      +   +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:  153 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVM-----TPPPQGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 353          
BLAST of SMED-P53 vs. UniProt
Match: sp|O12946|P53_PLAFE (Cellular tumor antigen p53 OS=Platichthys flesus OX=8260 GN=tp53 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.132e-13
Identity = 65/223 (29.15%), Postives = 101/223 (45.29%), Query Frame = 2
Query:  275 EPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDES-KRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTC--AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            E V+ ++++P   S  +P ++ YPG Y FQ+      F +S   K  T  F       +    K  P    L  S +P    +   +R   V+   E    ++ RC  H+     E+  ++RS LI  +    A YF+D  TKR  + +P+E    G   +++   F C +SC     GG  R+ +  I+TLE  D       V GR+C + R CACP RD +
Sbjct:   61 EMVAKDSVTPP--SSTVPVVTDYPGEYGFQL-----RFQKSGTAKSVTSTFSELLKKLYCQLAKTSPVEVLL--SKEPP---QGAVLRATAVYKKTEHVADVVRRCPHHQ----TEDTAEHRSHLIRLEGSQRALYFEDPHTKRQSVTVPYEPPQLGSETTAILLSFMCNSSCM----GGMNRRQILTILTLETPDGL-----VLGRRCFEVRVCACPGRDRK 258          
BLAST of SMED-P53 vs. UniProt
Match: sp|Q9JJP6|P63_RAT (Tumor protein 63 OS=Rattus norvegicus OX=10116 GN=Tp63 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.689e-12
Identity = 61/218 (27.98%), Postives = 100/218 (45.87%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRD 922
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD
Sbjct:  153 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRD 351          
BLAST of SMED-P53 vs. UniProt
Match: sp|O88898|P63_MOUSE (Tumor protein 63 OS=Mus musculus OX=10090 GN=Tp63 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.689e-12
Identity = 61/218 (27.98%), Postives = 100/218 (45.87%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRD 922
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD
Sbjct:  153 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRD 351          
BLAST of SMED-P53 vs. UniProt
Match: sp|Q9H3D4|P63_HUMAN (Tumor protein 63 OS=Homo sapiens OX=9606 GN=TP63 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.795e-12
Identity = 61/218 (27.98%), Postives = 100/218 (45.87%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRD 922
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD
Sbjct:  153 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRD 351          
BLAST of SMED-P53 vs. UniProt
Match: sp|Q9XSK8|P73_CHLAE (Tumor protein p73 OS=Chlorocebus aethiops OX=9534 GN=TP73 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.908e-12
Identity = 75/277 (27.08%), Postives = 120/277 (43.32%), Query Frame = 2
Query:  290 NTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWK---YRSMLIVEKT-CAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAI 1102
            +TMSPA     +P+ + YPGP++F++         S  K  T  +       +    K  P   ++  SA P   T    IR +PV+   E    I++RC  H E+  D N  +      ++ VE    + Y  D  T R  +++P+E    G  ++++   F C +SC     GG  R+ + +IITLE  D +     V GR+  + R CACP    RD+K   D      ++E++   E    N   SK          A  +  P++P L   +
Sbjct:  107 DTMSPA---PVIPSNTDYPGPHHFEVTFQQ----SSTAKSATWTYSPLLKKLYCQIAKTCP--IQIKVSAPPPPGTA---IRAMPVYKKAEHVTDIVKRCPNH-ELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIITLETRDGQ-----VLGRRSFEGRICACPG---RDRKADED-----HYREQQALNESSAKNGAASKR---------AFKQSPPAVPALGPGV 344          
BLAST of SMED-P53 vs. TrEMBL
Match: gnl|BL_ORD_ID|20334964 (tr|B9ZV22|B9ZV22_SCHMD SMED-P53 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 479/479 (100.00%), Postives = 479/479 (100.00%), Query Frame = 2
Query:   65 MAQQYITSAFDPNFTTLQHQTSIHYKSSPIEMIVPMQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALVCGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTPESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFETYPVSYDIKLSHEMPQHFDELPSDNYNRH 1501
            MAQQYITSAFDPNFTTLQHQTSIHYKSSPIEMIVPMQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALVCGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTPESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFETYPVSYDIKLSHEMPQHFDELPSDNYNRH
Sbjct:    1 MAQQYITSAFDPNFTTLQHQTSIHYKSSPIEMIVPMQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALVCGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTPESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFETYPVSYDIKLSHEMPQHFDELPSDNYNRH 479          
BLAST of SMED-P53 vs. TrEMBL
Match: gnl|BL_ORD_ID|22538947 (tr|A0A5J4P127|A0A5J4P127_9TREM Tumor protein p63 OS=Paragonimus westermani OX=34504 GN=DEA37_0002613 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.015e-36
Identity = 100/277 (36.10%), Postives = 147/277 (53.07%), Query Frame = 2
Query:  206 TPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPA-FKSDDMPTLSSYPGPYNFQIFIP--NGEFDESKRKGQTCVFQ-TDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSC-FNQDSGGRKTLYLIITLEFL----DKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIK-GDPEML--LKFKEKRIKTEEK 1000
            T  ++SP V     +N  L   VEPV    M P    SDD+P L S+PG Y F ++ P     ++ ++ K  T  F   D  G   L+ K  P +W L+Y        E  +IR+ PV+G  +K Q +++RC +        +  +Y S+++V  + A YF D  T+R+C+ LP+EK  EG  YS  N +F C+NSC +N   G +K L+LIITLE L    D+   + +V GRQC++FRSCACP RD  + + + GD  +        KR K  E+
Sbjct:  124 TRFNLSPTVYTDPESNATLR--VEPVVDTAMPPKKLTSDDIPVLDSFPGYYGFDLYRPLCGDAYEATETKPSTAYFYFKDDQGWTNLYAKKTPTWWTLSYWCQ-RQPPEGSFIRLTPVYGTSDKQQEVIQRCFEDFMAMPTNSMARY-SIVVVGNSLADYFFDPVTERLCVTLPYEKPKEGCEYSQFNGKFMCFNSCLYNGGQGNKKPLFLIITLERLVTGTDQTKGQCEVLGRQCIKFRSCACPKRDKENSERRTGDSTVYNPCTLSGKRRKESER 396          
BLAST of SMED-P53 vs. TrEMBL
Match: gnl|BL_ORD_ID|167258001 (tr|A0A0R3TMT8|A0A0R3TMT8_RODNA P53 domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS8652 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 8.201e-33
Identity = 85/211 (40.28%), Postives = 118/211 (55.92%), Query Frame = 2
Query:  314 SDDMPTLSSYPGPYNFQIFIPNGE--FDESKRKGQTC-VFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSC-FNQDSGGRKTLYLIITLEFLDKKTNKFD----VWGRQCLQFRSCACPSRD 922
            SDD+P L  +PG Y F ++ P  E  +D  + K  T   F  D  G   L+ K  P +W L+Y        E  +IR+ PV+G  +K Q +++RC +    +      +Y SM++V  + A YF D  T+R+C+ LP+E+  EG  YS  N +F C+NSC +N   G +K LYLIITLE   K  +  D    V GRQCL+FRSCACP RD
Sbjct:   94 SDDIPVLDPFPGYYGFDLYRPLCEDAYDSIETKPSTAYFFFKDDQGWTNLYAKKAPTWWTLSYWCQ-RQPPEGCFIRLTPVYGTSDKQQEVIQRCLEDFMASPTPGLSRY-SMILVGNSNAEYFYDPTTERLCVTLPYERPKEGCEYSQFNGKFTCFNSCLYNGGQGNKKPLYLIITLERPMKNGSPTDGPCEVLGRQCLKFRSCACPKRD 302          
BLAST of SMED-P53 vs. TrEMBL
Match: gnl|BL_ORD_ID|16154988 (tr|A0A158R7U3|A0A158R7U3_TAEAS P53 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4387 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 9.070e-33
Identity = 84/211 (39.81%), Postives = 119/211 (56.40%), Query Frame = 2
Query:  314 SDDMPTLSSYPGPYNFQIFIPNGE--FDESKRKGQTC-VFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSC-FNQDSGGRKTLYLIITLEFLDKKTNKF----DVWGRQCLQFRSCACPSRD 922
            SDD+P L  +PG Y F ++ P  E  +D  + K  T   F  D  G   L+ K  P +W L+Y        +  +IR+ PV+G  +K Q +++RC +   V+      +Y SM++V  + A YF D  T+R+C+ LP+E+  EG  YS  N +F C+NSC +N   G +K LYLIITLE   K  +      +V GRQCL+FRSCACP RD
Sbjct:   96 SDDIPVLDPFPGYYGFDLYRPLCEDAYDSVETKPSTAYFFFKDDQGWTNLYAKKAPTWWTLSYWCQ-RQPPDGCFIRLTPVYGTSDKQQEVIQRCLEDFMVSPTPGLSRY-SMILVGNSNAEYFYDPTTERLCVTLPYERPKEGCEYSQFNGKFTCFNSCLYNGGQGNKKPLYLIITLERPIKNGSATEGPCEVLGRQCLKFRSCACPKRD 304          
BLAST of SMED-P53 vs. TrEMBL
Match: gnl|BL_ORD_ID|19280967 (tr|A0A564YME7|A0A564YME7_HYMDI P53 domain-containing protein (Fragment) OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS7697 PE=4 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 9.249e-33
Identity = 85/211 (40.28%), Postives = 118/211 (55.92%), Query Frame = 2
Query:  314 SDDMPTLSSYPGPYNFQIFIPNGE--FDESKRKGQTC-VFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSC-FNQDSGGRKTLYLIITLEFLDKKTNKFD----VWGRQCLQFRSCACPSRD 922
            SDD+P L  +PG Y F ++ P  E  +D  + K  T   F  D  G   L+ K  P +W L+Y        E  +IR+ PV+G  +K Q +++RC +    +      +Y SM++V  + A YF D  T+R+C+ LP+E+  EG  YS  N +F C+NSC +N   G +K LYLIITLE   K  +  D    V GRQCL+FRSCACP RD
Sbjct:   93 SDDIPVLDPFPGYYGFDLYRPLCEDAYDSIETKPSTAYFFFKDDQGWTNLYAKKAPTWWTLSYWCQ-RQPPEGCFIRLTPVYGTSDKQQEVIQRCLEDFMASPTPGLSRY-SMILVGNSNAEYFYDPTTERLCVTLPYERPKEGCEYSQFNGKFTCFNSCLYNGGQGNKKPLYLIITLERPMKNGSPTDGPCEVLGRQCLKFRSCACPKRD 301          
BLAST of SMED-P53 vs. Ensembl Cavefish
Match: tp63 (tumor protein p63 [Source:NCBI gene;Acc:103030173])

HSP 1 Score: 75.8702 bits (185), Expect = 5.450e-14
Identity = 65/238 (27.31%), Postives = 108/238 (45.38%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N H   ++  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + TD    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   30 NEHAQNSVAAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 247          
BLAST of SMED-P53 vs. Ensembl Cavefish
Match: tp63 (tumor protein p63 [Source:NCBI gene;Acc:103030173])

HSP 1 Score: 75.8702 bits (185), Expect = 6.445e-14
Identity = 65/238 (27.31%), Postives = 108/238 (45.38%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N H   ++  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + TD    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   96 NEHAQNSVAAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 313          
BLAST of SMED-P53 vs. Ensembl Cavefish
Match: tp63 (tumor protein p63 [Source:NCBI gene;Acc:103030173])

HSP 1 Score: 75.485 bits (184), Expect = 8.089e-14
Identity = 65/238 (27.31%), Postives = 108/238 (45.38%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N H   ++  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + TD    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   39 NEHAQNSVAAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 256          
BLAST of SMED-P53 vs. Ensembl Cavefish
Match: tp63 (tumor protein p63 [Source:NCBI gene;Acc:103030173])

HSP 1 Score: 75.485 bits (184), Expect = 9.911e-14
Identity = 65/238 (27.31%), Postives = 108/238 (45.38%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N H   ++  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + TD    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:  133 NEHAQNSVAAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 350          
BLAST of SMED-P53 vs. Ensembl Cavefish
Match: ENSAMXT00000034713.1 (cellular tumor antigen p53-like [Source:NCBI gene;Acc:103037427])

HSP 1 Score: 73.1738 bits (178), Expect = 2.190e-13
Identity = 57/211 (27.01%), Postives = 93/211 (44.08%), Query Frame = 2
Query:  323 MPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTE-----NMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLI-VEKT-CAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            +P  S YPG Y F +      F++S          T K       T  +  Y +L  +    +  E        +R   ++  P+    ++ RC  H+ +  + + + +RS LI VE    A Y +D  TKR  + +P+E    G   +++   + C +SC     GG  R+ +  I+TLE     T+   V GR+C + R CACP RD +
Sbjct:   90 VPATSDYPGEYGFHLL-----FNQS---------STAKSAISTYSTPLNKLYCQLAKTCPVDVLVEREPPQGAVLRATAIYKKPDHVSEVVLRCPHHQSIAENNDGFAHRSHLIRVEGNQRAQYLEDLNTKRQSVTVPYEIPQLGSEGTTILLNYMCNSSCL----GGMNRRPILTIMTLE-----TSDGHVLGRRCFEVRVCACPGRDRK 277          
BLAST of SMED-P53 vs. Ensembl Sea Lamprey
Match: tp53 (tumor protein p53 [Source:NCBI gene;Acc:30590])

HSP 1 Score: 65.0846 bits (157), Expect = 4.553e-12
Identity = 63/236 (26.69%), Postives = 96/236 (40.68%), Query Frame = 2
Query:  239 SDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKH---KEVTTDENHWKYRSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            SD+    L    E  +  T +       +P+   YPG  +FQ+         S  K  T  +  D    +    K  P   R+              +R +PV+   +    +++RC  H   KE     N      ++ VE +  A Y  D +T R  + LP+E    G  +S+V   F C +SC     GG  R+ + +IITLE  D +     V GR+  + R CACP RD +
Sbjct:    4 SDAALLELQQPCELPACPTFNAPIAGPSIPSTDDYPGSLSFQLSWQQC----SIAKSATWTYSPDLNKLYCQIGKTCPVQLRVTTPV-----PTGCVVRAMPVYKKADHLTEVVKRCPNHEISKEFNDGNNLAPPSHLIRVEGSVQADYVDDHSTGRQSVRLPYEPPQVGTDFSTVLLNFMCNSSCV----GGMNRRPISVIITLEASDGQ-----VLGRRSFEARICACPGRDRK 221          
BLAST of SMED-P53 vs. Ensembl Sea Lamprey
Match: tp73 (tumor protein p73 [Source:ZFIN;Acc:ZDB-GENE-030814-2])

HSP 1 Score: 64.3142 bits (155), Expect = 4.396e-11
Identity = 60/240 (25.00%), Postives = 102/240 (42.50%), Query Frame = 2
Query:  323 MPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWK---YRSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSV 1030
            +P+ + YPGP+NF +  P      S  K  T  + T     +   +K  P   R +     ++  +   IR++ +F   E    ++ RC  H++ + + NH        ++ VE      Y +   T R  +++ FE    G   + V   F C  SC    S  R+ +Y I+T+E L+ +     V GR C + R CA P RD             +K  E+R++ +++L      K V
Sbjct:    1 IPSNTDYPGPFNFTVTFP----PSSTAKSATWTYSTKLKKLYCQLSKTCPAEIRTS-----TLPPQGTIIRIMAMFKKLEHVSEVVRRCPTHQQ-SPEFNHGSIAPVTHLIRVEGNRNVRYEEHPVTGRQSVVMLFEVPQVGTDLTKVMFCFMCNTSCLG--SMNRRPIYTILTMETLNGQ-----VLGRFCCETRVCASPGRD-------------IKMDEQRMQQDDQLTKFSGCKRV 210          
BLAST of SMED-P53 vs. Ensembl Nematostella
Match: EDO42543 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S162])

HSP 1 Score: 55.8398 bits (133), Expect = 7.566e-9
Identity = 53/203 (26.11%), Postives = 82/203 (40.39%), Query Frame = 2
Query:  323 MPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRD 931
            +P+ + YPG   F +    G   ES  K  T  +       +       P  ++      P       Y+R V VF        I++RC  H E T+ +   K    +      A Y     + R  IL+P+     G  + +    F C++SC +  S  R+ + +I TLE  D +T      GRQ ++ R CACP RD + 
Sbjct:   15 IPSTAEYPGELGFCVSF--GPPTESASKSATWTYSEKCKKLYVNLASFCPIKFKTTVKPPP-----GSYLRGVAVFKGSTNLHDIVKRCPNHME-TSQDGQEKISHFMRSNNPSARYNVCPESGRHSILIPYTGPQVGTEFVTEMFAFMCFSSCPSGPS--RRPVEIIFTLE-KDGQT-----LGRQVVEIRVCACPGRDRKS 201          
BLAST of SMED-P53 vs. Ensembl Nematostella
Match: EDO37515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFL1])

HSP 1 Score: 56.6102 bits (135), Expect = 2.291e-8
Identity = 54/230 (23.48%), Postives = 97/230 (42.17%), Query Frame = 2
Query:  326 PTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPH---PHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVT-TDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQ----FACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRD------------WRDKKIKGD 949
            P+    PG Y+F++ +   E    K      ++ T +   ++L+ KP    P  + +     P       +IR +P+F  PE A+ ++  C  H  +  ++ +H      +  +   A Y + + + R+ + +PF    +G I   +       F C NSC     GG  R+ + ++ TLE         ++ GR  ++ R CACP RD             + +KI GD
Sbjct:  112 PSSDEVPGEYSFKLTL---ETQPKKVANPDWIYSTSQ---NKLYIKPQTPCPMKFSVTGCVPP-----GTFIRAIPIFKLPEHAKDVVRCCPNHTLLEQSNRDHPAMAHFIRSDNPRAEYERCAQSGRLSVKIPFHV-TQGSISEEIIVHELFSFVCNNSC-----GGLNRRAIQIVFTLE----TGGGCELLGRCSIETRVCACPGRDSKQDNEAVSRPGRKKRKISGD 320          
BLAST of SMED-P53 vs. Ensembl Nematostella
Match: EDO41451 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4C8])

HSP 1 Score: 51.9878 bits (123), Expect = 1.324e-7
Identity = 41/125 (32.80%), Postives = 55/125 (44.00%), Query Frame = 2
Query:  620 NHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIK 988
             H   + +L  E T   Y   + T R  ++ P  K   G  Y     QF C+NSC     GG  R+ + +I TLE          V+GR+ L  R CACP RD      K D E L   K+ ++K
Sbjct:   15 GHTAPKHLLRCENTKTLYRTCNLTGRHELMFPTRKPDAGMDYFKDMFQFMCFNSC----PGGLNRRPIIVIFTLELSGV------VYGRKVLDVRVCACPGRD------KADQESLETRKKNKMK 123          
BLAST of SMED-P53 vs. Ensembl Medaka
Match: tp63 (tumor protein p63 [Source:NCBI gene;Acc:100170632])

HSP 1 Score: 77.411 bits (189), Expect = 1.807e-14
Identity = 66/238 (27.73%), Postives = 110/238 (46.22%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVE-KTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP++F +      F +S   K  T  + TD    +    K  P   ++  +  P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   16 NDHAQNNVTAPSPYAQPSSTFDALSPSPAIPSNTDYAGPHSFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCPIQIKV-LTPPP----QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNNHAQYLEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 233          
BLAST of SMED-P53 vs. Ensembl Medaka
Match: tp63 (tumor protein p63 [Source:NCBI gene;Acc:100170632])

HSP 1 Score: 77.411 bits (189), Expect = 1.876e-14
Identity = 66/238 (27.73%), Postives = 110/238 (46.22%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVE-KTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP++F +      F +S   K  T  + TD    +    K  P   ++  +  P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   41 NDHAQNNVTAPSPYAQPSSTFDALSPSPAIPSNTDYAGPHSFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCPIQIKV-LTPPP----QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNNHAQYLEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 258          
BLAST of SMED-P53 vs. Ensembl Medaka
Match: tp63 (tumor protein p63 [Source:NCBI gene;Acc:100170632])

HSP 1 Score: 77.411 bits (189), Expect = 2.102e-14
Identity = 66/238 (27.73%), Postives = 110/238 (46.22%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVE-KTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP++F +      F +S   K  T  + TD    +    K  P   ++  +  P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:  150 NDHAQNNVTAPSPYAQPSSTFDALSPSPAIPSNTDYAGPHSFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCPIQIKV-LTPPP----QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNNHAQYLEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 367          
BLAST of SMED-P53 vs. Ensembl Medaka
Match: tp63 (tumor protein p63 [Source:NCBI gene;Acc:100170632])

HSP 1 Score: 77.411 bits (189), Expect = 2.404e-14
Identity = 66/238 (27.73%), Postives = 110/238 (46.22%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVE-KTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP++F +      F +S   K  T  + TD    +    K  P   ++  +  P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:  133 NDHAQNNVTAPSPYAQPSSTFDALSPSPAIPSNTDYAGPHSFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCPIQIKV-LTPPP----QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNNHAQYLEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 350          
BLAST of SMED-P53 vs. Ensembl Medaka
Match: tp53 (tumor protein p53 [Source:NCBI gene;Acc:100049321])

HSP 1 Score: 68.5514 bits (166), Expect = 5.777e-12
Identity = 44/137 (32.12%), Postives = 70/137 (51.09%), Query Frame = 2
Query:  530 IRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLI-VEKT-CAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            +R   V+   E    ++ RC  H+    +E+  ++RS LI VE +  A YF+D  TKR  + +P+E    G   +++   + C +SC     GG  R+ +  I+TLE       +  V GR+C + R CACP RD +
Sbjct:  142 LRATAVYKKTEHVADVVRRCPHHQ----NEDSVEHRSHLIRVEGSQLAQYFEDPYTKRQSVTVPYEPPQPGSEMTTILLSYMCNSSCM----GGMNRRPILTILTLE------TEGLVLGRRCFEVRICACPGRDRK 264          
BLAST of SMED-P53 vs. Planmine SMEST
Match: SMESG000078256.1 (SMESG000078256.1)

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 444/444 (100.00%), Postives = 444/444 (100.00%), Query Frame = 2
Query:  170 MQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALVCGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTPESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFETYPVSYDIKLSHEMPQHFDELPSDNYNRH 1501
            MQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALVCGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTPESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFETYPVSYDIKLSHEMPQHFDELPSDNYNRH
Sbjct:    1 MQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALVCGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTPESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFETYPVSYDIKLSHEMPQHFDELPSDNYNRH 444          
The following BLAST results are available for this feature:
BLAST of SMED-P53 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TP634.068e-1428.05tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
TP634.558e-1428.05tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
TP631.330e-1327.73tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
TP631.471e-1328.05tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
TP631.630e-1328.05tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
back to top
BLAST of SMED-P53 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-P53 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-P53 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tp631.079e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
tp631.410e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
tp632.840e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
tp632.840e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
tp633.274e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
back to top
BLAST of SMED-P53 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TP632.962e-1426.78tumor protein p63 [Source:NCBI gene;Acc:100497737][more]
TP633.034e-1426.78tumor protein p63 [Source:NCBI gene;Acc:100497737][more]
TP633.377e-1426.78tumor protein p63 [Source:NCBI gene;Acc:100497737][more]
TP633.894e-1426.78tumor protein p63 [Source:NCBI gene;Acc:100497737][more]
TP634.833e-1426.05tumor protein p63 [Source:NCBI gene;Acc:100497737][more]
back to top
BLAST of SMED-P53 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Trp632.107e-1427.60transformation related protein 63 [Source:MGI Symb... [more]
Trp638.498e-1427.73transformation related protein 63 [Source:MGI Symb... [more]
Trp631.130e-1328.05transformation related protein 63 [Source:MGI Symb... [more]
Trp631.253e-1328.05transformation related protein 63 [Source:MGI Symb... [more]
Trp631.403e-1327.60transformation related protein 63 [Source:MGI Symb... [more]
back to top
BLAST of SMED-P53 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O12946|P53_PLAFE4.132e-1329.15Cellular tumor antigen p53 OS=Platichthys flesus O... [more]
sp|Q9JJP6|P63_RAT1.689e-1227.98Tumor protein 63 OS=Rattus norvegicus OX=10116 GN=... [more]
sp|O88898|P63_MOUSE1.689e-1227.98Tumor protein 63 OS=Mus musculus OX=10090 GN=Tp63 ... [more]
sp|Q9H3D4|P63_HUMAN1.795e-1227.98Tumor protein 63 OS=Homo sapiens OX=9606 GN=TP63 P... [more]
sp|Q9XSK8|P73_CHLAE2.908e-1227.08Tumor protein p73 OS=Chlorocebus aethiops OX=9534 ... [more]
back to top
BLAST of SMED-P53 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203349640.000e+0100.00tr|B9ZV22|B9ZV22_SCHMD SMED-P53 OS=Schmidtea medit... [more]
gnl|BL_ORD_ID|225389471.015e-3636.10tr|A0A5J4P127|A0A5J4P127_9TREM Tumor protein p63 O... [more]
gnl|BL_ORD_ID|1672580018.201e-3340.28tr|A0A0R3TMT8|A0A0R3TMT8_RODNA P53 domain-containi... [more]
gnl|BL_ORD_ID|161549889.070e-3339.81tr|A0A158R7U3|A0A158R7U3_TAEAS P53 domain-containi... [more]
gnl|BL_ORD_ID|192809679.249e-3340.28tr|A0A564YME7|A0A564YME7_HYMDI P53 domain-containi... [more]
back to top
BLAST of SMED-P53 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tp635.450e-1427.31tumor protein p63 [Source:NCBI gene;Acc:103030173][more]
tp636.445e-1427.31tumor protein p63 [Source:NCBI gene;Acc:103030173][more]
tp638.089e-1427.31tumor protein p63 [Source:NCBI gene;Acc:103030173][more]
tp639.911e-1427.31tumor protein p63 [Source:NCBI gene;Acc:103030173][more]
ENSAMXT00000034713.12.190e-1327.01cellular tumor antigen p53-like [Source:NCBI gene;... [more]
back to top
BLAST of SMED-P53 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tp534.553e-1226.69tumor protein p53 [Source:NCBI gene;Acc:30590][more]
tp734.396e-1125.00tumor protein p73 [Source:ZFIN;Acc:ZDB-GENE-030814... [more]
back to top
BLAST of SMED-P53 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-P53 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO425437.566e-926.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375152.291e-823.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414511.324e-732.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED-P53 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tp631.807e-1427.73tumor protein p63 [Source:NCBI gene;Acc:100170632][more]
tp631.876e-1427.73tumor protein p63 [Source:NCBI gene;Acc:100170632][more]
tp632.102e-1427.73tumor protein p63 [Source:NCBI gene;Acc:100170632][more]
tp632.404e-1427.73tumor protein p63 [Source:NCBI gene;Acc:100170632][more]
tp535.777e-1232.12tumor protein p53 [Source:NCBI gene;Acc:100049321][more]
back to top
BLAST of SMED-P53 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000078256.10.000e+0100.00SMESG000078256.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026364
GenBankACN51391.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026364 ID=SMED30026364|Name=SMED-P53|organism=Schmidtea mediterranea sexual|type=transcript|length=2047bp
CTCATGACAGTTTTATTAAAGTTACTATTATTAGGAATTCTGCGCGTTAA
ACTAGACATTATCGATGGCCCAGCAATATATTACTTCGGCTTTCGATCCA
AACTTCACAACGTTACAGCATCAGACTTCAATACATTATAAATCCTCTCC
AATTGAAATGATTGTTCCGATGCAATGCAACCAAAACCAAGCCACCTTAT
CTATAACCCCTGTTCATATTTCTCCATTTGTTAATATATCAGATTCTAAT
AATCACAATTTGACGAATATCGTCGAGCCTGTTTCATCAAATACTATGTC
TCCTGCTTTTAAATCCGACGACATGCCAACATTGTCTTCTTATCCAGGTC
CGTATAATTTTCAAATCTTTATTCCCAACGGAGAATTTGATGAATCCAAA
AGAAAAGGACAGACATGTGTGTTTCAAACCGATAAAATGGGAAATCACCA
ATTATTTACCAAACCTCATCCTCATTATTGGAGGTTAAATTATTCAGCTG
ATCCTTCTATGTCAACGGAAAACATGTATATTCGGATGGTTCCAGTTTTT
GGGGATCCAGAAAAAGCTCAATGCATTTTGGAAAGATGTGCAAAACACAA
AGAAGTAACAACAGATGAAAATCACTGGAAATATCGTAGCATGCTCATTG
TAGAAAAAACCTGTGCACATTACTTTCAGGATTCGGCAACGAAAAGAGTT
TGCATTTTATTACCGTTTGAAAAGCATGCGGAAGGAGAGATTTATTCTTC
CGTCAACTGTCAATTTGCATGCTACAACAGTTGCTTTAATCAAGATTCAG
GTGGTCGGAAAACACTTTATTTAATCATCACTCTAGAATTTCTCGATAAA
AAAACAAATAAATTCGATGTATGGGGTCGACAGTGTTTGCAATTTCGCAG
TTGTGCTTGTCCAAGTAGAGACTGGAGAGATAAAAAGATTAAAGGCGATC
CAGAAATGTTACTGAAATTCAAAGAAAAACGAATCAAAACCGAAGAAAAA
TTAAATAATTTGGTGATTTCTAAAAGCGTCCCTATTAATATGGGTGGAAA
GGATGCTATCATAAGAGTTCTTCCCTCGTTGCCAGGACTCGATGACGCTA
TTAACGCATTAGTTTGCGGATACTTACTGAATCGAACAACCAACATAAGC
GCAATAATAGCAGCATTTAATCAGATGAAAGACGTAGAACATTTAATTAT
CGATCAATTCACATCAAATTTAGATCAAAATACATGTGACAGTAAAAGTC
CTTCACAAACTCCAGAGTCTCAGATTTCTCCGAATACATCAAACCTTCAA
TTCAACGATTACGGTTCACTTTACGGTGAACCATGTCAACCCTATAGACC
GATGCACCAGCAAGTTGTTAATAATTTTTCCTCTCCAGGAATTTTCAGTA
AAATACCTTTTGAAACTTATCCGGTTAGTTATGACATTAAACTTTCACAT
GAAATGCCGCAGCACTTTGATGAGCTGCCATCAGACAACTATAATAGACA
CTGAAAAATTGCGTCCTTCCACGTTTAAAATTGTATAAAAAATAATATGC
TTGATTTTTATTTTTGCATTTGTTTTATTTTTTAATGTTGAAAATATTTA
CGTTTGTATTATTTTTTTTTGATTAGTAGTAGTAATGCTGCTTTCAAATT
TTATTGAACTTTGATCAGTGATTTTTAATATTCAATGACCTGAATTTTTC
ATGCGTCTTGATGAGGGTTTGAGTGAAAAAATTATCAATTTCTTCACTTT
GTCATGTGTGCTATGTGCATTTATTGATGTATATAACAATATATGTGTAG
ATAAATTTTATTTTTGTATCCGATTTAGGTTTGCAGGCACGATGATGAGT
GGTTTTTATTTTGTAAAAATTTTTCGAGATAACATGTGCTCAAATATCAA
TATTATATATGGTAACATATTTTTGCAATAAAAATGCATTTATTGTCAAT
TTGGCTATAAATTAAGTATCGTACGAATCAAGCAATATTTTATCATTGCT
GTCAATATTTTGTTGATAATTTTTTATTTGCTTTGTTAATAAAGAGC
back to top

protein sequence of SMED30026364-orf-1

>SMED30026364-orf-1 ID=SMED30026364-orf-1|Name=SMED30026364-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=480bp
MAQQYITSAFDPNFTTLQHQTSIHYKSSPIEMIVPMQCNQNQATLSITPV
HISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQ
IFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMS
TENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTC
AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKT
LYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLL
KFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALV
CGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTP
ESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFE
TYPVSYDIKLSHEMPQHFDELPSDNYNRH*
back to top
Aliases
The feature 'SMED-P53' has the following synonyms
Synonym
p53
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000033epidermal progenitor cell
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002112Xins cell
PLANA:0002142parenchyma
PLANA:0003104enteric muscle cell
PLANA:0004529integumental system
PLANA:0000028Category 2 cell
PLANA:0000014zeta neoblast
Vocabulary: INTERPRO
TermDefinition
IPR002117p53_tumour_suppressor
IPR011615p53_DNA-bd
IPR012346p53/RUNT-type_TF_DNA-bd_sf
IPR008967p53-like_TF_DNA-bd
Vocabulary: molecular function
TermDefinition
GO:0044212transcription regulatory region DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006915apoptotic process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000007Stage 7
PLANA:0000006Stage 6
PLANA:0000008Stage 8
PLANA:0000005Stage 5
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012346p53/RUNT-type transcription factor, DNA-binding domain superfamilyGENE3DG3DSA:2.60.40.720coord: 84..294
e-value: 2.7E-44
score: 153.5
IPR011615p53, DNA-binding domainPFAMPF00870P53coord: 91..289
e-value: 5.1E-28
score: 98.2
IPR011615p53, DNA-binding domainCDDcd08367P53coord: 110..294
e-value: 2.00927E-53
score: 175.535
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 389..408
NoneNo IPR availablePANTHERPTHR11447:SF16P53 PROTEIN LONG FORM VARIANT 1coord: 43..290
IPR002117p53 tumour suppressor familyPANTHERPTHR11447CELLULAR TUMOR ANTIGEN P53coord: 43..290
IPR008967p53-like transcription factor, DNA-bindingSUPERFAMILYSSF49417p53-like transcription factorscoord: 128..291