SMED-P53

Overview
NameSMED-P53 (ACN51391.1)
Smed IDSMED30026364
Uniprot Best hitCellular tumor antigen p53 OS=Platichthys flesus GN=tp53 PE=2 SV=1 (E=4.299e-13)
Length (bp)2047
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED-P53 (SMED30026364) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED-P53 (SMED30026364) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED-P53 (SMED30026364) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED-P53 (SMED30026364) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

SMED-P53 ( p53 ) is expressed during Stage 5, Stage 6, Stage 7 and Stage 8 in the Category 2 cell, integumental system and zeta neoblast

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

Definitive epidermal progenitors arise in the piwi-1+ blastomere population during S5.

SPIM reconstructed S5 embryo costained with piwi-1 (red) and p53 (green). Definitive epidermal progenitors, coexpressing piwi-1 and p53, are dispersed in the embryonic wall.  As definitive epidermal progenitors differentiate, they are predicted to downregulate piwi-1 and retain expression of p53.

Homology
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 76.6406 bits (187), Expect = 4.004e-14
Identity = 62/221 (28.05%), Postives = 104/221 (47.06%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++  +  P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKV-MTPPP----QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 76.6406 bits (187), Expect = 4.356e-14
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 74.7146 bits (182), Expect = 1.312e-13
Identity = 61/220 (27.73%), Postives = 101/220 (45.91%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 75.485 bits (184), Expect = 1.347e-13
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Human
Match: TP63 (tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:15979])

HSP 1 Score: 75.485 bits (184), Expect = 1.493e-13
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 77.411 bits (189), Expect = 1.270e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   40 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 257          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 77.411 bits (189), Expect = 2.399e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   96 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 313          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 77.0258 bits (188), Expect = 2.768e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   40 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 257          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 76.6406 bits (187), Expect = 2.947e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   96 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 313          
BLAST of SMED-P53 vs. Ensembl Zebrafish
Match: tp63 (tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819-1])

HSP 1 Score: 76.6406 bits (187), Expect = 3.248e-14
Identity = 65/238 (27.31%), Postives = 109/238 (45.80%), Query Frame = 2
Query:  248 NNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            N+H   N+  P      S+T      S  +P+ + Y GP+ F +      F +S   K  T  + T+    +    K  P   ++    +P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +DS T R  +L+P+E    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   40 NDHAQNNVTAPSPYAQPSSTFEALSPSPAIPSNTDYAGPHTFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVLTNPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNDGQIAPPSHLIRVEGNSHAQYVEDSITGRQSVLVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 257          
BLAST of SMED-P53 vs. Ensembl Xenopus
Match: tp53 (tumor protein p53 [Source:Xenbase;Acc:XB-GENE-484286])

HSP 1 Score: 69.3218 bits (168), Expect = 2.084e-12
Identity = 62/229 (27.07%), Postives = 101/229 (44.10%), Query Frame = 2
Query:  257 NLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQI-FIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKH-KEVTTDENHWKYRSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            ++T + E +  NT+ P   S  +P+   Y G Y  ++ F  NG       K  TC + TD         K  P   R+     P + +    +R   V+   E    +++RC  H + V   ++      ++ VE    A+Y +D  T R  + +P+E    G   ++V   + C +SC     GG  R+ +  IITLE     + +  + GR+C + R CACP RD R
Sbjct:   50 DMTVLQEGLMGNTV-PTVTSSAVPSTEDYAGSYGLKLEFQQNGTA-----KSVTCTYSTDLNKLFCQLAKTCPLLVRVERP--PPLGS---ILRATAVYKKSEHVAEVVKRCPHHERSVEPGDDPAPPSHLMRVEGNSKAYYMEDVGTGRHSVCVPYEGPQVGTECTTVLYNYMCNSSCM----GGMNRRPILTIITLE-----SPEGLLLGRRCFEVRVCACPGRDRR 258          
BLAST of SMED-P53 vs. Ensembl Xenopus
Match: tp53 (tumor protein p53 [Source:Xenbase;Acc:XB-GENE-484286])

HSP 1 Score: 69.3218 bits (168), Expect = 2.154e-12
Identity = 62/229 (27.07%), Postives = 101/229 (44.10%), Query Frame = 2
Query:  257 NLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQI-FIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKH-KEVTTDENHWKYRSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            ++T + E +  NT+ P   S  +P+   Y G Y  ++ F  NG       K  TC + TD         K  P   R+     P + +    +R   V+   E    +++RC  H + V   ++      ++ VE    A+Y +D  T R  + +P+E    G   ++V   + C +SC     GG  R+ +  IITLE     + +  + GR+C + R CACP RD R
Sbjct:   50 DMTVLQEGLMGNTV-PTVTSSAVPSTEDYAGSYGLKLEFQQNGTA-----KSVTCTYSTDLNKLFCQLAKTCPLLVRVERP--PPLGS---ILRATAVYKKSEHVAEVVKRCPHHERSVEPGDDPAPPSHLMRVEGNSKAYYMEDVGTGRHSVCVPYEGPQVGTECTTVLYNYMCNSSCM----GGMNRRPILTIITLE-----SPEGLLLGRRCFEVRVCACPGRDRR 258          
BLAST of SMED-P53 vs. Ensembl Xenopus
Match: tp73 (tumor protein p73 [Source:Xenbase;Acc:XB-GENE-482857])

HSP 1 Score: 69.707 bits (169), Expect = 3.247e-12
Identity = 61/219 (27.85%), Postives = 97/219 (44.29%), Query Frame = 2
Query:  290 NTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVE-KTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            + MSPA     +P+ + YPG +NF++         S  K  T  +       +    K  P   +L+    P        IR +PVF   E    +++RC  H E+  D N  +      ++ VE    + Y  D  T R  +++P+E    G  ++++   F C +SC     GG  R+ + +IITLE  D +     V GR+  + R CACP RD +
Sbjct:  109 DAMSPA---PVIPSNTDYPGTHNFEVTFQ----QSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKLSNPPPPGS-----VIRAMPVFKKAEHVTEVVKRCPNH-ELGRDFNDGQAAPASHLIRVEGNNLSQYVDDPVTGRQSVMVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIITLETRDGQ-----VLGRRSFEGRICACPGRDRK 305          
BLAST of SMED-P53 vs. Ensembl Xenopus
Match: tp63 (tumor protein p63 [Source:Xenbase;Acc:XB-GENE-479868])

HSP 1 Score: 64.3142 bits (155), Expect = 1.589e-10
Identity = 62/248 (25.00%), Postives = 107/248 (43.15%), Query Frame = 2
Query:  245 SNNHNLTNIVEPVS----SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCIL-------------LPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            +N+H   ++  P      S+T      S  +P+ + YPGP++F +      F +S   K  T  + TD    +    K  P   ++  +  P    +   +R +PV+   E    +++RC  H E++ + N    R    + K   H+ Q+       IL             LP++    G  ++++   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   41 ANDHAQNSVTAPSPYAQPSSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTDLKKLYCQIAKTCPIQVKV-MTPPP----QGAVVRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGMSR----IYKRAKHFVQNVKFCHGQILYVNNTVCRYRKGTLPYQLAQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 264          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 75.485 bits (184), Expect = 1.944e-14
Identity = 61/221 (27.60%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++      +   +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVM-----TPPPQGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 74.7146 bits (182), Expect = 8.057e-14
Identity = 61/220 (27.73%), Postives = 101/220 (45.91%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 75.485 bits (184), Expect = 9.947e-14
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 75.0998 bits (183), Expect = 1.102e-13
Identity = 62/221 (28.05%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:   59 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 259          
BLAST of SMED-P53 vs. Ensembl Mouse
Match: Trp63 (transformation related protein 63 [Source:MGI Symbol;Acc:MGI:1330810])

HSP 1 Score: 75.0998 bits (183), Expect = 1.236e-13
Identity = 61/221 (27.60%), Postives = 103/221 (46.61%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESK-RKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            S+T      S  +P+ + YPGP++F +      F +S   K  T  + T+    +    K  P   ++      +   +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD +
Sbjct:  153 SSTFDALSPSPAIPSNTDYPGPHSFDV-----SFQQSSTAKSATWTYSTELKKLYCQIAKTCPIQIKVM-----TPPPQGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRDRK 353          
BLAST of SMED-P53 vs. UniProt
Match: sp|O12946|P53_PLAFE (Cellular tumor antigen p53 OS=Platichthys flesus GN=tp53 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 4.299e-13
Identity = 65/223 (29.15%), Postives = 101/223 (45.29%), Query Frame = 2
Query:  275 EPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDES-KRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTC--AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWR 928
            E V+ ++++P   S  +P ++ YPG Y FQ+      F +S   K  T  F       +    K  P    L  S +P    +   +R   V+   E    ++ RC  H+     E+  ++RS LI  +    A YF+D  TKR  + +P+E    G   +++   F C +SC     GG  R+ +  I+TLE  D       V GR+C + R CACP RD +
Sbjct:   61 EMVAKDSVTPP--SSTVPVVTDYPGEYGFQL-----RFQKSGTAKSVTSTFSELLKKLYCQLAKTSPVEVLL--SKEPP---QGAVLRATAVYKKTEHVADVVRRCPHHQ----TEDTAEHRSHLIRLEGSQRALYFEDPHTKRQSVTVPYEPPQLGSETTAILLSFMCNSSCM----GGMNRRQILTILTLETPDGL-----VLGRRCFEVRVCACPGRDRK 258          
BLAST of SMED-P53 vs. UniProt
Match: sp|Q9JJP6|P63_RAT (Tumor protein 63 OS=Rattus norvegicus GN=Tp63 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.654e-12
Identity = 61/218 (27.98%), Postives = 100/218 (45.87%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRD 922
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD
Sbjct:  153 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRD 351          
BLAST of SMED-P53 vs. UniProt
Match: sp|O88898|P63_MOUSE (Tumor protein 63 OS=Mus musculus GN=Tp63 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.654e-12
Identity = 61/218 (27.98%), Postives = 100/218 (45.87%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRS---MLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRD 922
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD
Sbjct:  153 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRD 351          
BLAST of SMED-P53 vs. UniProt
Match: sp|Q9H3D4|P63_HUMAN (Tumor protein 63 OS=Homo sapiens GN=TP63 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.757e-12
Identity = 61/218 (27.98%), Postives = 100/218 (45.87%), Query Frame = 2
Query:  287 SNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKY---RSMLIVEKTC-AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRD 922
            S+T      S  +P+ + YPGP++F +         S  K  T  + T+    +    K  P   ++     P    +   IR +PV+   E    +++RC  H E++ + N  +      ++ VE    A Y +D  T R  +L+P+E    G  +++V   F C +SC     GG  R+ + +I+TLE  D +     V GR+C + R CACP RD
Sbjct:  153 SSTFDALSPSPAIPSNTDYPGPHSFDVSFQQS----STAKSATWTYSTELKKLYCQIAKTCP--IQIKVMTPPP---QGAVIRAMPVYKKAEHVTEVVKRCPNH-ELSREFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFTTVLYNFMCNSSCV----GGMNRRPILIIVTLETRDGQ-----VLGRRCFEARICACPGRD 351          
BLAST of SMED-P53 vs. UniProt
Match: sp|Q9XSK8|P73_CHLAE (Tumor protein p73 OS=Chlorocebus aethiops GN=TP73 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 2.847e-12
Identity = 75/277 (27.08%), Postives = 120/277 (43.32%), Query Frame = 2
Query:  290 NTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWK---YRSMLIVEKT-CAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGG--RKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAI 1102
            +TMSPA     +P+ + YPGP++F++         S  K  T  +       +    K  P   ++  SA P   T    IR +PV+   E    I++RC  H E+  D N  +      ++ VE    + Y  D  T R  +++P+E    G  ++++   F C +SC     GG  R+ + +IITLE  D +     V GR+  + R CACP    RD+K   D      ++E++   E    N   SK          A  +  P++P L   +
Sbjct:  107 DTMSPA---PVIPSNTDYPGPHHFEVTFQQ----SSTAKSATWTYSPLLKKLYCQIAKTCP--IQIKVSAPPPPGTA---IRAMPVYKKAEHVTDIVKRCPNH-ELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCV----GGMNRRPILIIITLETRDGQ-----VLGRRSFEGRICACPG---RDRKADED-----HYREQQALNESSAKNGAASKR---------AFKQSPPAVPALGPGV 344          
BLAST of SMED-P53 vs. TrEMBL
Match: tr|B9ZV22|B9ZV22_SCHMD (SMED-P53 OS=Schmidtea mediterranea PE=2 SV=1)

HSP 1 Score: 1006.51 bits (2601), Expect = 0.000e+0
Identity = 479/479 (100.00%), Postives = 479/479 (100.00%), Query Frame = 2
Query:   65 MAQQYITSAFDPNFTTLQHQTSIHYKSSPIEMIVPMQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALVCGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTPESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFETYPVSYDIKLSHEMPQHFDELPSDNYNRH 1501
            MAQQYITSAFDPNFTTLQHQTSIHYKSSPIEMIVPMQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALVCGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTPESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFETYPVSYDIKLSHEMPQHFDELPSDNYNRH
Sbjct:    1 MAQQYITSAFDPNFTTLQHQTSIHYKSSPIEMIVPMQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQIFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKTLYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLLKFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALVCGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTPESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFETYPVSYDIKLSHEMPQHFDELPSDNYNRH 479          
BLAST of SMED-P53 vs. TrEMBL
Match: tr|A0A0R3TMT8|A0A0R3TMT8_HYMNN (Uncharacterized protein OS=Hymenolepis nana PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 3.525e-33
Identity = 85/211 (40.28%), Postives = 118/211 (55.92%), Query Frame = 2
Query:  314 SDDMPTLSSYPGPYNFQIFIPNGE--FDESKRKGQTC-VFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSC-FNQDSGGRKTLYLIITLEFLDKKTNKFD----VWGRQCLQFRSCACPSRD 922
            SDD+P L  +PG Y F ++ P  E  +D  + K  T   F  D  G   L+ K  P +W L+Y        E  +IR+ PV+G  +K Q +++RC +    +      +Y SM++V  + A YF D  T+R+C+ LP+E+  EG  YS  N +F C+NSC +N   G +K LYLIITLE   K  +  D    V GRQCL+FRSCACP RD
Sbjct:   94 SDDIPVLDPFPGYYGFDLYRPLCEDAYDSIETKPSTAYFFFKDDQGWTNLYAKKAPTWWTLSYWCQ-RQPPEGCFIRLTPVYGTSDKQQEVIQRCLEDFMASPTPGLSRY-SMILVGNSNAEYFYDPTTERLCVTLPYERPKEGCEYSQFNGKFTCFNSCLYNGGQGNKKPLYLIITLERPMKNGSPTDGPCEVLGRQCLKFRSCACPKRD 302          
BLAST of SMED-P53 vs. TrEMBL
Match: tr|A0A068X7P1|A0A068X7P1_HYMMI (Tumor protein p63 OS=Hymenolepis microstoma GN=HmN_000797200 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 3.834e-33
Identity = 85/211 (40.28%), Postives = 118/211 (55.92%), Query Frame = 2
Query:  314 SDDMPTLSSYPGPYNFQIFIPNGE--FDESKRKGQTC-VFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSC-FNQDSGGRKTLYLIITLEFLDKKTNKFD----VWGRQCLQFRSCACPSRD 922
            SDD+P L  +PG Y F ++ P  E  +D  + K  T   F  D  G   L+ K  P +W L+Y        E  +IR+ PV+G  +K Q +++RC +    +      +Y SM++V  + A YF D  T+R+C+ LP+E+  EG  YS  N +F C+NSC +N   G +K LYLIITLE   K  +  D    V GRQCL+FRSCACP RD
Sbjct:   94 SDDIPVLDPFPGYYGFDLYRPLCEDAYDSIETKPSTAYFFFKDDQGWTNLYAKKAPTWWTLSYWCQ-RQPPEGCFIRLTPVYGTSDKQQEVIQRCLEDFMASPTPGLSRY-SMILVGNSNAEYFYDPTTERLCVTLPYERPKEGCEYSQFNGKFTCFNSCLYNGGQGNKKPLYLIITLERPMKNGSPTDGPCEVLGRQCLKFRSCACPKRD 302          
BLAST of SMED-P53 vs. TrEMBL
Match: tr|A0A158R7U3|A0A158R7U3_TAEAS (Uncharacterized protein OS=Taenia asiatica PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 3.906e-33
Identity = 84/211 (39.81%), Postives = 119/211 (56.40%), Query Frame = 2
Query:  314 SDDMPTLSSYPGPYNFQIFIPNGE--FDESKRKGQTC-VFQTDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSC-FNQDSGGRKTLYLIITLEFLDKKTNKF----DVWGRQCLQFRSCACPSRD 922
            SDD+P L  +PG Y F ++ P  E  +D  + K  T   F  D  G   L+ K  P +W L+Y        +  +IR+ PV+G  +K Q +++RC +   V+      +Y SM++V  + A YF D  T+R+C+ LP+E+  EG  YS  N +F C+NSC +N   G +K LYLIITLE   K  +      +V GRQCL+FRSCACP RD
Sbjct:   96 SDDIPVLDPFPGYYGFDLYRPLCEDAYDSVETKPSTAYFFFKDDQGWTNLYAKKAPTWWTLSYWCQ-RQPPDGCFIRLTPVYGTSDKQQEVIQRCLEDFMVSPTPGLSRY-SMILVGNSNAEYFYDPTTERLCVTLPYERPKEGCEYSQFNGKFTCFNSCLYNGGQGNKKPLYLIITLERPIKNGSATEGPCEVLGRQCLKFRSCACPKRD 304          
BLAST of SMED-P53 vs. TrEMBL
Match: tr|A0A074ZCB0|A0A074ZCB0_9TREM (Uncharacterized protein OS=Opisthorchis viverrini GN=T265_07622 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 4.235e-33
Identity = 96/283 (33.92%), Postives = 146/283 (51.59%), Query Frame = 2
Query:  116 QHQTSIHYKSSPIEMIVPMQCNQNQATLSITPVHISPFVNISDSNNHNLTNIVEPVSSNTMSPA------FKSDDMPTLSSYPGPYNFQIFIP--NGEFDESKRKGQTCVFQ-TDKMGNHQLFTKPHPHYWRLNYSADPSMSTENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTCAHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSC-FNQDSGGRKTLYLIITLEFLDKKT----NKFDVWGRQCLQFRSCACPSRD 922
            +H TS+   S+ I       C+    +  +T    S   N+S +   +L +   PV ++ M           SDD+P L S+PG Y F ++ P     ++ S  K  T  F   D+ G   L++K  P +W L+Y        E  +IR+ PV+G  +K Q +++RC +           +Y S+++V  + A YF D  T+R+C+ LP+E+  EG  YS  N +F C+NSC +N   G +K L+LIITLE L   T     + +V GRQC++FRSCACP RD
Sbjct:   88 EHSTSV--LSAAINRTTTPVCSPPVVSTPVTYTRQSSGFNVSPNGYTDLES-AGPVRADAMGDTAHPPKKLTSDDIPVLDSFPGYYGFDLYRPLCGDTYEASDTKPSTAFFFFKDEHGWTNLYSKKTPTWWTLSYWCQ-RQPPEGSFIRLTPVYGTADKQQEVIQRCFEDFMSVPTSAMSRY-SIVLVGNSLADYFFDPVTERLCVTLPYERPKEGCEYSQFNGKFMCFNSCLYNGGQGNKKPLFLIITLERLVAGTEPSKGQCEVLGRQCIKFRSCACPKRD 365          
The following BLAST results are available for this feature:
BLAST of SMED-P53 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
TP634.004e-1428.05tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
TP634.356e-1428.05tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
TP631.312e-1327.73tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
TP631.347e-1328.05tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
TP631.493e-1328.05tumor protein p63 [Source:HGNC Symbol;Acc:HGNC:159... [more]
back to top
BLAST of SMED-P53 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-P53 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED-P53 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
tp631.270e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
tp632.399e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
tp632.768e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
tp632.947e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
tp633.248e-1427.31tumor protein p63 [Source:ZFIN;Acc:ZDB-GENE-030819... [more]
back to top
BLAST of SMED-P53 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 4
Match NameE-valueIdentityDescription
tp532.084e-1227.07tumor protein p53 [Source:Xenbase;Acc:XB-GENE-4842... [more]
tp532.154e-1227.07tumor protein p53 [Source:Xenbase;Acc:XB-GENE-4842... [more]
tp733.247e-1227.85tumor protein p73 [Source:Xenbase;Acc:XB-GENE-4828... [more]
tp631.589e-1025.00tumor protein p63 [Source:Xenbase;Acc:XB-GENE-4798... [more]
back to top
BLAST of SMED-P53 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Trp631.944e-1427.60transformation related protein 63 [Source:MGI Symb... [more]
Trp638.057e-1427.73transformation related protein 63 [Source:MGI Symb... [more]
Trp639.947e-1428.05transformation related protein 63 [Source:MGI Symb... [more]
Trp631.102e-1328.05transformation related protein 63 [Source:MGI Symb... [more]
Trp631.236e-1327.60transformation related protein 63 [Source:MGI Symb... [more]
back to top
BLAST of SMED-P53 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O12946|P53_PLAFE4.299e-1329.15Cellular tumor antigen p53 OS=Platichthys flesus G... [more]
sp|Q9JJP6|P63_RAT1.654e-1227.98Tumor protein 63 OS=Rattus norvegicus GN=Tp63 PE=2... [more]
sp|O88898|P63_MOUSE1.654e-1227.98Tumor protein 63 OS=Mus musculus GN=Tp63 PE=1 SV=1[more]
sp|Q9H3D4|P63_HUMAN1.757e-1227.98Tumor protein 63 OS=Homo sapiens GN=TP63 PE=1 SV=1[more]
sp|Q9XSK8|P73_CHLAE2.847e-1227.08Tumor protein p73 OS=Chlorocebus aethiops GN=TP73 ... [more]
back to top
BLAST of SMED-P53 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|B9ZV22|B9ZV22_SCHMD0.000e+0100.00SMED-P53 OS=Schmidtea mediterranea PE=2 SV=1[more]
tr|A0A0R3TMT8|A0A0R3TMT8_HYMNN3.525e-3340.28Uncharacterized protein OS=Hymenolepis nana PE=3 S... [more]
tr|A0A068X7P1|A0A068X7P1_HYMMI3.834e-3340.28Tumor protein p63 OS=Hymenolepis microstoma GN=HmN... [more]
tr|A0A158R7U3|A0A158R7U3_TAEAS3.906e-3339.81Uncharacterized protein OS=Taenia asiatica PE=3 SV... [more]
tr|A0A074ZCB0|A0A074ZCB0_9TREM4.235e-3333.92Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.781
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.593
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..26
score: 0.505
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.657
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 16..38
NoneNo IPR availableTMHMMTMhelixcoord: 4..22
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 7..24
NoneNo IPR availableTMHMMTMhelixcoord: 12..34
IPR011615p53, DNA-binding domainPFAMPF00870P53coord: 90..292
e-value: 1.2E-18
score: 67.3
IPR012346p53/RUNT-type transcription factor, DNA-binding domainGENE3DG3DSA:2.60.40.720coord: 87..296
e-value: 1.2E-44
score: 152.1
IPR008967p53-like transcription factor, DNA-bindingSUPERFAMILYSSF49417p53-like transcription factorscoord: 131..294

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR011615p53_DNA-bd
IPR012346p53/RUNT-type_TF_DNA-bd
IPR008967p53-like_TF_DNA-bd
Vocabulary: molecular function
TermDefinition
GO:0044212transcription regulatory region DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0006915apoptotic process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000008Stage 8
PLANA:0000007Stage 7
PLANA:0000005Stage 5
PLANA:0000006Stage 6
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0004529integumental system
PLANA:0000014zeta neoblast
PLANA:0000028Category 2 cell
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026364 ID=SMED30026364|Name=SMED-P53|organism=Schmidtea mediterranea sexual|type=transcript|length=2047bp
CTCATGACAGTTTTATTAAAGTTACTATTATTAGGAATTCTGCGCGTTAA
ACTAGACATTATCGATGGCCCAGCAATATATTACTTCGGCTTTCGATCCA
AACTTCACAACGTTACAGCATCAGACTTCAATACATTATAAATCCTCTCC
AATTGAAATGATTGTTCCGATGCAATGCAACCAAAACCAAGCCACCTTAT
CTATAACCCCTGTTCATATTTCTCCATTTGTTAATATATCAGATTCTAAT
AATCACAATTTGACGAATATCGTCGAGCCTGTTTCATCAAATACTATGTC
TCCTGCTTTTAAATCCGACGACATGCCAACATTGTCTTCTTATCCAGGTC
CGTATAATTTTCAAATCTTTATTCCCAACGGAGAATTTGATGAATCCAAA
AGAAAAGGACAGACATGTGTGTTTCAAACCGATAAAATGGGAAATCACCA
ATTATTTACCAAACCTCATCCTCATTATTGGAGGTTAAATTATTCAGCTG
ATCCTTCTATGTCAACGGAAAACATGTATATTCGGATGGTTCCAGTTTTT
GGGGATCCAGAAAAAGCTCAATGCATTTTGGAAAGATGTGCAAAACACAA
AGAAGTAACAACAGATGAAAATCACTGGAAATATCGTAGCATGCTCATTG
TAGAAAAAACCTGTGCACATTACTTTCAGGATTCGGCAACGAAAAGAGTT
TGCATTTTATTACCGTTTGAAAAGCATGCGGAAGGAGAGATTTATTCTTC
CGTCAACTGTCAATTTGCATGCTACAACAGTTGCTTTAATCAAGATTCAG
GTGGTCGGAAAACACTTTATTTAATCATCACTCTAGAATTTCTCGATAAA
AAAACAAATAAATTCGATGTATGGGGTCGACAGTGTTTGCAATTTCGCAG
TTGTGCTTGTCCAAGTAGAGACTGGAGAGATAAAAAGATTAAAGGCGATC
CAGAAATGTTACTGAAATTCAAAGAAAAACGAATCAAAACCGAAGAAAAA
TTAAATAATTTGGTGATTTCTAAAAGCGTCCCTATTAATATGGGTGGAAA
GGATGCTATCATAAGAGTTCTTCCCTCGTTGCCAGGACTCGATGACGCTA
TTAACGCATTAGTTTGCGGATACTTACTGAATCGAACAACCAACATAAGC
GCAATAATAGCAGCATTTAATCAGATGAAAGACGTAGAACATTTAATTAT
CGATCAATTCACATCAAATTTAGATCAAAATACATGTGACAGTAAAAGTC
CTTCACAAACTCCAGAGTCTCAGATTTCTCCGAATACATCAAACCTTCAA
TTCAACGATTACGGTTCACTTTACGGTGAACCATGTCAACCCTATAGACC
GATGCACCAGCAAGTTGTTAATAATTTTTCCTCTCCAGGAATTTTCAGTA
AAATACCTTTTGAAACTTATCCGGTTAGTTATGACATTAAACTTTCACAT
GAAATGCCGCAGCACTTTGATGAGCTGCCATCAGACAACTATAATAGACA
CTGAAAAATTGCGTCCTTCCACGTTTAAAATTGTATAAAAAATAATATGC
TTGATTTTTATTTTTGCATTTGTTTTATTTTTTAATGTTGAAAATATTTA
CGTTTGTATTATTTTTTTTTGATTAGTAGTAGTAATGCTGCTTTCAAATT
TTATTGAACTTTGATCAGTGATTTTTAATATTCAATGACCTGAATTTTTC
ATGCGTCTTGATGAGGGTTTGAGTGAAAAAATTATCAATTTCTTCACTTT
GTCATGTGTGCTATGTGCATTTATTGATGTATATAACAATATATGTGTAG
ATAAATTTTATTTTTGTATCCGATTTAGGTTTGCAGGCACGATGATGAGT
GGTTTTTATTTTGTAAAAATTTTTCGAGATAACATGTGCTCAAATATCAA
TATTATATATGGTAACATATTTTTGCAATAAAAATGCATTTATTGTCAAT
TTGGCTATAAATTAAGTATCGTACGAATCAAGCAATATTTTATCATTGCT
GTCAATATTTTGTTGATAATTTTTTATTTGCTTTGTTAATAAAGAGC
back to top

protein sequence of SMED30026364-orf-1

>SMED30026364-orf-1 ID=SMED30026364-orf-1|Name=SMED30026364-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=480bp
MAQQYITSAFDPNFTTLQHQTSIHYKSSPIEMIVPMQCNQNQATLSITPV
HISPFVNISDSNNHNLTNIVEPVSSNTMSPAFKSDDMPTLSSYPGPYNFQ
IFIPNGEFDESKRKGQTCVFQTDKMGNHQLFTKPHPHYWRLNYSADPSMS
TENMYIRMVPVFGDPEKAQCILERCAKHKEVTTDENHWKYRSMLIVEKTC
AHYFQDSATKRVCILLPFEKHAEGEIYSSVNCQFACYNSCFNQDSGGRKT
LYLIITLEFLDKKTNKFDVWGRQCLQFRSCACPSRDWRDKKIKGDPEMLL
KFKEKRIKTEEKLNNLVISKSVPINMGGKDAIIRVLPSLPGLDDAINALV
CGYLLNRTTNISAIIAAFNQMKDVEHLIIDQFTSNLDQNTCDSKSPSQTP
ESQISPNTSNLQFNDYGSLYGEPCQPYRPMHQQVVNNFSSPGIFSKIPFE
TYPVSYDIKLSHEMPQHFDELPSDNYNRH*
back to top
Aliases
The feature 'SMED-P53' has the following synonyms
Synonym
p53
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026364
GenBankACN51391.1