slc26a-8

Overview
Nameslc26a-8 (AKN21612.1)
Smed IDSMED30026350
Length (bp)2426
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc26a-8 (SMED30026350) t-SNE clustered cells

Violin plots show distribution of expression levels for slc26a-8 (SMED30026350) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc26a-8 (SMED30026350) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc26a-8 (SMED30026350) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026350

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30026350h1SMcG0010088 dd_Smed_v4_4250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026350h1SMcG0010088 dd_Smed_v4_4250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026350h1SMcG0010088 dd_Smed_v4_4250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30026350h1SMcG0010088 dd_Smed_v4_4250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026350h1SMcG0010088 dd_Smed_v4_4250_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026350h1SMcG0010088 Contig49739newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026350h1SMcG0010088 Contig49739uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30026350h1SMcG0010088 dd_Smed_v6_4250_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026350h1SMcG0010088 dd_Smed_v4_4250_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30026350h1SMcG0010088 dd_Smed_v4_4250_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc26a-8 vs. Ensembl Human
Match: SLC26A2 (solute carrier family 26 member 2 [Source:HGNC Symbol;Acc:HGNC:10994])

HSP 1 Score: 371.318 bits (952), Expect = 1.750e-116
Identity = 237/676 (35.06%), Postives = 384/676 (56.80%), Query Frame = 1
Query:  253 KEYVNKQGMKRC----------IREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAV 2250
            KE+V K+  K C          I   LP +  + KY  ++ +L D ++GLIVGI+ +PQS+AY+ LAG +P+YGLY SFF  I+YF  GTSRHIS+G   ++ L+ G+ +++ L       A+++ +     N S L ++ S R+  ++     ++  + V    F+ GV Q+ MG F +GF++ YLSD L+SGF  GAS  + TSQ KY  GLN+P+  GV ++  T+ ++ +N+ KTN+  L+ +++ ++VL  TKE +N     K++ PIP+EL+VV+  T+ S +  L+EN+   I G I  G   P +P+ N       D    +II F++ +SL+++F+KKHGY +  NQE+ A G  N + SFF C+ ++++L+++ V+ES G  TQL+ +V++ +LL VLL I P+F++L   +L  I IV L+G   +F +L ++W  S  D   W V  L +A +  E GL++G+ FSI  ++LRTQ PKS +LG ++ ++++++V  Y                  GIKIFR+   LYY   + FKS+LY K + NP LIK+   K               E            +         +H ++IDCS   ++D  G+ TL +V  +Y++I I VLLA     VR ++   +     ++ ++F SV++A+
Sbjct:   67 KEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPVYGLYTSFFASIIYFLLGTSRHISVGIFGVLCLMIGETVDRELQKAGYDNAHSAPSLGMVSNGSTLLNHTSDRICDKSC--YAIMVGSTVT---FIAGVYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLNLPRTNGVGSLITTWIHVFRNIHKTNLCDLITSLLCLLVLLPTKE-LNEHFKSKLKAPIPIELVVVVAATLASHFGKLHENYNSSIAGHIPTGFMPPKVPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCFTTSAALAKTLVKESTGCHTQLSGVVTALVLLLVLLVIAPLFYSLQKSVLGVITIVNLRGALRKFRDLPKMWSISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSIFCVILRTQKPKSSLLGLVEESEVFESVSAYKNLQIK-----------PGIKIFRFVAPLYYINKECFKSALY-KQTVNPILIKVAWKKAA--------KRKIKEKVVTLGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAIGIQVLLAQCNPTVRDSLTNGEYCKKEEENLLFYSVYEAM 716          
BLAST of slc26a-8 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 359.377 bits (921), Expect = 1.371e-112
Identity = 207/586 (35.32%), Postives = 332/586 (56.66%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENIS-FLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RPI++        H  + +  S   K       T K+      ++  I   LP    +  YK++E++L D ++G+  G++ +PQ +A+A LA + PI+GLY SF+PVI+Y F GTSRHISIG  A+ISL+ G           +++  + +      N +    + D+LR+    S                L G++Q  +G+   GF+  YL++PL+ GFT  A++HVFTS +KY FG+   +  G+F++  +   + +N+   N+ +L + ++V  +L   KE+ N R  +K+  PIP+E   V++GT +S    L E++ V +VG +  GL  P+ PD + F +   D    AI+ FSV IS+AK  + KHGY++D NQELIA G+ N + S F  +  + SLSRS VQE  GGKTQL   ++S ++L V+L  G +F +LP  +LSAI+IV LKGMFMQF++L   W  S  + + W+  F+ + F+ ++YGL+  +  ++L ++ RTQ+P   +LG++  TD+Y +++ Y E            +EI GIKIF+    +YYA SD + ++L  K   NP
Sbjct:   18 VERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKK------IRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIG--------GVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMS-------------VTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEE-----------VKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNP 564          
BLAST of slc26a-8 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 359.377 bits (921), Expect = 7.529e-112
Identity = 207/586 (35.32%), Postives = 332/586 (56.66%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENIS-FLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RPI++        H  + +  S   K       T K+      ++  I   LP    +  YK++E++L D ++G+  G++ +PQ +A+A LA + PI+GLY SF+PVI+Y F GTSRHISIG  A+ISL+ G           +++  + +      N +    + D+LR+    S                L G++Q  +G+   GF+  YL++PL+ GFT  A++HVFTS +KY FG+   +  G+F++  +   + +N+   N+ +L + ++V  +L   KE+ N R  +K+  PIP+E   V++GT +S    L E++ V +VG +  GL  P+ PD + F +   D    AI+ FSV IS+AK  + KHGY++D NQELIA G+ N + S F  +  + SLSRS VQE  GGKTQL   ++S ++L V+L  G +F +LP  +LSAI+IV LKGMFMQF++L   W  S  + + W+  F+ + F+ ++YGL+  +  ++L ++ RTQ+P   +LG++  TD+Y +++ Y E            +EI GIKIF+    +YYA SD + ++L  K   NP
Sbjct:   18 VERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKK------IRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIG--------GVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMS-------------VTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEE-----------VKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNP 564          
BLAST of slc26a-8 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 359.377 bits (921), Expect = 7.529e-112
Identity = 207/586 (35.32%), Postives = 332/586 (56.66%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENIS-FLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RPI++        H  + +  S   K       T K+      ++  I   LP    +  YK++E++L D ++G+  G++ +PQ +A+A LA + PI+GLY SF+PVI+Y F GTSRHISIG  A+ISL+ G           +++  + +      N +    + D+LR+    S                L G++Q  +G+   GF+  YL++PL+ GFT  A++HVFTS +KY FG+   +  G+F++  +   + +N+   N+ +L + ++V  +L   KE+ N R  +K+  PIP+E   V++GT +S    L E++ V +VG +  GL  P+ PD + F +   D    AI+ FSV IS+AK  + KHGY++D NQELIA G+ N + S F  +  + SLSRS VQE  GGKTQL   ++S ++L V+L  G +F +LP  +LSAI+IV LKGMFMQF++L   W  S  + + W+  F+ + F+ ++YGL+  +  ++L ++ RTQ+P   +LG++  TD+Y +++ Y E            +EI GIKIF+    +YYA SD + ++L  K   NP
Sbjct:   18 VERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKK------IRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIG--------GVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMS-------------VTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEE-----------VKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNP 564          
BLAST of slc26a-8 vs. Ensembl Human
Match: SLC26A5 (solute carrier family 26 member 5 [Source:HGNC Symbol;Acc:HGNC:9359])

HSP 1 Score: 358.992 bits (920), Expect = 1.034e-111
Identity = 207/586 (35.32%), Postives = 332/586 (56.66%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENIS-FLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RPI++        H  + +  S   K       T K+      ++  I   LP    +  YK++E++L D ++G+  G++ +PQ +A+A LA + PI+GLY SF+PVI+Y F GTSRHISIG  A+ISL+ G           +++  + +      N +    + D+LR+    S                L G++Q  +G+   GF+  YL++PL+ GFT  A++HVFTS +KY FG+   +  G+F++  +   + +N+   N+ +L + ++V  +L   KE+ N R  +K+  PIP+E   V++GT +S    L E++ V +VG +  GL  P+ PD + F +   D    AI+ FSV IS+AK  + KHGY++D NQELIA G+ N + S F  +  + SLSRS VQE  GGKTQL   ++S ++L V+L  G +F +LP  +LSAI+IV LKGMFMQF++L   W  S  + + W+  F+ + F+ ++YGL+  +  ++L ++ RTQ+P   +LG++  TD+Y +++ Y E            +EI GIKIF+    +YYA SD + ++L  K   NP
Sbjct:   18 VERPIFSHPVLQERLHTKDKVPDSIADKLKQAFTCTPKK------IRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPIFGLYSSFYPVIMYCFLGTSRHISIGPFAVISLMIG--------GVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMS-------------VTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLKESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGKLPETDVYIDIDAYEE-----------VKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNP 564          
BLAST of slc26a-8 vs. Ensembl Celegans
Match: sulp-8 (Anion transporter SULP-8a; Anion transporter SULP-8b; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EFB2])

HSP 1 Score: 345.51 bits (885), Expect = 1.623e-108
Identity = 215/556 (38.67%), Postives = 316/556 (56.83%), Query Frame = 1
Query:  244 STKKEYVNKQ---GMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIAN--NSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            +T ++ V K+     ++ +++ +P +  +  Y+W++    D IAGL VGIMH+PQ MAYA LAG+ P+YG+Y SFF   +Y FFGT+RHISIG  A+ S++ G    +   D PI  ++  N   +   E +  L    +L L                     LVGVVQ+IMGI  LGFLT YLSD L+SGFT GA++HVFTSQ+   FG+ +P+  G+  I + Y  +  +L   N   L +++  I+ L + + +INP V K   +P P+ELI+VI G V+S    L+  + V+ V EI +G P PS+P LN     ++D    A++ +   +S+ KLF+KKH Y+ D  QEL A GI + ++SFF  YP  +SLSRS+V E  G  TQL ++ SSFLLL V+L +GP    LP CIL+ I+IV+LK +FMQ  EL  L+  S +DF+ W+VA L T F DV  GL+I + FS+  ++LR Q P             +  V +++E    N          + +KI ++ GSL++A    F+  +   I   P
Sbjct:   10 TTDQDIVEKKECSPFRKKLQKYIPILEWLPNYQWKDHFHGDVIAGLTVGIMHVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGVFAVASMMVGAARLRLAPDIPISNSSDINPSVYPLGEYVDPLVFTSALTL---------------------LVGVVQIIMGILRLGFLTTYLSDSLVSGFTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGILFLDLGRTYINPIVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVYEIPRGFPLPSIPRLNFLPALLSDAIPIAVVCYMFVMSMGKLFAKKHKYKTDATQELYAIGIASALSSFFPVYPVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSLFMQVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPS------------FSTV-LHDETPRQNVP--------ENVKIVKFAGSLHFANVTAFQDDMGEAIGKLP 523          
BLAST of slc26a-8 vs. Ensembl Celegans
Match: sulp-8 (Anion transporter SULP-8a; Anion transporter SULP-8b; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EFB2])

HSP 1 Score: 345.51 bits (885), Expect = 1.623e-108
Identity = 215/556 (38.67%), Postives = 316/556 (56.83%), Query Frame = 1
Query:  244 STKKEYVNKQ---GMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIAN--NSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            +T ++ V K+     ++ +++ +P +  +  Y+W++    D IAGL VGIMH+PQ MAYA LAG+ P+YG+Y SFF   +Y FFGT+RHISIG  A+ S++ G    +   D PI  ++  N   +   E +  L    +L L                     LVGVVQ+IMGI  LGFLT YLSD L+SGFT GA++HVFTSQ+   FG+ +P+  G+  I + Y  +  +L   N   L +++  I+ L + + +INP V K   +P P+ELI+VI G V+S    L+  + V+ V EI +G P PS+P LN     ++D    A++ +   +S+ KLF+KKH Y+ D  QEL A GI + ++SFF  YP  +SLSRS+V E  G  TQL ++ SSFLLL V+L +GP    LP CIL+ I+IV+LK +FMQ  EL  L+  S +DF+ W+VA L T F DV  GL+I + FS+  ++LR Q P             +  V +++E    N          + +KI ++ GSL++A    F+  +   I   P
Sbjct:   10 TTDQDIVEKKECSPFRKKLQKYIPILEWLPNYQWKDHFHGDVIAGLTVGIMHVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGVFAVASMMVGAARLRLAPDIPISNSSDINPSVYPLGEYVDPLVFTSALTL---------------------LVGVVQIIMGILRLGFLTTYLSDSLVSGFTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGILFLDLGRTYINPIVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVYEIPRGFPLPSIPRLNFLPALLSDAIPIAVVCYMFVMSMGKLFAKKHKYKTDATQELYAIGIASALSSFFPVYPVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSLFMQVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPS------------FSTV-LHDETPRQNVP--------ENVKIVKFAGSLHFANVTAFQDDMGEAIGKLP 523          
BLAST of slc26a-8 vs. Ensembl Celegans
Match: sulp-8 (Anion transporter SULP-8a; Anion transporter SULP-8b; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EFB2])

HSP 1 Score: 345.51 bits (885), Expect = 1.623e-108
Identity = 215/556 (38.67%), Postives = 316/556 (56.83%), Query Frame = 1
Query:  244 STKKEYVNKQ---GMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIAN--NSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            +T ++ V K+     ++ +++ +P +  +  Y+W++    D IAGL VGIMH+PQ MAYA LAG+ P+YG+Y SFF   +Y FFGT+RHISIG  A+ S++ G    +   D PI  ++  N   +   E +  L    +L L                     LVGVVQ+IMGI  LGFLT YLSD L+SGFT GA++HVFTSQ+   FG+ +P+  G+  I + Y  +  +L   N   L +++  I+ L + + +INP V K   +P P+ELI+VI G V+S    L+  + V+ V EI +G P PS+P LN     ++D    A++ +   +S+ KLF+KKH Y+ D  QEL A GI + ++SFF  YP  +SLSRS+V E  G  TQL ++ SSFLLL V+L +GP    LP CIL+ I+IV+LK +FMQ  EL  L+  S +DF+ W+VA L T F DV  GL+I + FS+  ++LR Q P             +  V +++E    N          + +KI ++ GSL++A    F+  +   I   P
Sbjct:   10 TTDQDIVEKKECSPFRKKLQKYIPILEWLPNYQWKDHFHGDVIAGLTVGIMHVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGVFAVASMMVGAARLRLAPDIPISNSSDINPSVYPLGEYVDPLVFTSALTL---------------------LVGVVQIIMGILRLGFLTTYLSDSLVSGFTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGILFLDLGRTYINPIVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVYEIPRGFPLPSIPRLNFLPALLSDAIPIAVVCYMFVMSMGKLFAKKHKYKTDATQELYAIGIASALSSFFPVYPVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSLFMQVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPS------------FSTV-LHDETPRQNVP--------ENVKIVKFAGSLHFANVTAFQDDMGEAIGKLP 523          
BLAST of slc26a-8 vs. Ensembl Celegans
Match: sulp-8 (Anion transporter SULP-8a; Anion transporter SULP-8b; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EFB2])

HSP 1 Score: 318.546 bits (815), Expect = 5.983e-99
Identity = 203/504 (40.28%), Postives = 290/504 (57.54%), Query Frame = 1
Query:  385 MHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            MH+PQ MAYA LAG+ P+YG+Y SFF   +Y FFGT+RHISIG  A+ S++ G    +   D PI   +NS    ++ N S     + +     TS +T             LVGVVQ+IMGI  LGFLT YLSD L+SGFT GA++HVFTSQ+   FG+ +P+  G+  I + Y  +  +L   N   L +++  I+ L + + +INP V K   +P P+ELI+VI G V+S    L+  + V+ V EI +G P PS+P LN     ++D    A++ +   +S+ KLF+KKH Y+ D  QEL A GI + ++SFF  YP  +SLSRS+V E  G  TQL ++ SSFLLL V+L +GP    LP CIL+ I+IV+LK +FMQ  EL  L+  S +DF+ W+VA L T F DV  GL+I + FS+  ++LR Q P             +  V +++E    N          + +KI ++ GSL++A    F+  +   I   P
Sbjct:    1 MHVPQGMAYASLAGVPPVYGMYSSFFASTIYMFFGTARHISIGVFAVASMMVGAARLRLAPDIPI---SNS----SDINPSVYPLGEYVDPLVFTSALT------------LLVGVVQIIMGILRLGFLTTYLSDSLVSGFTTGAAVHVFTSQLNKVFGIKLPRHEGIGMIVRMYRDMIMSLGSVNFVALGISIFGILFLDLGRTYINPIVKKFSPIPPPLELILVIFGIVISMIFNLDAEYHVKTVYEIPRGFPLPSIPRLNFLPALLSDAIPIAVVCYMFVMSMGKLFAKKHKYKTDATQELYAIGIASALSSFFPVYPVGASLSRSSVCEMSGANTQLYTIFSSFLLLTVILLLGPFLEPLPMCILACIVIVSLKSLFMQVKELPRLYRISKYDFAIWLVACLSTIFTDVTTGLVISLAFSLYTLVLRQQWPS------------FSTV-LHDETPRQNVP--------ENVKIVKFAGSLHFANVTAFQDDMGEAIGKLP 464          
BLAST of slc26a-8 vs. Ensembl Celegans
Match: sulp-7 (Anion transporter SULP-7a; SULfate Permease family [Source:UniProtKB/TrEMBL;Acc:G5EGG6])

HSP 1 Score: 310.842 bits (795), Expect = 1.020e-95
Identity = 184/518 (35.52%), Postives = 292/518 (56.37%), Query Frame = 1
Query:  268 KQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNL------PKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEID 1803
            K+   +  +  +P    +  Y   E L+ D I G+ VGI+++PQ MAYA L GLKP+YGLY S FP ++Y FFGTSRH+++G  A++SL++G                 S      + I  +S+N     +  TS   E +  N V      VG++Q+IMG+F   +L  YLSD +I GFT GA++HV T+Q+    G+ +P+  G+  +    F+I ++L       K N+ T   +VV I++L+++K  + PR   K  VPIP +L +++IGT+++ +  + E   V++VG+I  G P P+LPDL  F   + D    AI++  V +S+ K+ +KKH YEID  QE  A GI+    S F C+P+ ++L+R+ + ++ G KTQ++++ S+ +L  VL FIG     LP C+LS I+IVAL+GMF+       LW  S +D++ + + F  T  +DV  GL IG  F++L+ +LR Q     +L      D  ++ + +  F  S+   +F CE  D
Sbjct:    2 KKKQNQSWKNYIPITKWLPNYSISENLINDIIGGVTVGILNVPQGMAYASLVGLKPVYGLYTSLFPSLIYMFFGTSRHVALGVFAVVSLMSG-----------------SCNLRVTQEI--ISNNG----TNMTSTEVEAISINVVKSLGLAVGLIQIIMGLFKANYLISYLSDQIILGFTTGAAVHVLTAQLNKILGVALPRHSGIGKL----FFIYQDLITAIIGEKVNVITFGASVVAIVILYISKYILTPRFCAKTLVPIPFDLFLIVIGTIIADWFQVEERWGVKVVGDIPTGFPNPALPDLFMFRHVIGDALAIAIVSVVVTVSMGKVIAKKHNYEIDVRQEFFALGIVASTCSMFPCWPATTALARTLINDNAGTKTQISAIFSALVLTLVLFFIGQYLEGLPMCLLSCIVIVALRGMFLHLQNFVTLWRVSKYDWAIFAITFFATVCLDVVPGLFIGTIFALLLSILRIQRSSPTLLDD----DCAESGKTFVVFFASSL-FYFNCERFD 487          
BLAST of slc26a-8 vs. Ensembl Fly
Match: Prestin (gene:FBgn0036770 transcript:FBtr0075153)

HSP 1 Score: 315.079 bits (806), Expect = 1.791e-95
Identity = 207/549 (37.70%), Postives = 304/549 (55.37%), Query Frame = 1
Query:  301 LPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLE--KSLLDFPIKIANNSLTFLANE----------NISFLSSNDS------LRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYN 1893
            +P +  + +Y  R  L  D IAG  V IM+IP  MAY  LAG+    GLY + FPV+ Y F GTS+HISIGT A+ S++T K ++   ++ D    +  N+    +N           N S L+ + S       +L   T     + K       A  VG+V L+M    LG L+  LS+PL++GFT  A+ HV T+Q+K   G+++P+  G F I  T   + K +P+TN+      + VI  + +  E + PR+ KK R P+P ELI+VI GT++SK+  L  ++ V  VG+I  GLP P LP L+       D    AI+ +S+ +S+   F+KKHGYE+  NQEL A GI N V   F C P A SLSRS +Q+  GG +Q+ SLVS+ L++  L++IGP F +LP C+L+ +IIVALK MFMQ  ELK+       +  TW+  FL    ID++ GL+IGI  S+L + ++   P S +LG +         E    +M+   N H    ++  ++IFRY GSL +A S  F+ +LY  +  +
Sbjct:   81 IPILQWLPQYSPRRDLPGDIIAGFTVAIMNIPHGMAYGILAGVSAGNGLYMAVFPVLAYMFLGTSKHISIGTFAVASMMTAKVVDTYANVDDHHQILPINAFGLQSNGTATASPLLLINSSALADSVSSTTISPFQLLNSTLNADPITKIEVATSLALTVGIVNLLMAFLRLGTLSSLLSEPLVNGFTTAAACHVVTAQLKDVLGISVPRHKGAFKIIYTVIDVIKGVPQTNLVNFGFCMAVIAFMMICNEILKPRLSKKCRFPLPAELIMVIGGTLISKWFNLYVDYNVNPVGKIPSGLPEPVLPRLDLVPKVAVDSIAIAIVTYSIIMSMGLTFAKKHGYEVRPNQELFAMGIGNMVGGCFSCIPMACSLSRSVIQDQTGGVSQIASLVSASLVVVTLMWIGPFFSSLPRCVLAGVIIVALKPMFMQAKELKKFSKQGKLEMFTWISTFLCVVIIDIDIGLLIGICISLLALYIKGLKPYSCLLGYMP--------EAPGIYMD--LNQHRNAMQVPEVRIFRYSGSLNFATSLFFRRALYEAVGLD 619          
BLAST of slc26a-8 vs. Ensembl Fly
Match: Esp (gene:FBgn0013953 transcript:FBtr0304054)

HSP 1 Score: 171.014 bits (432), Expect = 1.965e-44
Identity = 150/535 (28.04%), Postives = 250/535 (46.73%), Query Frame = 1
Query:  172 EFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINP----------RVVKKIR--VPIPMELIVVIIGTVVSKYLLLNENHKV--RIVGEISQGLPAPSLPDL----NNFSMYVADIFITAIIAFSVGISLAKLFSK----------KHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPK 1692
            EF L   G  +K +     +   RS  ++   +   ++ + ++LP +  + KY  ++  + D +AG+ VG+  IPQ++AYA +AGL   YGLY SF    VY F G+ + + +G  AI++LLT                                     + +Q + + + LL          L G+V+L+MG+F LGFL  ++S P+ SGFT   S+ + TSQI+   G+       V    + +  I        +  L   V+++++  ++   I P          R V KI   V      I+V++  ++  Y+L  E H    R+VGEI  GLP+  LP      N  S  VA+ F+  + +   G+ +  L S            +G  +D +QELIA G  N   SF   +P   +LSR AV  + G +T L+++ S  L++  LLF+ P F+ +P   L+AIII A+  M ++   +K +W     D    V  F+    + +E+G++IG+G +++ I+     PK
Sbjct:   44 EFILTEDGKKVKPTVST--LDCTRSWLQDCQRRTFNRKTLHKRLPILGWLPKYNSQD-AVGDLVAGITVGLTVIPQALAYAGIAGLPVAYGLYASFVGCFVYIFLGSCKDVPMGPSAIVALLT------------------------------------YQAAQGSWQKSVLL--------CLLSGIVELLMGLFGLGFLIDFVSGPVSSGFTSAVSLIILTSQIQSVLGITAKGNTFVEIWTQVFHNIEHTRAGDTVLGLTCIVILLLMRSLSSCRIGPVDEKECSSFQRAVNKILWIVGTARNAILVVVCCIMG-YMLHTEEHGAPFRVVGEIPPGLPSIQLPPTSLTANETSNGVAEGFVEMVHSMGSGLVVIPLISLMENIAICKAFANGKPVDASQELIAIGTANIFNSFVQAFPGTGALSRGAVNNASGVRTPLSNIYSGGLVMIALLFLTPYFYFIPRPTLAAIIISAVVFM-IEVKVVKPMWRSKKSDLVPGVGTFVACLVLPLEWGILIGVGLNVIFILYHAARPK 529          
BLAST of slc26a-8 vs. Ensembl Fly
Match: Esp (gene:FBgn0013953 transcript:FBtr0084703)

HSP 1 Score: 171.014 bits (432), Expect = 1.965e-44
Identity = 150/535 (28.04%), Postives = 250/535 (46.73%), Query Frame = 1
Query:  172 EFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINP----------RVVKKIR--VPIPMELIVVIIGTVVSKYLLLNENHKV--RIVGEISQGLPAPSLPDL----NNFSMYVADIFITAIIAFSVGISLAKLFSK----------KHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPK 1692
            EF L   G  +K +     +   RS  ++   +   ++ + ++LP +  + KY  ++  + D +AG+ VG+  IPQ++AYA +AGL   YGLY SF    VY F G+ + + +G  AI++LLT                                     + +Q + + + LL          L G+V+L+MG+F LGFL  ++S P+ SGFT   S+ + TSQI+   G+       V    + +  I        +  L   V+++++  ++   I P          R V KI   V      I+V++  ++  Y+L  E H    R+VGEI  GLP+  LP      N  S  VA+ F+  + +   G+ +  L S            +G  +D +QELIA G  N   SF   +P   +LSR AV  + G +T L+++ S  L++  LLF+ P F+ +P   L+AIII A+  M ++   +K +W     D    V  F+    + +E+G++IG+G +++ I+     PK
Sbjct:   44 EFILTEDGKKVKPTVST--LDCTRSWLQDCQRRTFNRKTLHKRLPILGWLPKYNSQD-AVGDLVAGITVGLTVIPQALAYAGIAGLPVAYGLYASFVGCFVYIFLGSCKDVPMGPSAIVALLT------------------------------------YQAAQGSWQKSVLL--------CLLSGIVELLMGLFGLGFLIDFVSGPVSSGFTSAVSLIILTSQIQSVLGITAKGNTFVEIWTQVFHNIEHTRAGDTVLGLTCIVILLLMRSLSSCRIGPVDEKECSSFQRAVNKILWIVGTARNAILVVVCCIMG-YMLHTEEHGAPFRVVGEIPPGLPSIQLPPTSLTANETSNGVAEGFVEMVHSMGSGLVVIPLISLMENIAICKAFANGKPVDASQELIAIGTANIFNSFVQAFPGTGALSRGAVNNASGVRTPLSNIYSGGLVMIALLFLTPYFYFIPRPTLAAIIISAVVFM-IEVKVVKPMWRSKKSDLVPGVGTFVACLVLPLEWGILIGVGLNVIFILYHAARPK 529          
BLAST of slc26a-8 vs. Ensembl Fly
Match: CG6125 (gene:FBgn0038337 transcript:FBtr0346109)

HSP 1 Score: 165.622 bits (418), Expect = 9.193e-43
Identity = 143/484 (29.55%), Postives = 231/484 (47.73%), Query Frame = 1
Query:  307 FISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINP--RVVKKIRVPIPME---LIVVIIGTVVSKYLLLNENHKV--RIVGEISQGLPAPSLP----DLNNFSMYVADIF--------ITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHI 1701
            F+S +  Y  RE   AD IAG+ +G+  IPQS+AYA LAGL   YGLY +F   I+Y FFGT   +SIG  +++++LT +F      D P+++                                       V   AFL G+V+L MG+F LGF+  ++  P+   FT G ++ V  +QIK   G+ I    G  +I   +  I        I  +V+ + + ++  V  +   P  R +KKI   I +    L+V   G +V  ++  +    V   +  ++S  +P   LP    +  N +    DI         +  I+A    +++AK F K     +D +QE++  G+ N   SFF   P+  + +RSAV ++ G +T +  + +  ++L  L  + P F  +P   LSA++I A+  M +  A +KELW  +  DF +WV +F+      VE GL+ GI  S++ I+LR  NPK  +
Sbjct:   57 FLSWITSYD-REQAFADLIAGITLGLTIIPQSIAYAALAGLSSEYGLYSAFIGSIIYVFFGTIPQVSIGPTSLMAILTLQFCA----DKPVQV---------------------------------------VIVLAFLAGLVELAMGVFQLGFIVSFIPAPVTKAFTSGTALIVVFAQIKNLLGVRIK---GFPSIGDFFTNIRPTDAAMGISCMVVLLSLRLLSQVNFKQDTPVTRRLKKILWYISISRNALVVFFTGLLVFIWVKKSSIEAVPFALSSKVSSAMPTIKLPPFAFEYQNRTYVFTDILHELGSGIVVVPIVAVLANVAIAKAFVKDG--NLDASQEMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALSILTPYFQYIPKASLSAVLIAAVIFM-IDLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFGIVLSMVFILLRLGNPKFEV 490          
BLAST of slc26a-8 vs. Ensembl Fly
Match: CG6125 (gene:FBgn0038337 transcript:FBtr0083105)

HSP 1 Score: 165.622 bits (418), Expect = 9.193e-43
Identity = 143/484 (29.55%), Postives = 231/484 (47.73%), Query Frame = 1
Query:  307 FISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINP--RVVKKIRVPIPME---LIVVIIGTVVSKYLLLNENHKV--RIVGEISQGLPAPSLP----DLNNFSMYVADIF--------ITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHI 1701
            F+S +  Y  RE   AD IAG+ +G+  IPQS+AYA LAGL   YGLY +F   I+Y FFGT   +SIG  +++++LT +F      D P+++                                       V   AFL G+V+L MG+F LGF+  ++  P+   FT G ++ V  +QIK   G+ I    G  +I   +  I        I  +V+ + + ++  V  +   P  R +KKI   I +    L+V   G +V  ++  +    V   +  ++S  +P   LP    +  N +    DI         +  I+A    +++AK F K     +D +QE++  G+ N   SFF   P+  + +RSAV ++ G +T +  + +  ++L  L  + P F  +P   LSA++I A+  M +  A +KELW  +  DF +WV +F+      VE GL+ GI  S++ I+LR  NPK  +
Sbjct:   57 FLSWITSYD-REQAFADLIAGITLGLTIIPQSIAYAALAGLSSEYGLYSAFIGSIIYVFFGTIPQVSIGPTSLMAILTLQFCA----DKPVQV---------------------------------------VIVLAFLAGLVELAMGVFQLGFIVSFIPAPVTKAFTSGTALIVVFAQIKNLLGVRIK---GFPSIGDFFTNIRPTDAAMGISCMVVLLSLRLLSQVNFKQDTPVTRRLKKILWYISISRNALVVFFTGLLVFIWVKKSSIEAVPFALSSKVSSAMPTIKLPPFAFEYQNRTYVFTDILHELGSGIVVVPIVAVLANVAIAKAFVKDG--NLDASQEMLTLGLCNIAGSFFSAMPTCGAFTRSAVSQASGVRTPMAGIYTGLIVLSALSILTPYFQYIPKASLSAVLIAAVIFM-IDLAPVKELWQTNKKDFFSWVGSFIICLVAGVELGLLFGIVLSMVFILLRLGNPKFEV 490          
BLAST of slc26a-8 vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 403.675 bits (1036), Expect = 1.367e-129
Identity = 246/716 (34.36%), Postives = 402/716 (56.15%), Query Frame = 1
Query:  139 ISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRV---AGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERK 2274
            ++I R IYT+  F   +G     +S  R+ + + R  ++   ++      + ++LP  S + KYK R+WLL D IAGL VGI+HIPQ MA+A L  + P+YGLY SFFPV++Y  FGT  H+S GT A++SL+TG  +E+ +   PI +A NS +  A E                        +A R+   +  AFL G++ L M    LGFL+ YLS+P++  FT  A+ HV  SQ++   GL +P+  G F++ KT   + +N+P TN+  LV++++ + VL   KE +N R  +++R PIP+E+I VII T ++    L+  + ++IVG I  G P P LP L        D     ++A++V +SLA +++ KHGY ID NQEL+A+GI N V+S F C+P++++L+ + + ES GG TQL  L +S ++L VLL IGP+F+ LP  +L+ I + +L+ MF+QF +L ELW  S  DF  W+V +L    ++V+ GL IG+ FS++ ++ RTQ     +LG+   T++Y+++           N H  C E+ G+KI  Y G +YY     FK+ +   +   P  I+ R   L+   K+ ++  +  E         ++ +    ++    +  ++IDCS+  ++D  G +   Q+  E + I + + LAN    V   +  +   + ++ + IFV++HDAV+    +R+
Sbjct:    5 VAIYRNIYTEDRFRQTYGTE--DQSGGRERL-RDRLAQRCSCSQVECVHLLHKRLPVCSWLPKYKLRKWLLGDIIAGLTVGIVHIPQGMAFALLTSVAPVYGLYTSFFPVVLYMLFGTGHHVSTGTFAVLSLMTGSVVEQLV---PIPLALNSSSPEAAE-----------------------FEAQRIGVASAVAFLSGIMMLCMCGLQLGFLSTYLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKE-VNSRFRERLRTPIPVEIITVIIATGITYAFSLDSKYDIQIVGHIPAGFPEPRLPALETVPEIAGDTVAITLVAYAVSVSLAMIYADKHGYSIDPNQELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSI-----------NNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTPERIRSREKALKAIEKREREAISTVEQGVADSSFSSKNDLFTSEMAEGEVQAVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVVYIQQQRE 679          
BLAST of slc26a-8 vs. Ensembl Zebrafish
Match: slc26a6 (solute carrier family 26 member 6 [Source:ZFIN;Acc:ZDB-GENE-081105-83])

HSP 1 Score: 383.259 bits (983), Expect = 1.819e-121
Identity = 232/593 (39.12%), Postives = 345/593 (58.18%), Query Frame = 1
Query:  112 HINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISF---LSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            HI +  ++ +S+ + +  + +F++         S K K    VR T  +       K C    +P ++ + KY +RE  + D I+G+ VGIMH+PQ MAYA LA + P++GLY SF+P+++YF FGTS+HIS+GT A++S++ G   E+   D       +  TF  NE  S     SS D+ R+     KI         A   FL G+ QL++G+   GF+  YLS+PL+  +T  A++HV  SQ+KY FG+N  +  G  ++  T   I   L KTNI TLV+++V I+ L + KE ++    KKI +PIP+ELI +II TVVS Y+ L   +KV +VGEI  GL AP  P ++     V D F  A++ + + ISL ++F+ K+ Y++D+NQELIA G+ N +   F C+  + S+SRS VQ S GGK+Q+   +S+ ++L +LL IG +F  LP  +L+AII V L+GM  QF ++  LW  +  D   WV+  + T   + + GL   I FSIL ++ RTQ PK  ILGQI GTD+YK VE YN+            +EI GI IFR   +LY+A ++ +  +LY K
Sbjct:   11 HIQREVLDELSVDQ-VAEKSDFNI---------SVKEKLKDAVRCTGPK------AKSCFLSFIPLLAWLPKYPFRENAIGDLISGISVGIMHLPQGMAYALLAAVPPVFGLYSSFYPILIYFIFGTSKHISVGTYAVMSVMIGSVTERLAPD-------SDFTFPGNETNSTYIDFSSRDAERV-----KIA--------ATVTFLSGIFQLLLGVVRFGFVVTYLSEPLVRSYTTAAAIHVIVSQLKYSFGINPHRYSGPLSLIYTVIEICALLGKTNIGTLVVSIVTIVGLIIAKE-LSALAAKKIPIPIPVELITIIIATVVSWYMDLKTIYKVEVVGEIPSGLQAPVAPKVSQLGSMVGDAFALAVVGYGIAISLGRIFALKYAYKVDSNQELIALGLSNSIGGLFSCFAISCSMSRSMVQVSTGGKSQVAGAISALVILVILLKIGELFEELPKAVLAAIIYVNLQGMMKQFGDICSLWRTNKVDMVVWVMTMILTILFNPDMGLAASIAFSILTVVFRTQLPKYSILGQIPGTDIYKPVEDYNQ-----------VKEIPGITIFRSSATLYFANAEMYIDALYEK 555          
BLAST of slc26a-8 vs. Ensembl Zebrafish
Match: slc26a6 (solute carrier family 26 member 6 [Source:ZFIN;Acc:ZDB-GENE-081105-83])

HSP 1 Score: 383.259 bits (983), Expect = 4.298e-121
Identity = 232/593 (39.12%), Postives = 345/593 (58.18%), Query Frame = 1
Query:  112 HINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISF---LSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            HI +  ++ +S+ + +  + +F++         S K K    VR T  +       K C    +P ++ + KY +RE  + D I+G+ VGIMH+PQ MAYA LA + P++GLY SF+P+++YF FGTS+HIS+GT A++S++ G   E+   D       +  TF  NE  S     SS D+ R+     KI         A   FL G+ QL++G+   GF+  YLS+PL+  +T  A++HV  SQ+KY FG+N  +  G  ++  T   I   L KTNI TLV+++V I+ L + KE ++    KKI +PIP+ELI +II TVVS Y+ L   +KV +VGEI  GL AP  P ++     V D F  A++ + + ISL ++F+ K+ Y++D+NQELIA G+ N +   F C+  + S+SRS VQ S GGK+Q+   +S+ ++L +LL IG +F  LP  +L+AII V L+GM  QF ++  LW  +  D   WV+  + T   + + GL   I FSIL ++ RTQ PK  ILGQI GTD+YK VE YN+            +EI GI IFR   +LY+A ++ +  +LY K
Sbjct:   15 HIQREVLDELSVDQ-VAEKSDFNI---------SVKEKLKDAVRCTGPK------AKSCFLSFIPLLAWLPKYPFRENAIGDLISGISVGIMHLPQGMAYALLAAVPPVFGLYSSFYPILIYFIFGTSKHISVGTYAVMSVMIGSVTERLAPD-------SDFTFPGNETNSTYIDFSSRDAERV-----KIA--------ATVTFLSGIFQLLLGVVRFGFVVTYLSEPLVRSYTTAAAIHVIVSQLKYSFGINPHRYSGPLSLIYTVIEICALLGKTNIGTLVVSIVTIVGLIIAKE-LSALAAKKIPIPIPVELITIIIATVVSWYMDLKTIYKVEVVGEIPSGLQAPVAPKVSQLGSMVGDAFALAVVGYGIAISLGRIFALKYAYKVDSNQELIALGLSNSIGGLFSCFAISCSMSRSMVQVSTGGKSQVAGAISALVILVILLKIGELFEELPKAVLAAIIYVNLQGMMKQFGDICSLWRTNKVDMVVWVMTMILTILFNPDMGLAASIAFSILTVVFRTQLPKYSILGQIPGTDIYKPVEDYNQ-----------VKEIPGITIFRSSATLYFANAEMYIDALYEK 559          
BLAST of slc26a-8 vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 374.4 bits (960), Expect = 1.144e-118
Identity = 236/716 (32.96%), Postives = 386/716 (53.91%), Query Frame = 1
Query:  139 ISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRV---AGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVI-IGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERK 2274
            ++I R IYT+  F   +G     +S  R+ + + R  ++   ++      + ++LP  S + KYK R+WLL D IAGL VGI+HIPQ MA+A L  + P+YGLY SFFPV++Y  FGT  H+S GT A++SL+TG  +E+ +   PI +A NS +  A E                        +A R+   +  AFL G++ L M    LGFL+ YLS+P++  FT  A+ HV  SQ++   GL +P+  G F++ KT   + +N+P TN+  LV++++ + VL   KE +N R  +++R PIP+E+I V  + +   K LL+                P P LP L        D     ++A++V +SLA +++ KHGY ID NQEL+A+GI N V+S F C+P++++L+ + + ES GG TQL  L +S ++L VLL IGP+F+ LP  +L+ I + +L+ MF+QF +L ELW  S  DF  W+V +L    ++V+ GL IG+ FS++ ++ RTQ     +LG+   T++Y+++           N H  C E+ G+KI  Y G +YY     FK+ +   +   P   +    + +      K+              +   ++ +      +  ++IDCS+  ++D  G +   Q+  E + I + + LAN    V   +  +   + ++ + IFV++HDAV+    +R+
Sbjct:    5 VAIYRNIYTEDRFRQTYGTE--DQSGGRERL-RDRLAQRCSCSQVECVHLLHKRLPVCSWLPKYKLRKWLLGDIIAGLTVGIVHIPQGMAFALLTSVAPVYGLYTSFFPVVLYMLFGTGHHVSTGTFAVLSLMTGSVVEQLV---PIPLALNSSSPEAAE-----------------------FEAQRIGVASAVAFLSGIMMLCMCGLQLGFLSTYLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKE-VNSRFRERLRTPIPVEIITVNGLESTWMKCLLIF-------------SFPEPRLPALETVPEIAGDTVAITLVAYAVSVSLAMIYADKHGYSIDPNQELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSI-----------NNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTP---ERIRSREKALKAIEKREREAISTVEQGVADSSFSSKNDLFTSGEVQAVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVVYIQQQRE 663          
BLAST of slc26a-8 vs. Ensembl Zebrafish
Match: slc26a10 (solute carrier family 26 member 10 [Source:ZFIN;Acc:ZDB-GENE-030131-9845])

HSP 1 Score: 374.4 bits (960), Expect = 1.144e-118
Identity = 236/716 (32.96%), Postives = 386/716 (53.91%), Query Frame = 1
Query:  139 ISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRV---AGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVI-IGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERK 2274
            ++I R IYT+  F   +G     +S  R+ + + R  ++   ++      + ++LP  S + KYK R+WLL D IAGL VGI+HIPQ MA+A L  + P+YGLY SFFPV++Y  FGT  H+S GT A++SL+TG  +E+ +   PI +A NS +  A E                        +A R+   +  AFL G++ L M    LGFL+ YLS+P++  FT  A+ HV  SQ++   GL +P+  G F++ KT   + +N+P TN+  LV++++ + VL   KE +N R  +++R PIP+E+I V  + +   K LL+                P P LP L        D     ++A++V +SLA +++ KHGY ID NQEL+A+GI N V+S F C+P++++L+ + + ES GG TQL  L +S ++L VLL IGP+F+ LP  +L+ I + +L+ MF+QF +L ELW  S  DF  W+V +L    ++V+ GL IG+ FS++ ++ RTQ     +LG+   T++Y+++           N H  C E+ G+KI  Y G +YY     FK+ +   +   P   +    + +      K+              +   ++ +      +  ++IDCS+  ++D  G +   Q+  E + I + + LAN    V   +  +   + ++ + IFV++HDAV+    +R+
Sbjct:    5 VAIYRNIYTEDRFRQTYGTE--DQSGGRERL-RDRLAQRCSCSQVECVHLLHKRLPVCSWLPKYKLRKWLLGDIIAGLTVGIVHIPQGMAFALLTSVAPVYGLYTSFFPVVLYMLFGTGHHVSTGTFAVLSLMTGSVVEQLV---PIPLALNSSSPEAAE-----------------------FEAQRIGVASAVAFLSGIMMLCMCGLQLGFLSTYLSEPIVKAFTSAAAFHVTVSQLQSMLGLRLPRYAGAFSLFKTLASVMENVPHTNLAELVISLLCLAVLVPVKE-VNSRFRERLRTPIPVEIITVNGLESTWMKCLLIF-------------SFPEPRLPALETVPEIAGDTVAITLVAYAVSVSLAMIYADKHGYSIDPNQELLAHGISNTVSSLFTCFPNSATLATTNILESAGGHTQLAGLFTSLVVLIVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPELWRISKIDFMVWLVTWLSVVVLNVDLGLAIGMVFSMMTVVCRTQRASCSVLGRAANTEIYRSI-----------NNHNKCYEVPGVKILTYNGPIYYGNRSFFKADMAQLLGLTP---ERIRSREKALKAIEKREREAISTVEQGVADSSFSSKNDLFTSGEVQAVLIDCSSVIFVDIAGARLFIQMCMECQKIGVRIYLANCNESVLKILTSSGLMNYMNPQHIFVTIHDAVVYIQQQRE 663          
BLAST of slc26a-8 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 399.053 bits (1024), Expect = 7.256e-128
Identity = 260/667 (38.98%), Postives = 384/667 (57.57%), Query Frame = 1
Query:  301 LPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLD--FPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCST-WGYIDY--------VGVKTLNQVIEEYKSINITVLLANPK----TDVRATIFRNDASSIIDDRIIFVSVHDAVIN 2256
            +P +  + +Y  +E+LL D I+GL  G+M +PQ +AYA LAG+ P+YGLY SF+PV +Y FFG+SRHISIGT A+ISL+ G    +   D  F I  AN + +   +E I    + D++R+               V     L G++QL +GI   GF+  YL++PL+ GFT  A++HVFTSQ+KY  G+   +      +  ++  +  N+   N+ TL+L +  I++L   KE IN R  KK+ VPIPME+IVVI+ T VS  L L E+H V +VG+I  G   P LPD+  F     D    AI+ FS+ IS+AK+F+ KHGYE+  NQELIA G+ N V SFF  +    S+SRS VQES GG TQ+  L+SS ++L V++ IG +F  LP  +L+AI++V LKGMF QFA++  LW  S  + S WVV+FL +  + ++YGL++ + F+IL ++ RTQ+P+  ILGQ+  TD+Y +VE Y E            +E   IKIF+   SLY+A S+ + S+L  K   +P  I +   K +++  +  +  N  E     +  +            + + +    S  W  +D+        VGVKTL  +I+EYK I +TVL++        D+ +  F  D S+  D  I+F S+HDAVI+
Sbjct:   17 IPILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGTFAVISLMIGGVAVRIAPDEMFDIMPANGTNSTDFDEKIE---ARDAMRV-------------KVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEE-----------VKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDPAAILIAKKKAQKRHAREMKKANKTEKKAVLKLVSDYVNLHNTPSDELEYFMTPIISVHWIILDFTPVNFVDSVGVKTLKSIIKEYKEIGVTVLVSGCSGLVVKDLTSLNFF-DPSNKRD--ILFHSIHDAVIH 652          
BLAST of slc26a-8 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 398.667 bits (1023), Expect = 8.919e-127
Identity = 238/587 (40.55%), Postives = 345/587 (58.77%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLD--FPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RP++TQ   +   H      KS   K     R T K+       K  +   +P +  + +Y  +E+LL D I+GL  G+M +PQ +AYA LAG+ P+YGLY SF+PV +Y FFG+SRHISIGT A+ISL+ G    +   D  F I  AN + +   +E I    + D++R+               V     L G++QL +GI   GF+  YL++PL+ GFT  A++HVFTSQ+KY  G+   +      +  ++  +  N+   N+ TL+L +  I++L   KE IN R  KK+ VPIPME+IVVI+ T VS  L L E+H V +VG+I  G   P LPD+  F     D    AI+ FS+ IS+AK+F+ KHGYE+  NQELIA G+ N V SFF  +    S+SRS VQES GG TQ+  L+SS ++L V++ IG +F  LP  +L+AI++V LKGMF QFA++  LW  S  + S WVV+FL +  + ++YGL++ + F+IL ++ RTQ+P+  ILGQ+  TD+Y +VE Y E            +E   IKIF+   SLY+A S+ + S+L  K   +P
Sbjct:   19 VERPVFTQEYVEEQLHLRKDEPKSLVHKIKQSCRCTSKK------AKSQLYSFIPILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGTFAVISLMIGGVAVRIAPDEMFDIMPANGTNSTDFDEKIE---ARDAMRV-------------KVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEE-----------VKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDP 571          
BLAST of slc26a-8 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 397.897 bits (1021), Expect = 1.642e-126
Identity = 238/587 (40.55%), Postives = 345/587 (58.77%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLD--FPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RP++TQ   +   H      KS   K     R T K+       K  +   +P +  + +Y  +E+LL D I+GL  G+M +PQ +AYA LAG+ P+YGLY SF+PV +Y FFG+SRHISIGT A+ISL+ G    +   D  F I  AN + +   +E I    + D++R+               V     L G++QL +GI   GF+  YL++PL+ GFT  A++HVFTSQ+KY  G+   +      +  ++  +  N+   N+ TL+L +  I++L   KE IN R  KK+ VPIPME+IVVI+ T VS  L L E+H V +VG+I  G   P LPD+  F     D    AI+ FS+ IS+AK+F+ KHGYE+  NQELIA G+ N V SFF  +    S+SRS VQES GG TQ+  L+SS ++L V++ IG +F  LP  +L+AI++V LKGMF QFA++  LW  S  + S WVV+FL +  + ++YGL++ + F+IL ++ RTQ+P+  ILGQ+  TD+Y +VE Y E            +E   IKIF+   SLY+A S+ + S+L  K   +P
Sbjct:   19 VERPVFTQEYVEEQLHLRKDEPKSLVHKIKQSCRCTSKK------AKSQLYSFIPILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGTFAVISLMIGGVAVRIAPDEMFDIMPANGTNSTDFDEKIE---ARDAMRV-------------KVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEE-----------VKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDP 571          
BLAST of slc26a-8 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 397.512 bits (1020), Expect = 9.096e-126
Identity = 238/587 (40.55%), Postives = 345/587 (58.77%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLD--FPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RP++TQ   +   H      KS   K     R T K+       K  +   +P +  + +Y  +E+LL D I+GL  G+M +PQ +AYA LAG+ P+YGLY SF+PV +Y FFG+SRHISIGT A+ISL+ G    +   D  F I  AN + +   +E I    + D++R+               V     L G++QL +GI   GF+  YL++PL+ GFT  A++HVFTSQ+KY  G+   +      +  ++  +  N+   N+ TL+L +  I++L   KE IN R  KK+ VPIPME+IVVI+ T VS  L L E+H V +VG+I  G   P LPD+  F     D    AI+ FS+ IS+AK+F+ KHGYE+  NQELIA G+ N V SFF  +    S+SRS VQES GG TQ+  L+SS ++L V++ IG +F  LP  +L+AI++V LKGMF QFA++  LW  S  + S WVV+FL +  + ++YGL++ + F+IL ++ RTQ+P+  ILGQ+  TD+Y +VE Y E            +E   IKIF+   SLY+A S+ + S+L  K   +P
Sbjct:   19 VERPVFTQEYVEEQLHLRKDEPKSLVHKIKQSCRCTSKK------AKSQLYSFIPILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGTFAVISLMIGGVAVRIAPDEMFDIMPANGTNSTDFDEKIE---ARDAMRV-------------KVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEE-----------VKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDP 571          
BLAST of slc26a-8 vs. Ensembl Xenopus
Match: SLC26A5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:100497573])

HSP 1 Score: 392.119 bits (1006), Expect = 3.552e-125
Identity = 230/557 (41.29%), Postives = 333/557 (59.78%), Query Frame = 1
Query:  256 EYVNKQGMKRCIREK--------LPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLD--FPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            +Y+  Q    C  +K        +P +  + +Y  +E+LL D I+GL  G+M +PQ +AYA LAG+ P+YGLY SF+PV +Y FFG+SRHISIGT A+ISL+ G    +   D  F I  AN + +   +E I    + D++R+               V     L G++QL +GI   GF+  YL++PL+ GFT  A++HVFTSQ+KY  G+   +      +  ++  +  N+   N+ TL+L +  I++L   KE IN R  KK+ VPIPME+IVVI+ T VS  L L E+H V +VG+I  G   P LPD+  F     D    AI+ FS+ IS+AK+F+ KHGYE+  NQELIA G+ N V SFF  +    S+SRS VQES GG TQ+  L+SS ++L V++ IG +F  LP  +L+AI++V LKGMF QFA++  LW  S  + S WVV+FL +  + ++YGL++ + F+IL ++ RTQ+P+  ILGQ+  TD+Y +VE Y E            +E   IKIF+   SLY+A S+ + S+L  K   +P
Sbjct:   11 QYLGLQKTNGCTSKKAKSQLYSFIPILKWLPRYPVKEYLLGDVISGLSTGVMQLPQGLAYALLAGVPPVYGLYSSFYPVFLYTFFGSSRHISIGTFAVISLMIGGVAVRIAPDEMFDIMPANGTNSTDFDEKIE---ARDAMRV-------------KVVVALTLLSGIIQLCLGILRFGFVAIYLTEPLVRGFTTAAAVHVFTSQLKYLLGVKTKRFREPLAVIFSFAAVLSNIMTVNVATLILGLSCILLLLGAKE-INDRFKKKLPVPIPMEIIVVIVSTGVSAGLNLEESHAVAVVGKIPTGFSPPGLPDITLFKEVFVDAVAIAIVGFSMTISMAKIFALKHGYEVSGNQELIALGVCNSVGSFFQTFSVTCSMSRSLVQESTGGNTQIAGLLSSLMVLLVIVVIGYLFQPLPQTVLAAIVMVNLKGMFKQFADIPHLWRTSRLELSIWVVSFLASVSLGLDYGLLVAVTFAILTVIYRTQSPQYRILGQVPNTDIYCDVEQYEE-----------VKEFTDIKIFQANTSLYFANSELYVSALRKKTGIDP 539          
BLAST of slc26a-8 vs. Ensembl Mouse
Match: Slc26a5 (solute carrier family 26, member 5 [Source:MGI Symbol;Acc:MGI:1933154])

HSP 1 Score: 365.54 bits (937), Expect = 2.199e-114
Identity = 210/586 (35.84%), Postives = 335/586 (57.17%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENIS-FLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RPI++        H  + + +S   K       T K+      ++  I   LP    +  YK++E++L D ++G+  G++ +PQ +A+A LA + P++GLY SF+PVI+Y FFGTSRHISIG  A+ISL+ G           +++  + +      N +    + D+LR+    S                L G++Q  +G+   GF+  YL++PL+ GFT  A++HVFTS +KY FG+   +  G+F++  +   + +N+   N+ +L + ++V  +L   KE+ N R  +K+  PIP+E   V++GT +S    L+E++ V +VG +  GL  P+ PD + F +   D    AI+ FSV IS+AK  + KHGY++D NQELIA GI N + S F  +  + SLSRS VQE  GGKTQL   ++S ++L V+L  G +F +LP  +LSAI+IV LKGMFMQF++L   W  S  + + W+  F+ + F+ ++YGL+  +  ++L ++ RTQ+P   +LGQ+  TD+Y +++ Y E            +EI GIKIF+    +YYA SD + S+L  K   NP
Sbjct:   18 VERPIFSHPVLQERLHVKDKVTESIGDKLKQAFTCTPKK------IRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIG--------GVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMS-------------VTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEE-----------VKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNP 564          
BLAST of slc26a-8 vs. Ensembl Mouse
Match: Slc26a6 (solute carrier family 26, member 6 [Source:MGI Symbol;Acc:MGI:2159728])

HSP 1 Score: 353.599 bits (906), Expect = 3.402e-111
Identity = 207/584 (35.45%), Postives = 332/584 (56.85%), Query Frame = 1
Query:  145 IKRPIYTQHEF-DLNHGGNYIK----KSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            ++RP+  Q +  DL H G   K    ++W R   ++  S   ++V             P +  + +Y  REWLL D ++GL V IM +PQ +AYA LAGL P++GLY SF+PV +YF FGTSRHIS+GT A++S++ G   E    D           F+   N    ++ D  R+    +              +FLVG+ Q+ +G+ + GF+  YLS+PL+  +T  AS+ V  SQ+KY FG+ +    G  ++  T   +   LP+T   T+V  +V  + L + K  +N ++ +++ +PIP EL+ +I  T +S  + LN+  KV +VG I+ GL  P  P    F+  V + F  A++ F++ ISL K+F+ +HGY +D+NQEL+A G+ N +  FF C+P + S+SRS VQES GG TQ+   VSS  +L +++ +G +F  LP  +L+A+IIV LKGM  QF+++  LW  +  D   W+V F+ T  ++++ GL + I FS+L++++R Q P   +LGQ+  TD+Y++V  Y+             +E+ G+K+FR   +LY+A ++ +  SL  K
Sbjct:   10 VERPLLNQEQLEDLGHWGPAAKTHQWRTWFRCSRARAHSLLLQHV-------------PVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLTAD---------KAFVQGLN----ATADDARVQVAYT-------------LSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVK-LLNEKLHRRLPLPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFATLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYS-----------GAKEVPGVKVFRSSATLYFANAELYSDSLKEK 542          
BLAST of slc26a-8 vs. Ensembl Mouse
Match: Slc26a6 (solute carrier family 26, member 6 [Source:MGI Symbol;Acc:MGI:2159728])

HSP 1 Score: 353.599 bits (906), Expect = 3.402e-111
Identity = 207/584 (35.45%), Postives = 332/584 (56.85%), Query Frame = 1
Query:  145 IKRPIYTQHEF-DLNHGGNYIK----KSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            ++RP+  Q +  DL H G   K    ++W R   ++  S   ++V             P +  + +Y  REWLL D ++GL V IM +PQ +AYA LAGL P++GLY SF+PV +YF FGTSRHIS+GT A++S++ G   E    D           F+   N    ++ D  R+    +              +FLVG+ Q+ +G+ + GF+  YLS+PL+  +T  AS+ V  SQ+KY FG+ +    G  ++  T   +   LP+T   T+V  +V  + L + K  +N ++ +++ +PIP EL+ +I  T +S  + LN+  KV +VG I+ GL  P  P    F+  V + F  A++ F++ ISL K+F+ +HGY +D+NQEL+A G+ N +  FF C+P + S+SRS VQES GG TQ+   VSS  +L +++ +G +F  LP  +L+A+IIV LKGM  QF+++  LW  +  D   W+V F+ T  ++++ GL + I FS+L++++R Q P   +LGQ+  TD+Y++V  Y+             +E+ G+K+FR   +LY+A ++ +  SL  K
Sbjct:   10 VERPLLNQEQLEDLGHWGPAAKTHQWRTWFRCSRARAHSLLLQHV-------------PVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLTAD---------KAFVQGLN----ATADDARVQVAYT-------------LSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVK-LLNEKLHRRLPLPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFATLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYS-----------GAKEVPGVKVFRSSATLYFANAELYSDSLKEK 542          
BLAST of slc26a-8 vs. Ensembl Mouse
Match: Slc26a6 (solute carrier family 26, member 6 [Source:MGI Symbol;Acc:MGI:2159728])

HSP 1 Score: 353.599 bits (906), Expect = 3.402e-111
Identity = 207/584 (35.45%), Postives = 332/584 (56.85%), Query Frame = 1
Query:  145 IKRPIYTQHEF-DLNHGGNYIK----KSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            ++RP+  Q +  DL H G   K    ++W R   ++  S   ++V             P +  + +Y  REWLL D ++GL V IM +PQ +AYA LAGL P++GLY SF+PV +YF FGTSRHIS+GT A++S++ G   E    D           F+   N    ++ D  R+    +              +FLVG+ Q+ +G+ + GF+  YLS+PL+  +T  AS+ V  SQ+KY FG+ +    G  ++  T   +   LP+T   T+V  +V  + L + K  +N ++ +++ +PIP EL+ +I  T +S  + LN+  KV +VG I+ GL  P  P    F+  V + F  A++ F++ ISL K+F+ +HGY +D+NQEL+A G+ N +  FF C+P + S+SRS VQES GG TQ+   VSS  +L +++ +G +F  LP  +L+A+IIV LKGM  QF+++  LW  +  D   W+V F+ T  ++++ GL + I FS+L++++R Q P   +LGQ+  TD+Y++V  Y+             +E+ G+K+FR   +LY+A ++ +  SL  K
Sbjct:   10 VERPLLNQEQLEDLGHWGPAAKTHQWRTWFRCSRARAHSLLLQHV-------------PVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLTAD---------KAFVQGLN----ATADDARVQVAYT-------------LSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVK-LLNEKLHRRLPLPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFATLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYS-----------GAKEVPGVKVFRSSATLYFANAELYSDSLKEK 542          
BLAST of slc26a-8 vs. Ensembl Mouse
Match: Slc26a6 (solute carrier family 26, member 6 [Source:MGI Symbol;Acc:MGI:2159728])

HSP 1 Score: 353.599 bits (906), Expect = 3.402e-111
Identity = 207/584 (35.45%), Postives = 332/584 (56.85%), Query Frame = 1
Query:  145 IKRPIYTQHEF-DLNHGGNYIK----KSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            ++RP+  Q +  DL H G   K    ++W R   ++  S   ++V             P +  + +Y  REWLL D ++GL V IM +PQ +AYA LAGL P++GLY SF+PV +YF FGTSRHIS+GT A++S++ G   E    D           F+   N    ++ D  R+    +              +FLVG+ Q+ +G+ + GF+  YLS+PL+  +T  AS+ V  SQ+KY FG+ +    G  ++  T   +   LP+T   T+V  +V  + L + K  +N ++ +++ +PIP EL+ +I  T +S  + LN+  KV +VG I+ GL  P  P    F+  V + F  A++ F++ ISL K+F+ +HGY +D+NQEL+A G+ N +  FF C+P + S+SRS VQES GG TQ+   VSS  +L +++ +G +F  LP  +L+A+IIV LKGM  QF+++  LW  +  D   W+V F+ T  ++++ GL + I FS+L++++R Q P   +LGQ+  TD+Y++V  Y+             +E+ G+K+FR   +LY+A ++ +  SL  K
Sbjct:   10 VERPLLNQEQLEDLGHWGPAAKTHQWRTWFRCSRARAHSLLLQHV-------------PVLGWLPRYPVREWLLGDLLSGLSVAIMQLPQGLAYALLAGLPPMFGLYSSFYPVFIYFLFGTSRHISVGTFAVMSVMVGSVTESLTAD---------KAFVQGLN----ATADDARVQVAYT-------------LSFLVGLFQVGLGLVHFGFVVTYLSEPLVRSYTTAASVQVLVSQLKYVFGIKLSSHSGPLSVIYTVLEVCAQLPETVPGTVVTAIVAGVALVLVK-LLNEKLHRRLPLPIPGELLTLIGATGISYGVKLNDRFKVDVVGNITTGLIPPVAPKTELFATLVGNAFAIAVVGFAIAISLGKIFALRHGYRVDSNQELVALGLSNLIGGFFQCFPVSCSMSRSLVQESTGGNTQVAGAVSSLFILLIIVKLGELFRDLPKAVLAAVIIVNLKGMMKQFSDICSLWKANRVDLLIWLVTFVATILLNLDIGLAVSIVFSLLLVVVRMQLPHYSVLGQVPDTDIYRDVAEYS-----------GAKEVPGVKVFRSSATLYFANAELYSDSLKEK 542          
BLAST of slc26a-8 vs. UniProt/SwissProt
Match: sp|Q65AC2|S26A2_HORSE (Sulfate transporter OS=Equus caballus OX=9796 GN=SLC26A2 PE=2 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 6.721e-117
Identity = 230/652 (35.28%), Postives = 376/652 (57.67%), Query Frame = 1
Query:  301 LPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITEL-LKANRVAG-FAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAV 2250
            LP +  + KY  ++ +L D ++GLIVGI+ +PQS+AY+ LAG +PIYGLY SFF  ++YF  GTSRHIS+G   ++ L+ G+ +++ LL    K   +++    +     + SN S  L+Q + +I +    A +V     FL G+ Q+ MG F +GF++ YLSD L+SGF  GAS  + TSQ KY  GL++P+  GV ++  T+ +I +N+ KTN+  L+ +++ ++VL  TKE +N     K++ PIP EL+VV+  T+ S +  L+E +   I G I  G   P  PD N       D    +II F++ +SL+++F+KKHGY +  NQE+ A G  N + SFF C+ ++++L+++ V+ES G ++QL+ ++++ +LL VLL I P+F++L   +L  I IV L+G   +F +L ++W  S  D   W V  L +A I  E GL+IG+ FS+  ++LRTQ PK  +LG ++ T++++++  Y              +   GIKIFR+   LYY   + FKS+LY K + NP L+K    K  ++  K +                   +         +  ++IDCS   ++D  G+ TL +V  +Y++I I VLLA     VR ++ R +     ++ ++F SV++A+
Sbjct:   95 LPVLQWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPIYGLYTSFFASLIYFLLGTSRHISVGIFGVLCLMIGEVVDRELL----KAGYDTVHIAPSLG---MVSNGSTSLNQTSDRICDRSCYAIKVGSTVTFLAGIYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLSLPRSSGVGSLITTWIHIFRNIHKTNVCDLITSLLCLLVLLPTKE-LNEHFKSKLKAPIPTELVVVVAATLASHFGKLHEKYNTSIAGHIPTGFMPPKAPDWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCFTTSAALAKTLVKESTGCQSQLSGVMTALVLLLVLLVIAPLFYSLQKSVLGVITIVNLRGALRKFRDLPKMWRVSRMDTVIWFVTMLSSALISTELGLLIGVCFSMFCVILRTQKPKVSLLGLVEETEIFESMSAYKNL-----------QARPGIKIFRFVAPLYYINKECFKSALYKK-TLNPVLVKAAQKKAAKRKIKKQP--------VTLSGIQNEISVQLSHDPLELRTIVIDCSAIQFLDTAGIHTLKEVRRDYEAIGIQVLLAQCNPSVRDSLARGEYCKDEEENLLFYSVYEAM 718          
BLAST of slc26a-8 vs. UniProt/SwissProt
Match: sp|P50443|S26A2_HUMAN (Sulfate transporter OS=Homo sapiens OX=9606 GN=SLC26A2 PE=1 SV=2)

HSP 1 Score: 371.318 bits (952), Expect = 8.406e-116
Identity = 237/676 (35.06%), Postives = 384/676 (56.80%), Query Frame = 1
Query:  253 KEYVNKQGMKRC----------IREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAV 2250
            KE+V K+  K C          I   LP +  + KY  ++ +L D ++GLIVGI+ +PQS+AY+ LAG +P+YGLY SFF  I+YF  GTSRHIS+G   ++ L+ G+ +++ L       A+++ +     N S L ++ S R+  ++     ++  + V    F+ GV Q+ MG F +GF++ YLSD L+SGF  GAS  + TSQ KY  GLN+P+  GV ++  T+ ++ +N+ KTN+  L+ +++ ++VL  TKE +N     K++ PIP+EL+VV+  T+ S +  L+EN+   I G I  G   P +P+ N       D    +II F++ +SL+++F+KKHGY +  NQE+ A G  N + SFF C+ ++++L+++ V+ES G  TQL+ +V++ +LL VLL I P+F++L   +L  I IV L+G   +F +L ++W  S  D   W V  L +A +  E GL++G+ FSI  ++LRTQ PKS +LG ++ ++++++V  Y                  GIKIFR+   LYY   + FKS+LY K + NP LIK+   K               E            +         +H ++IDCS   ++D  G+ TL +V  +Y++I I VLLA     VR ++   +     ++ ++F SV++A+
Sbjct:   67 KEFVIKKLQKNCQCSPAKAKNMILGFLPVLQWLPKYDLKKNILGDVMSGLIVGILLVPQSIAYSLLAGQEPVYGLYTSFFASIIYFLLGTSRHISVGIFGVLCLMIGETVDRELQKAGYDNAHSAPSLGMVSNGSTLLNHTSDRICDKSC--YAIMVGSTVT---FIAGVYQVAMGFFQVGFVSVYLSDALLSGFVTGASFTILTSQAKYLLGLNLPRTNGVGSLITTWIHVFRNIHKTNLCDLITSLLCLLVLLPTKE-LNEHFKSKLKAPIPIELVVVVAATLASHFGKLHENYNSSIAGHIPTGFMPPKVPEWNLIPSVAVDAIAISIIGFAITVSLSEMFAKKHGYTVKANQEMYAIGFCNIIPSFFHCFTTSAALAKTLVKESTGCHTQLSGVVTALVLLLVLLVIAPLFYSLQKSVLGVITIVNLRGALRKFRDLPKMWSISRMDTVIWFVTMLSSALLSTEIGLLVGVCFSIFCVILRTQKPKSSLLGLVEESEVFESVSAYKNLQIK-----------PGIKIFRFVAPLYYINKECFKSALY-KQTVNPILIKVAWKKAA--------KRKIKEKVVTLGGIQDEMSVQLSHDPLELHTIVIDCSAIQFLDTAGIHTLKEVRRDYEAIGIQVLLAQCNPTVRDSLTNGEYCKKEEENLLFYSVYEAM 716          
BLAST of slc26a-8 vs. UniProt/SwissProt
Match: sp|Q99NH7|S26A5_MOUSE (Prestin OS=Mus musculus OX=10090 GN=Slc26a5 PE=2 SV=3)

HSP 1 Score: 365.54 bits (937), Expect = 1.538e-113
Identity = 210/586 (35.84%), Postives = 335/586 (57.17%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENIS-FLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RPI++        H  + + +S   K       T K+      ++  I   LP    +  YK++E++L D ++G+  G++ +PQ +A+A LA + P++GLY SF+PVI+Y FFGTSRHISIG  A+ISL+ G           +++  + +      N +    + D+LR+    S                L G++Q  +G+   GF+  YL++PL+ GFT  A++HVFTS +KY FG+   +  G+F++  +   + +N+   N+ +L + ++V  +L   KE+ N R  +K+  PIP+E   V++GT +S    L+E++ V +VG +  GL  P+ PD + F +   D    AI+ FSV IS+AK  + KHGY++D NQELIA GI N + S F  +  + SLSRS VQE  GGKTQL   ++S ++L V+L  G +F +LP  +LSAI+IV LKGMFMQF++L   W  S  + + W+  F+ + F+ ++YGL+  +  ++L ++ RTQ+P   +LGQ+  TD+Y +++ Y E            +EI GIKIF+    +YYA SD + S+L  K   NP
Sbjct:   18 VERPIFSHPVLQERLHVKDKVTESIGDKLKQAFTCTPKK------IRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIG--------GVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMS-------------VTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEE-----------VKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNP 564          
BLAST of slc26a-8 vs. UniProt/SwissProt
Match: sp|Q9EPH0|S26A5_RAT (Prestin OS=Rattus norvegicus OX=10116 GN=Slc26a5 PE=1 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 3.018e-113
Identity = 210/586 (35.84%), Postives = 334/586 (57.00%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENIS-FLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RPI++        H  + +  S   K       T K+      ++  I   LP    +  YK++E++L D ++G+  G++ +PQ +A+A LA + P++GLY SF+PVI+Y FFGTSRHISIG  A+ISL+ G           +++  + +      N +    + D+LR+    S                L G++Q  +G+   GF+  YL++PL+ GFT  A++HVFTS +KY FG+   +  G+F++  +   + +N+   N+ +L + ++V  +L   KE+ N R  +K+  PIP+E   V++GT +S    L+E++ V +VG +  GL  P+ PD + F +   D    AI+ FSV IS+AK  + KHGY++D NQELIA GI N + S F  +  + SLSRS VQE  GGKTQL   ++S ++L V+L  G +F +LP  +LSAI+IV LKGMFMQF++L   W  S  + + W+  F+ + F+ ++YGL+  +  ++L ++ RTQ+P   +LGQ+  TD+Y +++ Y E            +EI GIKIF+    +YYA SD + S+L  K   NP
Sbjct:   18 VERPIFSHPVLQERLHVKDKVTDSIGDKLKQAFTCTPKK------VRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIG--------GVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMS-------------VTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYTVLGQLPDTDVYIDIDAYEE-----------VKEIPGIKIFQINAPIYYANSDLYSSALKRKTGVNP 564          
BLAST of slc26a-8 vs. UniProt/SwissProt
Match: sp|Q9JKQ2|S26A5_MERUN (Prestin OS=Meriones unguiculatus OX=10047 GN=SLC26A5 PE=1 SV=1)

HSP 1 Score: 363.614 bits (932), Expect = 7.622e-113
Identity = 209/586 (35.67%), Postives = 335/586 (57.17%), Query Frame = 1
Query:  145 IKRPIYTQHEFDLN-HGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENIS-FLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++RPI++        H  + + +S   K       T K+      ++  I   LP    +  YK++E++L D ++G+  G++ +PQ +A+A LA + P++GLY SF+PVI+Y FFGTSRHISIG  A+ISL+ G           +++  + +      N +    + D+LR+    S                L G++Q  +G+   GF+  YL++PL+ GFT  A++HVFTS +KY FG+   +  G+F++  +   + +N+   N+ +L + ++V  +L   KE+ N R  +K+  PIP+E   V++GT +S    L+E++ V +VG +  GL  P+ PD + F +   D    AI+ FSV IS+AK  + KHGY++D NQELIA GI N + S F  +  + SLSRS VQE  GGKTQL   ++S ++L V+L  G +F +LP  +LSAI+IV LKGMFMQF++L   W  S  + + W+  F+ + F+ ++YGL+  +  ++L ++ RTQ+P   +LGQ+  TD+Y +++ Y E            +EI GIKIF+    +YYA SD + ++L  K   NP
Sbjct:   18 VERPIFSHPVLQERLHVKDKVSESIGDKLKQAFTCTPKK------IRNIIYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPVIMYCFFGTSRHISIGPFAVISLMIG--------GVAVRLVPDDIVIPGGVNATNGTEARDALRVKVAMS-------------VTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVKTKRYSGIFSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEF-NERFKEKLPAPIPLEFFAVVMGTGISAGFNLHESYSVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKTLANKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLMILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSLFLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYIDIDAYEE-----------VKEIPGIKIFQINAPIYYANSDLYSNALKRKTGVNP 564          
BLAST of slc26a-8 vs. TrEMBL
Match: A0A0H3YFH1 (Slc26a-8 OS=Schmidtea mediterranea OX=79327 GN=slc26a-8 PE=2 SV=1)

HSP 1 Score: 1356.27 bits (3509), Expect = 0.000e+0
Identity = 759/759 (100.00%), Postives = 759/759 (100.00%), Query Frame = 1
Query:   55 MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTYHNSEPNDEC 2331
            MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEKTQLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTYHNSEPNDEC
Sbjct:    1 MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEKTQLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTYHNSEPNDEC 759          
BLAST of slc26a-8 vs. TrEMBL
Match: A0A0H3YKD1 (Slc26a-4 OS=Schmidtea mediterranea OX=79327 GN=slc26a-4 PE=2 SV=1)

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 315/514 (61.28%), Postives = 393/514 (76.46%), Query Frame = 1
Query:  322 MKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFK 1863
            M+YKW+ WLL D IAGLIVG M IPQS AYA L G++PIYGLY +FFPV+VY+FFG+SRHISIGTIAI+SLL+G FLE+SL+DFP+    N+   + N + S  +               E +KA+RVAG    VG+ QLIMG+FNLGFLTKYLSDPLISGFTVG+++ VF++Q+KYCFG+ I K +G+F++  T   + K LP TNIPT VLT + II+L VTK  INP ++KKI  PIP+EL+VV+ GTV S+YL L+  + V +VG I QG+PAP +P ++N S Y+++I +TAIIAFSV ISL K+F+KKHGY+ID  QE IA+G+MN  +SFF CYPSA S+SRSAVQE+ GGKTQ+TSLVS  L+LFVLLFIGP+F  LPNCIL+++IIVALK M M+F ELKELWLFSIWDFS W+V FL T F+DV+YGL+ G+  SI+ I+LRTQ+P SHILGQI GTDLYKNV VY +           C EI GIKIFRYEGS+YYAC D+FK
Sbjct:    1 MRYKWKTWLLLDLIAGLIVGTMQIPQSFAYAQLVGIQPIYGLYLAFFPVMVYYFFGSSRHISIGTIAIVSLLSGSFLEQSLIDFPL----NTTKTVGNVSASVQN---------------EAIKASRVAGLTLFVGISQLIMGVFNLGFLTKYLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQGVPAPVIPVIDNMSNYISNIIVTAIIAFSVSISLGKMFAKKHGYKIDATQEFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGD-----------CHEIPGIKIFRYEGSIYYACKDHFK 484          
BLAST of slc26a-8 vs. TrEMBL
Match: A0A1I8J1Y0 (STAS domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 541.962 bits (1395), Expect = 2.068e-177
Identity = 301/613 (49.10%), Postives = 415/613 (67.70%), Query Frame = 1
Query:  151 RPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYV------------NKQGMKRCIREK------LPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIA-------NNSLTFLANENISF-LSSNDSLRLSQETSK-ITELLKANRVA---GFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVA-DIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            RP+YTQ +FD  HGG  ++    R  ++++R + K+ V            + +    C R K      LPFI I+ +Y  R+WLLADFI+GL VGIMHIPQ MAYA LA L P  GLY SFFP ++YFFFGTSR +S+GT+AIISLL G  + K   +FP  +        N + T +A++ ++  L+ NDS   S    +  ++ +  NRVA        VG++QL MG+  LGFLT+YLSDPLISGFT+G ++HVF+SQIKY  G+ +P++ GVF++   YF + +N+ +TN  T+ + VV I++L+VTKE +NP+V K+I+ P+P+EL++V +GT++S +L L +N+ V+IVG I  G+P P LPD +     +A +I   AIIAFSV +SLAK+F KKH YE+  +QELIAYGI N V SFF C+P+ +SLSRSAVQ+S+GGKTQ+ +L SS LLL VLLFIG  F ++PNC LSAIIIVA+KGM  Q  E   LW  S +DF TW+VA LG  F+ V+YGL++G+ FS+  I++RTQ+P S +LG+I  TDLYKNV  Y++            E +DG+KIFRYEGSLY+AC++NF+ SLY+K   +P
Sbjct:   89 RPVYTQQQFDEKHGGRLVR----RPLLARLRDSAKKLVTCGAGSGRSDDGDGESGHNCSRAKTQLLGFLPFIGILKRYNIRDWLLADFISGLTVGIMHIPQGMAYAFLAELPPYIGLYTSFFPPLIYFFFGTSRQVSMGTVAIISLLVGGLVSK---NFPATLGSAVGSFDNETTTAIASQQLTLDLNGNDSTVGSGSPFQWSSDPVSRNRVALACVTCLCVGLIQLAMGVLRLGFLTRYLSDPLISGFTMGVAIHVFSSQIKYVLGIEVPRRNGVFSLPLHYFDLLRNITETNFVTVGIAVVSIVILYVTKELVNPKVRKRIKAPLPIELLIVSLGTILSYFLDLKKNYNVKIVGTIPTGIPPPELPDFSILRASMAIEIVTIAIIAFSVCVSLAKIFGKKHNYEVAPSQELIAYGICNTVGSFFHCWPAGTSLSRSAVQDSMGGKTQVAALFSSTLLLLVLLFIGKYFESVPNCCLSAIIIVAIKGMLEQAKEAPVLWRLSPYDFWTWIVACLGVVFLAVDYGLILGLAFSVCSIIVRTQSPTSSMLGRIPDTDLYKNVLAYDDI-----------ELVDGVKIFRYEGSLYFACAENFRDSLYHKSGVHP 683          

HSP 2 Score: 86.2705 bits (212), Expect = 1.636e-13
Identity = 41/82 (50.00%), Postives = 53/82 (64.63%), Query Frame = 1
Query: 2056 DCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGT 2301
            D STWGYIDYVGV+ LNQ I+EYK + I V LANPK  +RA + R+D     +  II+VSVHDAV+ +  E++        T
Sbjct:  746 DASTWGYIDYVGVRALNQTIQEYKEVGIRVYLANPKCGIRACLQRSDFYEKNEPDIIYVSVHDAVLAAQCEQREAAAKGGDT 827          
BLAST of slc26a-8 vs. TrEMBL
Match: A0A267DPA4 (STAS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032357g1 PE=3 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 2.225e-177
Identity = 301/613 (49.10%), Postives = 415/613 (67.70%), Query Frame = 1
Query:  151 RPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYV------------NKQGMKRCIREK------LPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIA-------NNSLTFLANENISF-LSSNDSLRLSQETSK-ITELLKANRVA---GFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVA-DIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            RP+YTQ +FD  HGG  ++    R  ++++R + K+ V            + +    C R K      LPFI I+ +Y  R+WLLADFI+GL VGIMHIPQ MAYA LA L P  GLY SFFP ++YFFFGTSR +S+GT+AIISLL G  + K   +FP  +        N + T +A++ ++  L+ NDS   S    +  ++ +  NRVA        VG++QL MG+  LGFLT+YLSDPLISGFT+G ++HVF+SQIKY  G+ +P++ GVF++   YF + +N+ +TN  T+ + VV I++L+VTKE +NP+V K+I+ P+P+EL++V +GT++S +L L +N+ V+IVG I  G+P P LPD +     +A +I   AIIAFSV +SLAK+F KKH YE+  +QELIAYGI N V SFF C+P+ +SLSRSAVQ+S+GGKTQ+ +L SS LLL VLLFIG  F ++PNC LSAIIIVA+KGM  Q  E   LW  S +DF TW+VA LG  F+ V+YGL++G+ FS+  I++RTQ+P S +LG+I  TDLYKNV  Y++            E +DG+KIFRYEGSLY+AC++NF+ SLY+K   +P
Sbjct:  108 RPVYTQQQFDEKHGGRLVR----RPLLARLRDSAKKLVTCGAGSGRSDDGDGESGHNCSRAKTQLLGFLPFIGILKRYNIRDWLLADFISGLTVGIMHIPQGMAYAFLAELPPYIGLYTSFFPPLIYFFFGTSRQVSMGTVAIISLLVGGLVSK---NFPATLGSAVGSFDNETTTAIASQQLTLDLNGNDSTVGSGSPFQWSSDPVSRNRVALACVTCLCVGLIQLAMGVLRLGFLTRYLSDPLISGFTMGVAIHVFSSQIKYVLGIEVPRRNGVFSLPLHYFDLLRNITETNFVTVGIAVVSIVILYVTKELVNPKVRKRIKAPLPIELLIVSLGTILSYFLDLKKNYNVKIVGTIPTGIPPPELPDFSILRASMAIEIVTIAIIAFSVCVSLAKIFGKKHNYEVAPSQELIAYGICNTVGSFFHCWPAGTSLSRSAVQDSMGGKTQVAALFSSTLLLLVLLFIGKYFESVPNCCLSAIIIVAIKGMLEQAKEAPVLWRLSPYDFWTWIVACLGVVFLAVDYGLILGLAFSVCSIIVRTQSPTSSMLGRIPDTDLYKNVLAYDDI-----------ELVDGVKIFRYEGSLYFACAENFRDSLYHKSGVHP 702          

HSP 2 Score: 86.6557 bits (213), Expect = 1.537e-13
Identity = 41/82 (50.00%), Postives = 53/82 (64.63%), Query Frame = 1
Query: 2056 DCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGT 2301
            D STWGYIDYVGV+ LNQ I+EYK + I V LANPK  +RA + R+D     +  II+VSVHDAV+ +  E++        T
Sbjct:  765 DASTWGYIDYVGVRALNQTIQEYKEVGIRVYLANPKCGIRACLQRSDFYEKNEPDIIYVSVHDAVLAAQCEQREAAAKGGDT 846          
BLAST of slc26a-8 vs. TrEMBL
Match: A0A267ECE9 (STAS domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005698g1 PE=3 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 2.450e-177
Identity = 300/613 (48.94%), Postives = 414/613 (67.54%), Query Frame = 1
Query:  151 RPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYV------------NKQGMKRCIREK------LPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIA-------NNSLTFLANENISF-LSSNDSLRLSQETSK-ITELLKANRVA---GFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVA-DIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            RP+YTQ +FD  HGG  ++    R  ++++R + K+ V            + +    C R K      LPFI I+ +Y  R+WLLADFI+GL VGIMHIPQ MAYA LA L P  GLY SFFP ++YFFFGTSR +S+GT+AIISLL G  + K   +FP  +        N + T +A++ ++  L+ NDS   S    +  ++ +  NRVA        VG++QL MG+  LGFLT+YLSDPLISGFT+G ++HVF+SQIKY  G+ +P++ GVF++   YF + +N+ +TN  T+ + VV I++L+ TKE++NP+V K+I+ P+P+EL++V +GT++S +L L +N+ V+IVG I  G+P P LPD +     +A +I   AIIAFSV +SLAK+F KKH YE+  +QELIAYGI N V SFF C+P+ +SLSRSAVQ+S+GGKTQ+ +L SS LLL VLLFIG  F ++PNC LSAIIIVA+KGM  Q  E   LW  S +DF TW+VA LG  F+ V+YGL++G+ FS+  I++RTQ+P S +LG I  TDLYKNV  Y++            E +DG+KIFRYEGSLY+AC++NF+ SLY+K   +P
Sbjct:  108 RPVYTQQQFDEKHGGRLVR----RPLLARLRDSAKKLVTCGAGSGRSDDGDGESGHNCSRAKAQLLGFLPFIGILKRYNIRDWLLADFISGLTVGIMHIPQGMAYAFLAELPPYIGLYTSFFPPLIYFFFGTSRQVSMGTVAIISLLVGGLVSK---NFPATLGSAVGSFDNETTTAIASQQLTLELNGNDSTVGSGSPFQWSSDPVSRNRVALACVTCLCVGLIQLAMGVLRLGFLTRYLSDPLISGFTMGVAIHVFSSQIKYVLGIKVPRRNGVFSLPLHYFDLLRNITETNFVTVGIAVVSIVILYGTKEFVNPKVRKRIKAPLPIELLIVSLGTILSYFLDLKKNYNVQIVGTIPTGIPPPELPDFSILRASMAIEIVTIAIIAFSVCVSLAKIFGKKHNYEVAPSQELIAYGICNTVGSFFHCWPAGTSLSRSAVQDSMGGKTQVAALFSSTLLLLVLLFIGKYFESVPNCCLSAIIIVAIKGMLEQAKEAPVLWRLSPYDFWTWIVACLGVVFLAVDYGLILGLAFSVCSIIVRTQSPTSSMLGHIPDTDLYKNVLAYDDI-----------ELVDGVKIFRYEGSLYFACAENFRDSLYHKSGVHP 702          

HSP 2 Score: 86.6557 bits (213), Expect = 1.352e-13
Identity = 41/82 (50.00%), Postives = 53/82 (64.63%), Query Frame = 1
Query: 2056 DCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGT 2301
            D STWGYIDYVGV+ LNQ I+EYK + I V LANPK  +RA + R+D     +  II+VSVHDAV+ +  E++        T
Sbjct:  765 DASTWGYIDYVGVRALNQTIQEYKEVGIRVYLANPKCGIRACLQRSDFYEKNEPDIIYVSVHDAVLAAQCEQREAAAKGGDT 846          
BLAST of slc26a-8 vs. Ensembl Cavefish
Match: slc26a10 (solute carrier family 26 member 10 [Source:NCBI gene;Acc:103043095])

HSP 1 Score: 397.127 bits (1019), Expect = 3.125e-127
Identity = 252/728 (34.62%), Postives = 404/728 (55.49%), Query Frame = 1
Query:  139 ISIKRPIYTQHEFDLNHG--GNYIKKSWKRKFMSK-VRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRV---AGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGT 2301
            +++ R IYT+  F   +G       K+  R+ +S+  R ++   ++       ++E++P +S + KY+ R+W+L D +AGL VGI+HIPQ MA+A L  + PIYGLY SFFPV++Y  FGT  H+S GT A++SL+TG  +E+ +   P   A NS +  A E                       L+A R+   +  AFL GV+ L M    LGFL+ YLS+P+I  FT  A+ HV  SQ++   GL +P+  G F++ KT   + +NLP TN+  L++++V + VL   KE +N R  + +R PIP+E++ VII T V+    L+  + V+IVG I  G P P LP L+       D      + ++V +SLA +++ KHGY I  NQEL+A+GI N V+S F C+PS+++L+ + + ES GG TQL+ L +S ++L VLL IGP+F+ LP  +L+ I + +L+ MF+QF +L +LW  S  DF  W+V +L    ++V+ GL IG+ FS++ ++ RTQ     +LG+   T++Y+ +           N H  C EI G+KI  Y G +YY     FK+ +   +   P  I+ R    +   K+ ++  N  E         ++ E    ++    +  +++DCS   ++D  G K   Q+  E + + + + LAN   +V   +  +   + ++ + IFV+VHDAVI    E++ E  + N T
Sbjct:    5 VAVYRNIYTEDRFRQTYGTEAQPSGKAGLRETLSRPCRCSRDTCLH------LLKERVPVVSWLPKYRLRKWILGDTVAGLTVGILHIPQGMAFALLTSVAPIYGLYTSFFPVVLYMLFGTGCHVSTGTFAVVSLMTGSVVEQLV---PSPPALNSSSPEAAE-----------------------LEAQRIGVASAIAFLSGVMMLCMFGLQLGFLSTYLSEPIIKAFTSAAAFHVTISQLQSMLGLRLPRHTGTFSLFKTLASVLENLPHTNLAELLISLVCLAVLIPIKE-VNTRFRQHLRTPIPVEILTVIIATGVAYAFSLDSTYDVQIVGHIPAGFPQPRLPALHTVPDIAGDTVAITFVGYAVSVSLAMIYADKHGYSIHPNQELLAHGISNTVSSLFTCFPSSATLATTNILESAGGYTQLSGLFTSLVVLVVLLLIGPLFYFLPKAVLACINVTSLRQMFLQFQDLPDLWRVSRIDFMVWLVTWLSVVVLNVDLGLAIGVVFSMMTVICRTQRAGCSVLGRASNTEIYRPI-----------NNHNKCYEIPGVKILTYNGPIYYGNRSFFKADVNQLLGLTPERIRSREKARKALEKREREAINTVERGVANTSFSSENEFFKSEMSENEVQAVLMDCSGVVFVDVAGAKLFIQMCIECQKMGVRIYLANCNENVLKILTSSGLMNYMNPQHIFVTVHDAVI--YIEQQREKPSENAT 686          
BLAST of slc26a-8 vs. Ensembl Cavefish
Match: slc26a5 (solute carrier family 26 member 5 [Source:NCBI gene;Acc:103036170])

HSP 1 Score: 374.4 bits (960), Expect = 6.865e-118
Identity = 224/586 (38.23%), Postives = 344/586 (58.70%), Query Frame = 1
Query:  145 IKRPIYTQHEF--DLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            ++R ++ +      L H      KS  ++     R + +        K  I   LP +S +  Y  +E+L  D ++GL  G+M +PQ +AYA LA + P+YGLY SF+PV++Y  FGTSRHIS+GT A+ISL+ G    +   D    +   ++T L +       + D+ R+    +  T             LVG++QL +G+   GF+  YL++PL+ GFT  A++HVF SQ+KY FG+   +  G  ++  +   + K++  TN+ TL++ +V I+ L+  K+ +N R  KK+ +PIP E+IVVI+ T VS  + L EN++V IVG I  GL  P +PD   F   VAD    A+++FS+GISLAK+F+ K+GY +D NQE+IA G+ NF +SFF  +   SS+SRS VQES GGKTQ+  L+ S L+L V++ IG +F  LP  +L+A+I+V L GMF Q  ++  LW  S  + + W+VAF+ +  + +++GL++ +GF+IL ++ RTQ PKS ILGQI  T LY +++ Y E             E  G+KIF    S+Y+A SD + + L +K   +P
Sbjct:   24 VQRNVFDEEHLSSQLLHKKERTPKSIGQRLAESCRCSSER------AKSAIFSFLPILSWLPSYPVKEYLFGDIVSGLSTGVMQLPQGLAYAMLAAVPPVYGLYSSFYPVLLYTLFGTSRHISMGTFAVISLMIGGVAVREAPDSMFPLNGTNVTGLVD-----FEARDARRVQVAVALTT-------------LVGLIQLFLGVLRFGFVAIYLAEPLVRGFTTAAAIHVFVSQLKYLFGVKTKRFSGPLSVLYSLIAVFKDITSTNVTTLIVGLVCIVFLYSVKD-VNERFKKKLPIPIPGEIIVVIVSTGVSYGMALFENYQVDIVGSIPVGLLPPVIPDFTLFPNLVADAVAIAVVSFSMGISLAKIFALKYGYSVDGNQEMIALGLCNFASSFFQTFVITSSMSRSLVQESTGGKTQIAGLLGSLLVLLVIVAIGFMFEPLPQTVLAAVIMVNLLGMFKQVRDIPALWRTSKIELAVWLVAFVASVLLGLDFGLLVAVGFAILTVIYRTQRPKSVILGQIPNTGLYYDIDEYEE-----------ASECSGVKIFHSNSSIYFANSDQYVNHLKDKTGIDP 573          
BLAST of slc26a-8 vs. Ensembl Cavefish
Match: slc26a6l (solute carrier family 26 member 6 [Source:NCBI gene;Acc:103035873])

HSP 1 Score: 375.941 bits (964), Expect = 1.009e-117
Identity = 206/535 (38.50%), Postives = 331/535 (61.87%), Query Frame = 1
Query:  277 MKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            +KR +   LP +  + +Y   ++ + D ++G+ VGIMH+PQ MAY+ LA L P++GLY SF+P +VYFFFG+SRHISIGT  ++S++ G  +E+        +A ++   + N   + +  N + R         +L +    A    L G++Q+I+G+   GF+  YLS+PL+ G+T  A+ H   +Q+KY FG++  +  G  ++  T   +   LP T++PTL+++ V I VL V KE +N R  KK+ VPIP+ELIV+++GT++S Y  LN+N+++ +VGEI  GL  P++P  + FS  V D F  AI+ +++ ISL K F+ KHGY++D+NQEL+A G+ N V  FF CY   +S+SRS VQE+ GGKTQ+  + S+ ++L  +L +GP+F  LP  +L+A++ V LKGMF Q++++  LW  S  D   W+V ++ T   +++ GL   IGF++L ++ RTQ P+  +LG + GT+LY ++E            H    E+ GI IFR   ++Y+A ++ +  +L  K
Sbjct:   53 LKRRVVGCLPVLYWLPRYSIWDYGMPDLVSGISVGIMHLPQGMAYSLLASLPPVFGLYTSFYPALVYFFFGSSRHISIGTFTVLSIMVGSVVER--------LAPDANFLIVNGTNATVEVNVTER---------DLYRVQVAAATTVLAGLIQVILGLVQFGFVGTYLSEPLVRGYTSSAAAHAVVAQLKYIFGVSPTRFSGPLSLVYTLVDVCMLLPSTHLPTLLISSVSITVLIVAKE-LNNRFRKKLPVPIPVELIVIVVGTLISYYTHLNKNYEISVVGEIPSGLQPPTVPQTSVFSEVVVDAFALAIVGYAISISLGKTFALKHGYKVDSNQELVALGLSNAVGGFFQCYSVCASMSRSLVQETTGGKTQMAGVASAVIVLVTVLKLGPLFQDLPKAVLAAVVFVNLKGMFKQYSDILTLWRTSKIDLLVWLVTWVSTVLFNLDMGLGASIGFALLTVIFRTQRPRYSVLGHLPGTELYLDME-----------THTQVREVPGITIFRSSATIYFANAELYLEALKQK 558          
BLAST of slc26a-8 vs. Ensembl Cavefish
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:103026473])

HSP 1 Score: 354.369 bits (908), Expect = 1.485e-110
Identity = 208/557 (37.34%), Postives = 328/557 (58.89%), Query Frame = 1
Query:  217 KRKFMSKVRSTKKEYVNKQG--MKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            K    + V+   KE +   G  +K C    +P ++ + +Y ++E    D ++G+ VGIMH+PQ MAYA LA + P++GLY SF+P+++YF FGTS+HIS+GT A++S++ G   E+   D    + NN    ++N +     + D  R+     KI         A   FL G+ QL++G+   GF+  YLS+PL+  +T  A++HV  SQ+KY FG++  +  G  ++  T   +   L +TNI TLV+++V I+ L + KE +N  + +K+ VP+P+ELI +II TV+S        +KV +VG I  GL  P LP  +     + D F  A++ + + ISL ++F+ K+GY++D+NQEL+A G+ N +   F C+  + S+SR+ VQ S GGKTQ+   +S+ ++L +LL+IG +F  LP  +L+AII V L GM  QFA++  LW  +  D   W+V F+ T  ++ + GL   I FS+L ++ RTQ PK  +LGQ+ GTD+Y+ VE YN+             +I GI IFR   +LY+A ++ +   LY K
Sbjct:   31 KLDVTTSVKDKLKESMRCSGPQVKSCFLSCIPLLAWLPRYPFKENAFGDLVSGISVGIMHLPQGMAYALLAAVPPVFGLYSSFYPILIYFIFGTSKHISVGTYAVMSVMIGSVTERLAPDSDFTLWNN----ISNSSEINFEARDIERV-----KIA--------AAVTFLSGIFQLLLGLVQFGFVVTYLSEPLVRAYTTAAAIHVIVSQLKYSFGISATRFSGPLSLIYTVLEVCSLLGQTNIGTLVVSIVTIVCLIIAKE-LNSWLARKLPVPVPVELIAIIIATVLSWQFDFKTEYKVEVVGSIPSGLQPPKLPAFSMMGSMIGDAFALAVVGYGIAISLGRIFALKYGYKVDSNQELVALGLSNSIGGVFQCFAISCSMSRTMVQISTGGKTQVAGALSAIVMLVILLWIGSLFEDLPKAVLAAIIYVNLHGMMKQFADIPSLWRSNKVDMLVWLVTFVLTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSLLGQVPGTDIYRPVEDYNQ-----------VTQIPGIVIFRSSATLYFANAEMYTDHLYEK 558          
BLAST of slc26a-8 vs. Ensembl Cavefish
Match: slc26a3.2 (solute carrier family 26 member 3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-041210-179])

HSP 1 Score: 351.288 bits (900), Expect = 2.479e-109
Identity = 213/593 (35.92%), Postives = 331/593 (55.82%), Query Frame = 1
Query:  121 KTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYV-NKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            +T V+   + RP+YT+  F  NH      +  +RK  + +   K+ +  + + +K      +P +  M  Y+ +EWLL D ++G+  G++ I Q +AY+ LA L   YGLY +FFPVI+YFF GTSRHIS+G   ++SL+ G  + + + D    +           NI+ L   + L +  + + ++        A   FL+G+ QL MG+  +GF+  YLSD L+SGFT  A++H+  SQ+K+ FGL++P   G   I     +    +  TNI  LV  +VV++V+F  KE IN R   K+ VPIP+E+I+ II   VS      +NH V +VG I      P  P++  F     D F  AI+ F++  ++AK+++ KH Y ID NQELIA+G+ N     F    S+++LSRSAVQES GGKTQ+  ++S+ ++L V L IG +   LP  +L A++IV LKGM MQ  E+  LW     D   W+V FL + F+ ++ GL +G+G  +L ++ RTQ P+  +L  I GTD+Y++ + Y    E            +G+KIFR    +++A  D F+  L + + +NP
Sbjct:    2 RTPVDQYVVSRPLYTEDSFTENH------EKVERKHKTTLDHVKQYFTCDSKRVKNAALSLVPIVGWMKMYRVKEWLLGDIVSGVSTGLVAILQGLAYSLLASLPAWYGLYAAFFPVIIYFFLGTSRHISVGAFPVLSLMVGAVVTRMVPDGGPTV-----------NITGL---EGLSIDDQRAMVS--------ASLTFLIGIFQLGMGLLQVGFVVIYLSDTLVSGFTTAAAVHILISQLKFIFGLSVPGFSGPLAIYIRNIF--TQITSTNIHDLVTAIVVMVVVFAVKE-INERFKSKLPVPIPIEVIMTIIACGVSYAFNFKDNHGVDVVGLIPDSFETPVAPNIEVFKETAVDAFPMAIVGFAISFAVAKVYAVKHDYVIDGNQELIAFGVSNIFGGAFKSLASSTALSRSAVQESTGGKTQIAGILSAIIVLIVTLAIGFLLEPLPKSVLGAVVIVNLKGMLMQMREVPYLWKKDRLDCIIWIVTFLASIFLGLDLGLAVGLGVELLAVVFRTQFPRCSVLANISGTDIYRDRKDYINIYEP-----------EGVKIFRIPAPIFFANIDFFRGKLLDAVGFNP 552          
BLAST of slc26a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003427.1 (pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-1 gene:ENSPMAG00000003117.1 transcript:ENSPMAT00000003427.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 377.867 bits (969), Expect = 3.391e-120
Identity = 231/666 (34.68%), Postives = 381/666 (57.21%), Query Frame = 1
Query:  304 PFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSL-----LDFPIK----IANNSLTFL-ANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGT-DLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYE 2268
            P +  + KYK REW+L DF++GLIVGI+ +PQ +AY+ LAG  PIYGLY SFF  I+YF  GTS+HIS+G   ++ L+ G+ +++ L      +  IK    + NNS+ F  ++E   F      L   +    I             F+ GV Q++MGIF +GF++ YLS+P++SGF  G+S+ V TSQ+KY  G++IP+  G   + KT+++I   +  TN+  +V +++ I+VL   KE +N     +++ P P+EL+VV+  T+ S +    EN+   I G I  G   P  P+        AD    AII F++ +SL+++F+KKHGY +  NQE+IA G  N V +FF  + ++++L+++ V+E+ G +TQ++++V++ +LL VLL I P+F++L  C+L  I IV L+G F +F ++  +W  S  D S W V  L +A I  E GL++G+  S+L+ ++RTQ P++ + G +  T + Y ++E Y+              E+ G+++F ++  LYYA  + FKS L+ K   NP        + +R+ K  K+   +  ++     K  +    + L     H ++IDCS   ++D VGV  +  ++++Y+SI I V+LA     V  ++ R    S I+D + F  +HDAV+ +  E
Sbjct:   57 PVLRWLPKYKVREWILGDFMSGLIVGILLVPQCIAYSLLAGQDPIYGLYTSFFACIIYFLMGTSKHISVGIFGVLCLMIGQVVDRELQVAGFAEEGIKGHDHVVNNSMNFSNSDEENGFTVMIGGLPCGRSCFAIAVGTTVT------FMAGVYQVVMGIFQMGFVSIYLSEPMLSGFVTGSSLTVLTSQMKYLLGIHIPRASGAGALLKTWYHIFSQISNTNVCDVVTSIICILVLVPAKE-LNEHFKARLKAPFPIELVVVVAATLASHFGGFKENYSSSIAGHIPTGFLPPRAPEWTLIPRIAADAVPIAIIGFAITVSLSEMFAKKHGYTVRANQEMIAIGFCNIVPAFFYSFTTSAALAKTLVKEATGCQTQMSAVVTAGVLLLVLLLIAPLFYSLQKCVLGVITIVNLRGAFRKFLDIPRMWQESRVDTSIWFVTMLASALISTEIGLLVGVCVSLLVFIVRTQRPRAALYGCVHDTNNFYADLEAYSNV-----------AEVPGVRVFHFDAPLYYANKEYFKSQLFLKTRVNP--ALEVAAQKKRQEKLQKRKKLSGSDNGEIVNKQAMLEFNKLLPTFDFHTIVIDCSAMQFMDSVGVGAVKSIMKDYQSIGIRVILACCNPTVMDSLHRGKCISTIEDNLTFCLIHDAVLYAEAE 702          
BLAST of slc26a-8 vs. Ensembl Sea Lamprey
Match: si:ch211-117c9.2 (si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-11])

HSP 1 Score: 264.618 bits (675), Expect = 4.297e-79
Identity = 150/397 (37.78%), Postives = 237/397 (59.70%), Query Frame = 1
Query:  718 FLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTN-QELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLP---NCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNP 1896
            FL G+ QL +G+   G +  YLS+P++ GFT   S+HV  +Q+KY FG+++ +  G     +T      +L  TN+ +L+L V+  + L  +KE +  R   ++  PIP+ELI+V++ T+ S  L LNE H V I+G+I  GL  P +P    F   V D    AI+ FS+ IS+ K F+ KHGY ID+N QEL+A G+ N   S F  +  + ++SRS VQ++ GG+TQ+  LVS+ L+L V+L I  +F  LP      L+A+++V LKGMF QFA++ +LW     D + W+V F  +  + ++ GL + + F++L +++RTQ PK  ILG+I  TD+Y +++ Y E            +E+ GI+IF+   SLY+A +D +  +L +K   +P
Sbjct:    9 FLCGIYQLSLGMLRFGVVATYLSEPMVRGFTTACSIHVCVTQLKYMFGVSVSRYSGPLASEQTTIEFCSHLGHTNLVSLLLCVICTVGLAGSKE-LGDRYRNRLPAPIPLELILVVLATLASSGLELNEKHAVDIIGDIPTGLKPPVVPSFTLFGKVVVDAITLAIVGFSIAISMGKTFALKHGYNIDSNQQELVAIGLSNIFGSIFHSFTISCAMSRSLVQDATGGQTQVAGLVSALLVLIVILAISSLFRPLPRSGQAALAAVVLVNLKGMFKQFADVPQLWRTCRIDLAMWMVTFWASVLLGLDLGLAVAVSFALLSVVIRTQTPKYSILGKIPNTDIYLDLKEYAE-----------AKEVSGIRIFQTNASLYFANADMYTEALISKTGLDP 393          
BLAST of slc26a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003699.1 (pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 gene:ENSPMAG00000003383.1 transcript:ENSPMAT00000003699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 201.83 bits (512), Expect = 4.962e-60
Identity = 108/227 (47.58%), Postives = 150/227 (66.08%), Query Frame = 1
Query:  736 QLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFG---VFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQL 1407
            QLIM    LGF+  YLSDPL+S FT  A++HV  SQIK   GL +P+  G   +F + +T   I + LP TNI  LV ++V + VL   +E IN R   K++ PIP+EL+++++ TV+S Y  L E   V +VG I  GLP P LP + NFS  +AD    AI+ ++V +SLAK+F+KKHGY +D NQEL A+G+ N   SFF C+PSA+S+SR+++QE  GG TQ+
Sbjct:    1 QLIMFSLQLGFVAIYLSDPLVSAFTNAAAIHVLVSQIKNMLGLQVPRFSGPASIFMVFQTMVDIFQKLPNTNIAELVTSLVCLTVLIPVRE-INQRYKSKLKAPIPVELLLIVLATVISFYARLEEKFGVTVVGNIPAGLPVPQLPTVTNFSSLIADGLAIAIVGYAVSVSLAKIFAKKHGYTVDANQELFAHGVCNLFGSFFQCFPSAASISRTSIQEGTGGNTQV 226          
BLAST of slc26a-8 vs. Ensembl Sea Lamprey
Match: slc26a11 (solute carrier family 26 member 11 [Source:ZFIN;Acc:ZDB-GENE-030131-5349])

HSP 1 Score: 141.739 bits (356), Expect = 6.043e-36
Identity = 135/458 (29.48%), Postives = 212/458 (46.29%), Query Frame = 1
Query:  355 DFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGL-NIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMEL---IVVIIGTV--------VSKYLLLNENHKVR---IVGEISQGLPAPSLPDLNN--------FSMYVAD----IFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGI 1647
            D +AGL VG+  +PQS+AYA +AGL   YGLY +F    VY   GTS+ +++G  AI+SL+   ++ +        +    LTFL+                                      G +QL+MGI  LGFL +++S P++ GFT  A++ +  SQIK   GL +IP+QF      +  +Y    + +T +   +L    +++L + +  I  R      +P+ + +   I  I GTV         +      E+ ++    + G I+QGLP    P  +         F   V D    + +  ++ F   I++AK F+ K+ Y ID +QELIA G+ N + SF   YP   S  R+AV    G  T    LV+  ++L  L F+ P F+ +P   LSAIII A+  +F     L  LW     D   +V+ F      ++ YGL+ G+
Sbjct:    9 DLVAGLTVGLTVVPQSLAYAQVAGLPAQYGLYSAFMGCFVYCLLGTSKDVTLGPTAIMSLVVSVYVRRD------PVYAVLLTFLS--------------------------------------GAIQLLMGILRLGFLVEFISLPVLKGFTCAAAITIGFSQIKTLLGLKDIPQQF-----FQEVYYTFSRIAETRLADALLGGSSLLLLILLRV-IAARSPIPPPIPVSVRISNSITSIFGTVRNAVVVLAAALVAFACESQRLHPFTLTGHIAQGLPPFHPPAFSETKEGTFIPFLQIVRDLGLALLVIPLLGFLESIAIAKAFATKNMYRIDPSQELIAIGLTNVLGSFTSSYPVTGSFGRTAVNSETGVATPAGGLVTGTVVLLSLAFLTPWFYFIPQAALSAIIICAVAPLF-DCRILWRLWKIKKSDALVFVLTF-ALCLWEIPYGLLGGV 414          
BLAST of slc26a-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006617.1 (pep scaffold:Pmarinus_7.0:GL482475:5949:18084:-1 gene:ENSPMAG00000005984.1 transcript:ENSPMAT00000006617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 7.798e-22
Identity = 61/188 (32.45%), Postives = 111/188 (59.04%), Query Frame = 1
Query:  721 LVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQ----FGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWIN--PRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKH 1266
            L+   Q+ +G+   G +  YLS+PL+ GF+  AS+ V  SQ+K+  GL +P++     G  + A+    + + + + N+ T +++++ +  + + K  ++  PR+    RVP+P EL++V++GTV+S+ L L+ +H V +VG I  GL AP  P L      V D    A++ ++V +SL K+F++KH
Sbjct:    1 LLAAPQVGLGLLRFGVVATYLSEPLVRGFSTAASVTVLVSQLKHLLGLALPRRHDQVLGTLHTARD---VCRGVLQVNVVTALVSLLSLCSMLLLKRVVHSVPRLR---RVPVPAELLLVVLGTVLSEQLQLSPDHSVDVVGLIPSGLAAPEWPSLALSVGLVGDALALAVVGYTVAVSLGKMFAQKH 182          
BLAST of slc26a-8 vs. Ensembl Yeast
Match: SUL1 (High affinity sulfate permease of the SulP anion transporter family; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000000498])

HSP 1 Score: 155.992 bits (393), Expect = 1.024e-39
Identity = 125/489 (25.56%), Postives = 227/489 (46.42%), Query Frame = 1
Query:  343 WLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIA----KNLPKTNXXXXXXXXXXXXXXXXXKEWI--------------NPRVVKKIR-----VPIPMELIVVIIGTVVSKYLLLNENHKVR---IVGEISQGL---PAPSLPD--LNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIK 1716
            W  AD +AG+ VG + +PQSM+YA +A L P YGLY SF    +Y  F TS+ + IG +A++SL T K + + L  +P                            ++ +++T  + A  +     L G+V   +GI  LGFL + +S   ++GF  G++ ++   QI    G N      + N  +  + +     K+LP T +  +   + ++I+    K W                P+V  +++            +V+++ T +S  +  N++ K R   I+G +  GL       +PD  L+N S   ++I  + I+     I+++K F + + Y++  +QELIA G+ N + +FF  YP+  S SRSA++     +T  + + +   +L  L  +   F  +P   LSA+II A+  +   +      W  +  D  +++V    T F  +E G+   + +S  M++L+   P    LG+++
Sbjct:  120 WGYADLVAGITVGCVLVPQSMSYAQIASLSPEYGLYSSFIGAFIYSLFATSKDVCIGPVAVMSLQTAKVIAEVLKKYP----------------------------EDQTEVTAPIIATTLC---LLCGIVATGLGILRLGFLVELISLNAVAGFMTGSAFNIIWGQIPALMGYN-----SLVNTREATYKVVINTLKHLPNTKLDAVFGLIPLVILYVW-KWWCGTFGITLADRYYRNQPKVANRLKSFYFYAQAMRNAVVIVVFTAISWSITRNKSSKDRPISILGTVPSGLNEVGVMKIPDGLLSNMS---SEIPASIIVLVLEHIAISKSFGRINDYKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVLLALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYKTTWTFWKTNPLDCISFIVTVFITVFSSIENGIYFAMCWSCAMLLLKQAFPAGKFLGRVE 568          
BLAST of slc26a-8 vs. Ensembl Yeast
Match: SUL2 (High affinity sulfate permease; sulfate uptake is mediated by specific sulfate transporters Sul1p and Sul2p, which control the concentration of endogenous activated sulfate intermediates [Source:SGD;Acc:S000004082])

HSP 1 Score: 149.058 bits (375), Expect = 2.010e-37
Identity = 133/518 (25.68%), Postives = 230/518 (44.40%), Query Frame = 1
Query:  253 KEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNI-AKTYFYI---AKNLPKTNXXXXXXXXXXXXXXXXXKEWI--------------NPRVVKKIR-----VPIPMELIVVIIGTVVSKYLLLNENHKVR---IVGEISQGLPAPSL----PDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIK 1716
            + ++  +G    ++   P I+ +  Y +  W  AD IAG+ +G + +PQSM+YA +A L   YGLY SF     Y FF TS+ + IG +A++SL T K +      +P                               S IT  + A  +A    L G++   +G   LGFL + +S   ++GF  G++ ++   Q+    G N      + N  A TY  +    K+LP T +  +   + + ++    K W               NPR+ K I+            I++I+ T +   +   ++   R   I+G +  GL    +    P L   S    ++  + I+     I+++K F + + Y++  +QELIA G+ N + +FF  YP+  S SRSA++     +T L+ L S   +L  L  +   F  +P   LSA+II A+  +   +      W  +  DF  ++V  L T F  +E G+   + +S  M++L+   P    LG+++
Sbjct:  107 RSHLTVKGACSYLKSVFPIINWLPHYNF-SWFTADLIAGITIGCVLVPQSMSYAQVATLPAQYGLYSSFIGAYSYSFFATSKDVCIGPVAVMSLQTAKVIADVTAKYP----------------------------DGDSAITGPVIATTLA---LLCGIISAAVGFLRLGFLVELISLNAVAGFMTGSAFNILWGQVPALMGYN-----SLVNTRAATYKVVIETLKHLPDTKLDAVFGLIPLFLLYVW-KWWCGTYGPRLNDRYNSKNPRLHKIIKWTYFYAQASRNGIIIIVFTCIGWAITRGKSKSERPISILGSVPSGLKEVGVFHVPPGL--MSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGTFFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIHAVSDLLASYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLILKVAFPAGKFLGRVE 584          
BLAST of slc26a-8 vs. Ensembl Yeast
Match: YPR003C_mRNA (Putative sulfate permease; physically interacts with Hsp82p; green fluorescent protein (GFP)-fusion protein localizes to the ER; YPR003C is not an essential gene [Source:SGD;Acc:S000006207])

HSP 1 Score: 108.997 bits (271), Expect = 6.408e-25
Identity = 134/545 (24.59%), Postives = 235/545 (43.12%), Query Frame = 1
Query:  301 LPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYA-HLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGF--TVGASM--HVFTSQIKYC-FGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVK--KIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVG--------EISQGLPAPS---LPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAI-IIVALKGMFMQFAELK-ELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSL 1872
            LP  S + +Y + + L  D IAG+ V    IP +++Y   +A + P+ GLY       VY   G+   + +G  + ISL+ G+ +E             S+T L  EN+S +              I+ ++         F+ G + L  GI   GFL   LS  L+ GF  +VG  M  +   S++K   F +++P+ +      K  F I    P        +     +++      +  +++K  K  +  P  L+VVI+  ++S    L   + + I+G        E+   L  P    +PDL + S+      I A++ F    + +K     +   + +N+EL+A G MN V S F   P+     RS +    G ++ ++ +    + L  +  +    H +PNC+LS I  I+ +  +     ++K  L      +   + V F  T F  +E G+ IG  +SI+ I+  +   +  IL ++ GT  + N++ Y   M+ N       EEI+G  I R    L +  S++ K  L
Sbjct:  105 LPCFSWLPEYTFNK-LWGDVIAGISVASFQIPLALSYTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVE-------------SIT-LHKENVSLI-------------DISTVI--------TFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDKFLVSLPQHYHT-PFEKILFLI-DYAPAQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSAIFFPDILLVVIVTILISMKFNLKHRYGISIIGDFSMDNFDELKNPLTRPRRKLIPDLFSASL------IVAMLGFFESTTASKSLGTTYNLTVSSNRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIVRIPEPLTFTNSEDLKQRL 605          
BLAST of slc26a-8 vs. Ensembl Nematostella
Match: EDO49691 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG03])

HSP 1 Score: 326.25 bits (835), Expect = 2.642e-100
Identity = 234/719 (32.55%), Postives = 383/719 (53.27%), Query Frame = 1
Query:  139 ISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNK-----QGMKRCIREKL----PFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSL--RLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGI---KIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVI 2253
            I I+R   T+ +F     G++  K  K+ F +  RS +K  +        GM     E L    P +  + KY +R+  +AD   G+ VG+MHIPQ +A+A LA L P+ GLY +  PV++Y   GTS+++S G+ A+I L+  +  E+ +  +        +T   N +    SS   +    S+  S+  E+         A L+G++Q++MG+  LGF+  YLSDPLISGFT G+++ V  SQ+K+ FG  +P+  G F   K   ++ K +  +N   ++  V+ +++L   K +IN +  K++ +PIP EL+VV +GT +S    L++   V+++GEI +GLP  S+P        V D F+ +++ F+  ISLA++F+KK+G  +D NQEL+AYG+ N   SFF C+P  ++L+R+ VQE++   TQL S+    L+L VLLF+ P+F+ LP  IL+A++I  L G+  QFA L++LW     D  TW V   G   + V+ GL +G+  +I ++++R   P+  ILG IK T+LY++ +               C +  GI   KI R+E SL++A +   K  + + +  NP     R         +         N+      T   T  E+  +  I  +I+D S + +ID VG+  +  +I E  S  + V LA     +R  +        +++  +FVS+HDAV+
Sbjct:   17 IDIQRSALTEGQF-----GDFYGKHEKKTFDN--RSLRKRVLTSVTGKVTGMTCSPLETLEKLFPIVQWLPKYNFRKEFVADLTGGMTVGVMHIPQGLAFAMLASLPPVTGLYTALIPVMIYMLMGTSKYLSQGSFAVICLMVAQVSEREVQSYTPTPLTTPITAPYNAS----SSQPPMVGPWSELDSRKMEI-----AVTLALLIGIMQILMGLCRLGFVATYLSDPLISGFTTGSAVLVVLSQLKHIFGQVVPQNTGAFASIKVAAHMLKFIASSNPGAIITGVLCLVILVTLK-FINEKYKKRLPIPIPAELLVVALGTAISYGASLSDEFGVKVLGEIPKGLPPISIPSFKRMRTIVPDAFVISVVIFATNISLARMFAKKNGQTVDANQELLAYGMCNVGGSFFSCFPICNALARTVVQENL-ASTQLCSIPVICLILLVLLFMAPLFYYLPKAILAAVVIANLGGLLKQFARLRQLWCICRTDAVTWFVTCFGVILLGVDLGLGLGVITTIFVVIIRQSRPRVSILGHIKDTELYRDTQ--------------ECPQAAGIPNVKILRFESSLFFANAGFIKERIMSFM--NPLTPTKRECIPGITTDEA--EVTMELNAEKESLDTTKRTNREQGVNANIKAVIVDASAFTFIDSVGITAIKTIITEGDSRGVHVCLAACSYHLRKQLEAGGLEPSLNNDHLFVSIHDAVL 699          
BLAST of slc26a-8 vs. Ensembl Nematostella
Match: EDO48275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ6])

HSP 1 Score: 187.578 bits (475), Expect = 5.690e-51
Identity = 164/557 (29.44%), Postives = 269/557 (48.29%), Query Frame = 1
Query:  205 KKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGL-NIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKE-----WI------NPRVVKKIR-----VPIPMELIVVIIGTVVSKYLLLNENHKV-RIVGEISQGLP---APSLPDLN-NFSMYVADIF--------ITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLR------TQNPKSHILGQIKGTDLYKNVE-VYNEFME 1764
            K   + +   K   + +  ++ + +K+  +++ P    + KY    +L  D IAGL VG+M +PQ +AYA +AGL P YGLY +F    VY  FGTS+ I++G  AI+SL+   + +  +  F                                           V     L GV+QL+MGI  LGFL  ++S P++SGFT  A++ +  SQIK   GL NIP+ F      K  +   KN+  T    LVL ++ IIVL + ++     W+       PR +K ++     + I    IV+++ +VV+  L ++ +  V  + G +  GLP   AP +   N N +   +D+         I  +I F   I++AK F++K+ Y++D +QELIA G+ N ++SF   YP   S SR+AV    G  T    + +  +++  L  + P F  +P   L+A+II ++  M ++F  +  +W     D    +V F G  F ++EYG++ G+G S+ + +        T+  + +I  +IKG   Y  VE V +E  E
Sbjct:    7 KTQHQEELEEKCAESCQRKIDLEAIKKYTKKRFPIAKWLSKYNL-HFLQCDLIAGLTVGLMVVPQGLAYALVAGLPPQYGLYSAFMGCFVYCVFGTSKDITLGPTAIMSLIVSAYGKSEIPAF-------------------------------------------VMVLTLLSGVIQLLMGILKLGFLVNFISIPVVSGFTSSAAIIIAISQIKDVLGLKNIPRPF-----MKRIYQTFKNIGDTRRWDLVLGLICIIVLLLMRKLGRTRWVKDVIPETPRTIKVLKKICWLIAIARNAIVILVASVVAVLLYIHGHKSVFSLTGHLEPGLPPFKAPPMTITNGNVTYSTSDVLSQLGPGLAIVPLIGFLESIAIAKAFARKNRYKVDASQELIALGLANVLSSFVSSYPVTGSFSRTAVNAQSGVATPAGGIFTGAIVILALGVLTPFFKYIPKASLAALIISSVLTM-VEFQIVPRIWRVKKIDLIPLLVTFFG-CFYEIEYGILAGMGVSLAIFLYPVIWPTLTKTEQDYITIRIKGDLAYTGVEHVVSELEE 512          
BLAST of slc26a-8 vs. Ensembl Nematostella
Match: EDO48274 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJJ5])

HSP 1 Score: 89.3521 bits (220), Expect = 1.139e-20
Identity = 63/203 (31.03%), Postives = 95/203 (46.80%), Query Frame = 1
Query:  301 LPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTY 909
            LP    +  Y +   L  D I GL VG+M IPQ +AYA +AGL  +YGLY +F    +Y  FGTS+ +S+G  AI+SL+  ++   S  D               E+  F                            AF  G++Q  MG F  GFL +++S P+ISGFT  A++ +   Q+K   GL   ++  ++ +  T+
Sbjct:    1 LPITKWLPHYSFNN-LQCDMIGGLTVGLMVIPQGLAYATIAGLPTVYGLYSAFMGCFIYCIFGTSKDVSLGPTAIMSLIVNQYCHYSEED---------------EDTRF------------------------AIALAFFSGLIQFAMGFFRFGFLVRFISVPVISGFTSAAAITIAAGQLKSILGLQHIRREFIYCVYDTF 163          
BLAST of slc26a-8 vs. Ensembl Nematostella
Match: EDO34158 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQ57])

HSP 1 Score: 76.2554 bits (186), Expect = 5.415e-17
Identity = 38/90 (42.22%), Postives = 57/90 (63.33%), Query Frame = 1
Query:  262 VNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIIS 531
            ++ + +K+  +++ P    + KY    +L  D IAGL VG+M +PQ +AYA +AGL P YGLY +F    VY  FGTS+ I++G  AI+S
Sbjct:    3 IDLEAIKKYTKKRFPIAKWLSKYNL-HFLQCDLIAGLTVGLMVVPQGLAYALVAGLPPQYGLYSAFMGCFVYCVFGTSKDITLGPTAIMS 91          
BLAST of slc26a-8 vs. Ensembl Medaka
Match: slc26a10 (solute carrier family 26 member 10 [Source:NCBI gene;Acc:101171246])

HSP 1 Score: 399.053 bits (1024), Expect = 5.686e-128
Identity = 239/720 (33.19%), Postives = 394/720 (54.72%), Query Frame = 1
Query:  139 ISIKRPIYTQHEFDLNHGGNYIKKSWKR---KFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENV 2286
            +++ R I+T+  F   +G         R   +   + R +++ +++       +RE++P    + +YK R+W+L D IAGL VGI+HIPQ MA+A L  + PI+GLY SFFPV++Y  FGT  H+S GT A++SL+TG  +E+ L+  P+++ ++S      E   F                 E  +    +  A L G+  + M   +LGFL+ YLS+P++  F   A+ HV  SQ++   GL +P+  G F+  KT   + +NLP TN   L++++V + VL   KE IN R   ++R PIP+E++ VII T V     L+  + + IVG+I  G P P LP +N F     D     ++ +++ +SLA +++ KHGY I  NQEL+A+GI N V++FF C+PS+++L+ + + ES GG TQL  L +S ++L VLL IGP+F+ LP  +L+ I + +L+ M +QF +L ELW  S  DF  W+V +L    ++V+ GL IG+ FS++ I+ RTQ     +LG+   T++Y+ +E +N+           C E+ G+KI  Y G +YY     F+  +   +   P  I+ R    +   K+  +               + +    +      +  ++IDCS+  +ID  G +   Q+  + ++I ++V LAN   +V   +  +   S ++ + IFV+VHDAV   + ++K ENV
Sbjct:    5 VAVYRDIFTEDRFKQAYGSEEDTGGGVRLRDRLAGRCRCSREAFLH------LLRERVPIFRWLPRYKLRKWILGDTIAGLTVGILHIPQGMAFALLTSVAPIFGLYTSFFPVVLYMIFGTGHHVSTGTFAVVSLMTGSVVEQ-LVPTPLEMNSSS-----PEAAGF-----------------EAQRIGVASAVALLSGIFMICMFALHLGFLSTYLSEPIVKAFISAAAFHVTISQLQSMLGLRLPRHTGNFSFFKTLVSVMENLPHTNTAELIISLVSLAVLVPVKE-INVRFRHRLRTPIPVEILTVIIATCVVYASSLDSIYNIEIVGDIPAGFPRPQLPAINTFPAIAGDTVAITLVGYALSVSLAMIYADKHGYSIQPNQELLAHGISNAVSAFFTCFPSSATLATTNILESAGGHTQLCGLFTSLVVLVVLLLIGPLFYFLPKAVLACINVTSLRQMLLQFQDLPELWRISKLDFMVWIVTWLSVVVLNVDLGLAIGVVFSMMTIICRTQRVACSVLGRASNTEIYRPLENHNK-----------CYEVPGVKILTYNGPIYYGNRSFFREQMSKLLGLTPEKIRRREKAKKALEKQESETVICTVERGIANTSFSSVSDFFKSASESDLEAVLIDCSSVIFIDVAGARLFTQMCTQCQNIGVSVYLANCNENVLKIMTSSGLMSHMNPQHIFVTVHDAV-TYIQQQKTENV 682          
BLAST of slc26a-8 vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 375.555 bits (963), Expect = 3.074e-118
Identity = 215/559 (38.46%), Postives = 328/559 (58.68%), Query Frame = 1
Query:  205 KKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            K +W  K     +  +    +   +K  +   +P +S + KY +RE +L D ++G  VGIMH+PQ MAYA LA L+P+YGLY S FPV+VY  FGTSRH+SIGT A+IS++ G   E+                  +E   F  +N SL ++ +     +  +         L G+ Q+++G+   GF+  YLS+PL+ G+T GA+ HV  SQ+KY FG+   +  G F++  T   I + LP+T +P LV+++V + VL V KE IN    KK+ +P+P+ELIVVI  T++  +  + E++ + +VGEI  GL AP  PD+  FS  + D    AI+++++ ISL K F+ K+GY++D+NQELIA G+ N + SFF CY   +SLSRS VQES GG TQ+  +VSS L+L +++ IG +F  LP  +LS I+ V LKGMF QF ++  LW  +  D   W+V F+ T   +++ GL + +GFS+L  + +TQ P   ILG +  TDLY + E + +            +EI GIKIFR   ++ +  ++ +  +L  +
Sbjct:   30 KGTWSIKPTVGEKLKESLRCSVPSLKHILLTWIPILSWLPKYSFRENILGDVVSGCSVGIMHLPQGMAYALLASLRPVYGLYTSLFPVLVYVVFGTSRHVSIGTFAVISIMVGSVTER---------------LAPDEAFYFNGTNGSLTVNIDAR---DAYRVQMACSVTLLSGIFQILLGVVRFGFVATYLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIYTIVDICRLLPQTRVPELVVSLVALAVLIVVKE-INACYSKKLPLPVPIELIVVIGATIIIHFCGVREDYLIDVVGEIPSGLKAPRTPDVTFFSQLIGDAIAVAIVSYAITISLGKTFALKYGYKVDSNQELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGNVPSTDLYLDTEAFKQV-----------KEIPGIKIFRSSATICFTNAELYLEALQQR 558          
BLAST of slc26a-8 vs. Ensembl Medaka
Match: si:ch211-117c9.2 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101162048])

HSP 1 Score: 375.17 bits (962), Expect = 6.462e-118
Identity = 215/559 (38.46%), Postives = 328/559 (58.68%), Query Frame = 1
Query:  205 KKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            K +W  K     +  +    +   +K  +   +P +S + KY +RE +L D ++G  VGIMH+PQ MAYA LA L+P+YGLY S FPV+VY  FGTSRH+SIGT A+IS++ G   E+                  +E   F  +N SL ++ +     +  +         L G+ Q+++G+   GF+  YLS+PL+ G+T GA+ HV  SQ+KY FG+   +  G F++  T   I + LP+T +P LV+++V + VL V KE IN    KK+ +P+P+ELIVVI  T++  +  + E++ + +VGEI  GL AP  PD+  FS  + D    AI+++++ ISL K F+ K+GY++D+NQELIA G+ N + SFF CY   +SLSRS VQES GG TQ+  +VSS L+L +++ IG +F  LP  +LS I+ V LKGMF QF ++  LW  +  D   W+V F+ T   +++ GL + +GFS+L  + +TQ P   ILG +  TDLY + E + +            +EI GIKIFR   ++ +  ++ +  +L  +
Sbjct:   29 KGTWSIKPTVGEKLKESLRCSVPSLKHILLTWIPILSWLPKYSFRENILGDVVSGCSVGIMHLPQGMAYALLASLRPVYGLYTSLFPVLVYVVFGTSRHVSIGTFAVISIMVGSVTER---------------LAPDEAFYFNGTNGSLTVNIDAR---DAYRVQMACSVTLLSGIFQILLGVVRFGFVATYLSEPLVRGYTTGAACHVCVSQLKYLFGVKPARFTGPFSLIYTIVDICRLLPQTRVPELVVSLVALAVLIVVKE-INACYSKKLPLPVPIELIVVIGATIIIHFCGVREDYLIDVVGEIPSGLKAPRTPDVTFFSQLIGDAIAVAIVSYAITISLGKTFALKYGYKVDSNQELIAVGLSNTIGSFFQCYAVTASLSRSLVQESTGGNTQIAGVVSSLLMLIMVIRIGSLFEDLPKAVLSTIVFVNLKGMFRQFMDVPLLWKTNKVDLLVWLVTFISTVLFNLDLGLALSVGFSMLTFIFKTQLPHYSILGNVPSTDLYLDTEAFKQV-----------KEIPGIKIFRSSATICFTNAELYLEALQQR 557          
BLAST of slc26a-8 vs. Ensembl Medaka
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101169607])

HSP 1 Score: 367.851 bits (943), Expect = 4.148e-116
Identity = 216/584 (36.99%), Postives = 353/584 (60.45%), Query Frame = 1
Query:  145 IKRPIYTQHEFD-LNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYN 1893
            ++R I  + E D L H     K      F  +V+ + +   +   +K+ +   +P +S + +Y ++E+ + D I+G+ VGIM +PQ MAYA LA + PI+GLY SF+PV++YF FGTS+HIS+GT A++S++ G   E+        +A +S  F+  +N++  +  D++    E  ++         A   F+ G+ Q+++G+   GF+  YLS+PL+ G+T  A++HV  SQ+KY FG++  +  G  ++  T   I   LPKTNI TLV+T+V I+ LF+ KE +N  + KKI VPIP ELI +II T+VS  + L+  + + +VGEI  GL  P  PD+  F+  + D F  +++ + + ISL ++F+ K+GY++D+NQEL+A G+ N +   F C+  + S+SRS VQES GGKTQ+   +S+ ++LF+ L+IG +F  LP  +L+AII V L+GM  QF ++  LW  S  D   W+  F+ T  ++ + GL   I FS+L ++ RTQ PK  ILG+++ TD+YK ++ Y++            +E+ GI IFR   +LY+A ++ ++ +L  K  ++
Sbjct:   11 VQRQILDEGEVDELAH-----KDDSHFPFSERVKKSVR--CSGPRLKKALFSTIPILSWLPRYPFKEYAVGDLISGISVGIMQLPQGMAYALLASVPPIFGLYSSFYPVLIYFIFGTSKHISLGTYAVMSVMIGGVTER--------LAPDS-DFMTWDNVTNATLIDTVARDAERVRVA--------AAVTFMSGIFQILLGVVQFGFVVTYLSEPLVRGYTTAAAIHVIVSQLKYSFGISPDRYSGPLSLIYTVIEICYLLPKTNIGTLVVTLVAILGLFLAKE-LNAYLSKKIPVPIPTELIAIIIATIVSWQVDLSGKYGIDVVGEIPSGLQPPVFPDVKLFAPVIGDAFALSVVGYGIAISLGRIFALKYGYKVDSNQELVALGLSNSIGGIFQCFAISCSMSRSLVQESSGGKTQVAGALSAVVILFITLWIGTLFEDLPKAVLAAIIHVNLQGMLKQFMDIFALWKSSKIDMMIWIATFILTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSILGRVEDTDIYKPLDGYSK-----------VKELPGILIFRSSATLYFANAEMYQEALGKKEQHD 558          
BLAST of slc26a-8 vs. Ensembl Medaka
Match: slc26a6 (solute carrier family 26 member 6 [Source:NCBI gene;Acc:101169607])

HSP 1 Score: 367.081 bits (941), Expect = 1.953e-115
Identity = 216/580 (37.24%), Postives = 351/580 (60.52%), Query Frame = 1
Query:  145 IKRPIYTQHEFD-LNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNK 1881
            ++R I  + E D L H     K      F  +V+ + +   +   +K+ +   +P +S + +Y ++E+ + D I+G+ VGIM +PQ MAYA LA + PI+GLY SF+PV++YF FGTS+HIS+GT A++S++ G   E+        +A +S  F+  +N++  +  D++    E  ++         A   F+ G+ Q+++G+   GF+  YLS+PL+ G+T  A++HV  SQ+KY FG++  +  G  ++  T   I   LPKTNI TLV+T+V I+ LF+ KE +N  + KKI VPIP ELI +II T+VS  + L+  + + +VGEI  GL  P  PD+  F+  + D F  +++ + + ISL ++F+ K+GY++D+NQEL+A G+ N +   F C+  + S+SRS VQES GGKTQ+   +S+ ++LF+ L+IG +F  LP  +L+AII V L+GM  QF ++  LW  S  D   W+  F+ T  ++ + GL   I FS+L ++ RTQ PK  ILG+++ TD+YK ++ Y++            +E+ GI IFR   +LY+A ++ ++ +L  K
Sbjct:   11 VQRQILDEGEVDELAH-----KDDSHFPFSERVKKSVR--CSGPRLKKALFSTIPILSWLPRYPFKEYAVGDLISGISVGIMQLPQGMAYALLASVPPIFGLYSSFYPVLIYFIFGTSKHISLGTYAVMSVMIGGVTER--------LAPDS-DFMTWDNVTNATLIDTVARDAERVRVA--------AAVTFMSGIFQILLGVVQFGFVVTYLSEPLVRGYTTAAAIHVIVSQLKYSFGISPDRYSGPLSLIYTVIEICYLLPKTNIGTLVVTLVAILGLFLAKE-LNAYLSKKIPVPIPTELIAIIIATIVSWQVDLSGKYGIDVVGEIPSGLQPPVFPDVKLFAPVIGDAFALSVVGYGIAISLGRIFALKYGYKVDSNQELVALGLSNSIGGIFQCFAISCSMSRSLVQESSGGKTQVAGALSAVVILFITLWIGTLFEDLPKAVLAAIIHVNLQGMLKQFMDIFALWKSSKIDMMIWIATFILTLLLNPDLGLAASIAFSMLTVIFRTQLPKYSILGRVEDTDIYKPLDGYSK-----------VKELPGILIFRSSATLYFANAEMYQEALGKK 554          
BLAST of slc26a-8 vs. Planmine SMEST
Match: SMESG000064562.1 (SMESG000064562.1)

HSP 1 Score: 1355.12 bits (3506), Expect = 0.000e+0
Identity = 757/759 (99.74%), Postives = 758/759 (99.87%), Query Frame = 1
Query:   55 MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTYHNSEPNDEC 2331
            MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSL+FLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEK QLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTYHNSEPNDEC
Sbjct:    1 MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLSFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEKAQLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTYHNSEPNDEC 759          
BLAST of slc26a-8 vs. Planmine SMEST
Match: SMESG000064562.1 (SMESG000064562.1)

HSP 1 Score: 1319.68 bits (3414), Expect = 0.000e+0
Identity = 746/759 (98.29%), Postives = 747/759 (98.42%), Query Frame = 1
Query:   55 MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTYHNSEPNDEC 2331
            MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSL+FLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNE           CEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEK QLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTYHNSEPNDEC
Sbjct:    1 MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLSFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTLVLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNE-----------CEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEKAQLETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTYHNSEPNDEC 748          
BLAST of slc26a-8 vs. Planmine SMEST
Match: SMESG000064566.1 (SMESG000064566.1)

HSP 1 Score: 702.59 bits (1812), Expect = 0.000e+0
Identity = 395/653 (60.49%), Postives = 498/653 (76.26%), Query Frame = 1
Query:  322 MKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKME 2280
            M+YKW+ WLL D IAGLIVG M IPQS AYA L G++PIYGLY +FFPV+VY+FFG+SRHISIGTIAI+SLL+G FLE+SL+DFP+    N+   + N + S  +               E +KA+RVAG    VG+ QLIMG+FNLGFLTKYLSDPLISGFTVG+++ VF++Q+KYCFG+ I K +G+F++  T   + K LP TNIPT VLT + II+L VTK  INP ++KKI  PIP+EL+VV+ GTV S+YL L+  + V +VG I QG+PAP +P ++N S Y+++I +TAIIAFSV ISL K+F+KKHGY+ID  QE IA+G+MN  +SFF CYPSA S+SRSAVQE+ GGKTQ+TSLVS  L+LFVLLFIGP+F  LPNCIL+++IIVALK M M+F ELKELWLFSIWDFS W+V FL T F+DV+YGL+ G+  SI+ I+LRTQ+P SHILGQI GTDLYKNV VY +           C EI GIKIFRYEGS+YYAC D+FK SLY KISY+P ++KLRI K+++K+KK+ Q     EN+    ++   + EL+ L +P IHH+IIDCSTWGYID VGVK L+QVIEEYK++NI+VLLANPKTDVR   +R + S +I D  IFVSVHDAVINS+Y  K++
Sbjct:    1 MRYKWKTWLLLDLIAGLIVGTMQIPQSFAYAQLVGIQPIYGLYLAFFPVMVYYFFGSSRHISIGTIAIVSLLSGSFLEQSLIDFPL----NTTKTVGNVSASVQN---------------EAIKASRVAGLTLFVGISQLIMGVFNLGFLTKYLSDPLISGFTVGSAIIVFSTQLKYCFGVTIAKYYGIFSVWNTLIAVCKQLPNTNIPTFVLTAISIILLAVTKNVINPILMKKIHFPIPIELLVVVAGTVSSQYLDLHNKYNVSVVGTIIQGVPAPVIPVIDNMSNYISNIIVTAIIAFSVSISLGKMFAKKHGYKIDATQEFIAFGLMNIFSSFFYCYPSAGSVSRSAVQEAAGGKTQITSLVSVILILFVLLFIGPLFQPLPNCILASVIIVALKSMLMKFVELKELWLFSIWDFSVWMVTFLFTIFLDVQYGLIAGVALSIISIVLRTQSPNSHILGQISGTDLYKNVAVYGD-----------CHEIPGIKIFRYEGSIYYACKDHFKKSLYTKISYDPIMVKLRIEKIQKKIKKINQSLEEMENTDLIAKRAVFQEELDSLLNPNIHHIIIDCSTWGYIDIVGVKILHQVIEEYKNVNISVLLANPKTDVRRMFYRIETSQLIHDENIFVSVHDAVINSLYNHKIQ 623          
BLAST of slc26a-8 vs. Planmine SMEST
Match: SMESG000064565.1 (SMESG000064565.1)

HSP 1 Score: 659.062 bits (1699), Expect = 0.000e+0
Identity = 370/717 (51.60%), Postives = 506/717 (70.57%), Query Frame = 1
Query:  142 SIKRPIYTQHEFDLNHGGNYIKKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLANPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVN 2289
            +I RP  +Q+EFD N+  N  + S K + +   +  ++ + ++      +  K PFI I+ KYKW+E LL D I G+IVGIMHIPQ MAY+ LAGL+P++GLY S FP ++YFFFGTS+HISIG++AI SL+T KFLEKSL+DFPI+  +N  T     N  F                 E L +NR AGFAF VG+ Q++MG  N+G LTKYLSDP+ISGFTVG+S+HVFTSQIKYCFG+ I   +G+FN+  T   + KN+ +TNIPT+ + ++ I +L  TKE INP V+ + R+P+PMEL VV+ G + S+Y  L++NHKV IVGEIS+GLP+P++PD+     YV DI IT IIAF+V +SLA +FSKKH Y I +NQE +AYG+MN  ASFF C+PSA+SLSRSAVQESVGGK+QL+SL+SS LL+FVLLFIG  F  LPNCIL++IIIVALKG+FM+ AELK+LW FS+ DFS W++ FLGT  +DVEYGL++G   SI  ++L+TQNPKS+ILGQI  TD+Y N+ +Y+E           C+EI GIKIF+YEGS+YYA  +NFK +LY KI  NP  I  +   LE KL  +++          F E+K+ +E EL++L       +IIDCS + +ID +G+KT+NQVIEEY+ INI+V L + K D+R    + ++   I+D+++++S+HDAV++ + +R++ +V 
Sbjct:   58 TITRPTLSQYEFDQNYEINTDQLSIKSQLIESSKDFQRNFCSRNNFYNFLCGKFPFIFILYKYKWKECLLEDLITGIIVGIMHIPQGMAYSQLAGLRPVHGLYVSLFPALIYFFFGTSKHISIGSMAIASLMTNKFLEKSLVDFPIQTVHNITTDYDTANNEF-----------------ERLVSNRAAGFAFFVGLTQILMGTCNMGSLTKYLSDPIISGFTVGSSVHVFTSQIKYCFGVEIQTFYGIFNVINTITEVIKNISETNIPTMSMAIICISLLIFTKEAINPYVMLRFRIPVPMELFVVVGGILASEYFSLHKNHKVLIVGEISKGLPSPTMPDIKISYNYVVDIIITGIIAFAVSVSLADIFSKKHCYSISSNQEFLAYGMMNVFASFFSCFPSAASLSRSAVQESVGGKSQLSSLISSILLVFVLLFIGQFFENLPNCILASIIIVALKGLFMKCAELKDLWRFSLMDFSIWLITFLGTVILDVEYGLLVGTMLSIFSVVLKTQNPKSYILGQIDKTDIYCNISLYSE-----------CKEILGIKIFQYEGSVYYASCENFKKNLYQKIGLNPIEIFFKKRSLENKLATIQKKFEKENQMPDFMEKKSTIEEELDQLNKSTEFSIIIDCSNFQFIDAMGMKTINQVIEEYQIINISVFLTSLKYDIRKKFHQFNSPCHINDKMVYLSIHDAVVSILRQRRVTDVQ 746          
BLAST of slc26a-8 vs. Planmine SMEST
Match: SMESG000064571.1 (SMESG000064571.1)

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 352/621 (56.68%), Postives = 453/621 (72.95%), Query Frame = 1
Query:  250 KKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLADFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHISIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLRLSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISGFTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNXXXXXXXXXXXXXXXXXKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNENHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLFSKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQLTXXXXXXXXXXXXXXIGPVFHTLPNCILSAIIIVALKGMFMQFAELKELWLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHILGQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSDNFKSSLYNKISYNPXXXXXXXXXXXXXXXXXXQHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCSTWGYIDYVGVKTLNQV 2112
            K +Y N +G+KR    K PFI I+M+YKW+ WLL D IAGLIVG M IPQS AYA L G+KPIYGLY +FFPV+VY+FFG+S+HISIGT+AI+SLLTG FLE++L+DFP+    N              SN S  +  E       +KA+RVAG    VG+ QLIMG+FN+GFLTKYLSDPLISGFTVG+++ VF++Q+KYCFG+ I K +G+F++  T   + K LP TN+PT+VLT + II+L VTK  +NP ++KKI  PIP+EL++++ GTV S +L L++ + V IVG I QG+PAP +P + N + Y+ +I +TAII FSV ISL K+F+KKHGY++D  QE IA+G+MN  +SFF CYPS +S+SRSAVQES GGKTQ+TSLVS+ L+LFVLLFIGP+F  LPNC+L+++IIVALK M M+F ELKELWLFSIWDF                YGL+ G+  SI+ I+LRTQ+P S+ILGQI GTDLYKNV VY +           C EI GIKIFRYEGSLYYAC D+FK SLY KISY+P ++KLRI K+++K+KK+ Q     EN+    ++   + EL+ L +P IHH+IIDCSTWGYID VGVK L+QV
Sbjct:    6 KGKYWNSEGVKRFFLGKFPFIPILMRYKWKNWLLLDLIAGLIVGTMQIPQSFAYAQLVGIKPIYGLYLAFFPVLVYYFFGSSKHISIGTVAIVSLLTGNFLEQTLIDFPLSKHTNF-------------SNVSASVQNEA------IKASRVAGLTLFVGISQLIMGVFNIGFLTKYLSDPLISGFTVGSAIIVFSTQLKYCFGVTIQKYYGIFSVWNTIIAVCKELPHTNVPTMVLTAISIIILAVTKNVVNPILMKKIHFPIPVELLLIVTGTVSSHFLRLHDKYNVSIVGNIDQGVPAPVIPVIKNMTNYIPNIIVTAIIGFSVSISLGKMFAKKHGYKVDATQEFIAFGLMNIFSSFFYCYPSGASVSRSAVQESAGGKTQITSLVSAVLILFVLLFIGPLFKQLPNCLLASVIIVALKSMLMKFVELKELWLFSIWDF----------------YGLIAGVALSIISIVLRTQSPNSYILGQISGTDLYKNVAVYTD-----------CHEIPGIKIFRYEGSLYYACGDHFKKSLYTKISYDPIMVKLRIQKVQKKIKKINQSLEEMENTELIVQRAVFQKELDALLNPDIHHIIIDCSTWGYIDIVGVKILHQV 580          
The following BLAST results are available for this feature:
BLAST of slc26a-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC26A21.750e-11635.06solute carrier family 26 member 2 [Source:HGNC Sym... [more]
SLC26A51.371e-11235.32solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A57.529e-11235.32solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A57.529e-11235.32solute carrier family 26 member 5 [Source:HGNC Sym... [more]
SLC26A51.034e-11135.32solute carrier family 26 member 5 [Source:HGNC Sym... [more]
back to top
BLAST of slc26a-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sulp-81.623e-10838.67Anion transporter SULP-8a; Anion transporter SULP-... [more]
sulp-81.623e-10838.67Anion transporter SULP-8a; Anion transporter SULP-... [more]
sulp-81.623e-10838.67Anion transporter SULP-8a; Anion transporter SULP-... [more]
sulp-85.983e-9940.28Anion transporter SULP-8a; Anion transporter SULP-... [more]
sulp-71.020e-9535.52Anion transporter SULP-7a; SULfate Permease family... [more]
back to top
BLAST of slc26a-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prestin1.791e-9537.70gene:FBgn0036770 transcript:FBtr0075153[more]
Esp1.965e-4428.04gene:FBgn0013953 transcript:FBtr0304054[more]
Esp1.965e-4428.04gene:FBgn0013953 transcript:FBtr0084703[more]
CG61259.193e-4329.55gene:FBgn0038337 transcript:FBtr0346109[more]
CG61259.193e-4329.55gene:FBgn0038337 transcript:FBtr0083105[more]
back to top
BLAST of slc26a-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a101.367e-12934.36solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
slc26a61.819e-12139.12solute carrier family 26 member 6 [Source:ZFIN;Acc... [more]
slc26a64.298e-12139.12solute carrier family 26 member 6 [Source:ZFIN;Acc... [more]
slc26a101.144e-11832.96solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
slc26a101.144e-11832.96solute carrier family 26 member 10 [Source:ZFIN;Ac... [more]
back to top
BLAST of slc26a-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC26A57.256e-12838.98solute carrier family 26 member 5 [Source:NCBI gen... [more]
SLC26A58.919e-12740.55solute carrier family 26 member 5 [Source:NCBI gen... [more]
SLC26A51.642e-12640.55solute carrier family 26 member 5 [Source:NCBI gen... [more]
SLC26A59.096e-12640.55solute carrier family 26 member 5 [Source:NCBI gen... [more]
SLC26A53.552e-12541.29solute carrier family 26 member 5 [Source:NCBI gen... [more]
back to top
BLAST of slc26a-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc26a52.199e-11435.84solute carrier family 26, member 5 [Source:MGI Sym... [more]
Slc26a63.402e-11135.45solute carrier family 26, member 6 [Source:MGI Sym... [more]
Slc26a63.402e-11135.45solute carrier family 26, member 6 [Source:MGI Sym... [more]
Slc26a63.402e-11135.45solute carrier family 26, member 6 [Source:MGI Sym... [more]
Slc26a63.402e-11135.45solute carrier family 26, member 6 [Source:MGI Sym... [more]
back to top
BLAST of slc26a-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q65AC2|S26A2_HORSE6.721e-11735.28Sulfate transporter OS=Equus caballus OX=9796 GN=S... [more]
sp|P50443|S26A2_HUMAN8.406e-11635.06Sulfate transporter OS=Homo sapiens OX=9606 GN=SLC... [more]
sp|Q99NH7|S26A5_MOUSE1.538e-11335.84Prestin OS=Mus musculus OX=10090 GN=Slc26a5 PE=2 S... [more]
sp|Q9EPH0|S26A5_RAT3.018e-11335.84Prestin OS=Rattus norvegicus OX=10116 GN=Slc26a5 P... [more]
sp|Q9JKQ2|S26A5_MERUN7.622e-11335.67Prestin OS=Meriones unguiculatus OX=10047 GN=SLC26... [more]
back to top
BLAST of slc26a-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFH10.000e+0100.00Slc26a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YKD10.000e+061.28Slc26a-4 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1I8J1Y02.068e-17749.10STAS domain-containing protein OS=Macrostomum lign... [more]
A0A267DPA42.225e-17749.10STAS domain-containing protein OS=Macrostomum lign... [more]
A0A267ECE92.450e-17748.94STAS domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of slc26a-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a103.125e-12734.62solute carrier family 26 member 10 [Source:NCBI ge... [more]
slc26a56.865e-11838.23solute carrier family 26 member 5 [Source:NCBI gen... [more]
slc26a6l1.009e-11738.50solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a61.485e-11037.34solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a3.22.479e-10935.92solute carrier family 26 member 3, tandem duplicat... [more]
back to top
BLAST of slc26a-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003427.13.391e-12034.68pep scaffold:Pmarinus_7.0:GL476526:256569:262630:-... [more]
si:ch211-117c9.24.297e-7937.78si:ch211-117c9.2 [Source:ZFIN;Acc:ZDB-GENE-110408-... [more]
ENSPMAT00000003699.14.962e-6047.58pep scaffold:Pmarinus_7.0:GL480994:8326:18126:1 ge... [more]
slc26a116.043e-3629.48solute carrier family 26 member 11 [Source:ZFIN;Ac... [more]
ENSPMAT00000006617.17.798e-2232.45pep scaffold:Pmarinus_7.0:GL482475:5949:18084:-1 g... [more]
back to top
BLAST of slc26a-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SUL11.024e-3925.56High affinity sulfate permease of the SulP anion t... [more]
SUL22.010e-3725.68High affinity sulfate permease; sulfate uptake is ... [more]
YPR003C_mRNA6.408e-2524.59Putative sulfate permease; physically interacts wi... [more]
back to top
BLAST of slc26a-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO496912.642e-10032.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482755.690e-5129.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482741.139e-2031.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341585.415e-1742.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc26a-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc26a105.686e-12833.19solute carrier family 26 member 10 [Source:NCBI ge... [more]
si:ch211-117c9.23.074e-11838.46solute carrier family 26 member 6 [Source:NCBI gen... [more]
si:ch211-117c9.26.462e-11838.46solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a64.148e-11636.99solute carrier family 26 member 6 [Source:NCBI gen... [more]
slc26a61.953e-11537.24solute carrier family 26 member 6 [Source:NCBI gen... [more]
back to top
BLAST of slc26a-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064562.10.000e+099.74SMESG000064562.1[more]
SMESG000064562.10.000e+098.29SMESG000064562.1[more]
SMESG000064566.10.000e+060.49SMESG000064566.1[more]
SMESG000064565.10.000e+051.60SMESG000064565.1[more]
SMESG000064571.10.000e+056.68SMESG000064571.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026350
GenBankAKN21612.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026350 ID=SMED30026350|Name=slc26a-8|organism=Schmidtea mediterranea sexual|type=transcript|length=2426bp
ATTTAAGATCAATCATGATAATTGCTTTGCAGAAATTATACAATTTTATT
TTCGATGGATGAATTCAAAGATTCGACAGATGTGGGTTTCCTCTTGGAAG
GGAGTGATCTGCATATTAACAAGACGAGTGTAAATGTCATTTCCATTAAA
CGACCAATTTATACTCAACATGAGTTCGATTTAAATCATGGTGGAAATTA
TATTAAAAAATCTTGGAAAAGAAAGTTTATGAGTAAGGTGCGAAGTACGA
AAAAAGAATATGTCAATAAGCAAGGAATGAAAAGATGTATCAGAGAAAAG
TTGCCATTTATTTCAATTATGATGAAATACAAATGGAGGGAATGGTTACT
CGCTGACTTTATTGCCGGATTAATCGTCGGGATTATGCATATTCCCCAAA
GTATGGCATACGCTCACTTGGCTGGTTTGAAGCCAATATATGGTTTATAT
GGCTCTTTTTTCCCGGTGATTGTGTACTTCTTTTTCGGTACCTCAAGGCA
CATTTCCATCGGAACAATTGCGATTATTAGTTTATTAACGGGAAAATTTC
TTGAAAAATCTTTATTAGATTTTCCAATTAAAATCGCGAATAATTCTCTA
ACTTTTCTTGCCAATGAAAACATTTCCTTTTTATCTTCAAATGATTCTCT
CAGATTATCTCAAGAAACTTCAAAAATAACAGAATTGCTCAAAGCAAACC
GGGTAGCGGGTTTTGCATTTCTTGTTGGTGTAGTTCAGCTCATAATGGGC
ATATTTAACCTTGGATTTTTGACAAAATATCTATCCGATCCACTGATTTC
TGGATTTACTGTTGGTGCATCCATGCATGTTTTTACAAGCCAAATCAAAT
ATTGCTTCGGGTTGAACATTCCAAAACAATTTGGAGTGTTCAATATTGCA
AAGACATATTTCTATATTGCTAAAAACCTCCCAAAAACAAACATTCCAAC
ACTTGTTTTAACTGTCGTAGTTATTATTGTGCTTTTCGTAACCAAAGAAT
GGATTAATCCTAGAGTAGTAAAAAAAATACGGGTACCCATACCAATGGAG
TTGATAGTGGTAATAATTGGAACAGTTGTCTCAAAATATTTACTGCTAAA
TGAAAACCATAAAGTGAGAATTGTTGGAGAAATATCTCAAGGATTACCAG
CCCCTTCTCTACCTGACCTCAACAACTTCTCTATGTACGTGGCCGACATT
TTTATAACTGCGATCATTGCATTTTCTGTGGGAATTTCACTTGCCAAATT
ATTTAGTAAAAAACATGGTTATGAAATTGATACAAACCAGGAATTAATTG
CTTATGGAATTATGAATTTCGTTGCATCGTTTTTCCTCTGTTATCCTTCT
GCGTCCTCACTCAGTCGATCTGCAGTTCAAGAGTCTGTCGGTGGAAAGAC
TCAATTAACGTCTCTTGTATCATCATTTCTGTTATTATTTGTTTTGCTTT
TCATAGGGCCAGTGTTCCATACATTACCAAATTGTATTCTTTCCGCCATA
ATAATTGTTGCTTTGAAAGGAATGTTCATGCAATTCGCAGAATTGAAAGA
ACTTTGGTTATTCTCAATATGGGACTTTTCAACATGGGTGGTTGCTTTTC
TTGGCACAGCATTTATCGATGTGGAATACGGATTAATGATAGGAATAGGA
TTTTCTATTTTGATGATAATGCTAAGAACTCAAAATCCGAAGTCCCATAT
CCTTGGTCAAATTAAAGGCACAGACTTGTATAAGAACGTTGAAGTTTACA
ATGAATTTATGGAAAGCAATTGCAATTGTCATTTCACATGCGAAGAAATC
GACGGTATCAAGATTTTCAGATATGAAGGCAGTCTGTACTATGCTTGTAG
TGACAATTTCAAAAGCAGCCTTTATAACAAAATATCCTACAACCCAAGAT
TGATTAAACTAAGAATTCTCAAATTGGAGCGAAAATTGAAAAAGTTAAAA
CAACACAATAATAATTTTGAAAACAGCCCGTTTTTTGAAGAGAAAACCCA
ATTGGAAACCGAACTAGAAAAACTCAAACATCCTATTATTCATCATCTTA
TAATAGATTGTTCGACCTGGGGTTACATAGATTATGTTGGCGTCAAAACG
CTCAATCAGGTGATTGAAGAATACAAAAGTATTAATATTACTGTTCTTCT
GGCCAATCCAAAAACTGATGTCCGAGCCACCATATTCCGGAATGACGCTA
GCAGTATAATAGACGACCGCATCATATTTGTCTCCGTTCACGATGCCGTT
ATCAACAGTGTGTATGAACGCAAAATGGAAAACGTAAACAGCAATGGAAC
TTATCACAATTCAGAACCAAACGACGAATGCTAACTATGTTTTATGTTCT
ATATTGCAAAATATTTTTGGTGAATTGTTTTACTGATTAAAATGGAAATT
CATAGAATGGTGTTTTAATGACATTT
back to top

protein sequence of SMED30026350-orf-1

>SMED30026350-orf-1 ID=SMED30026350-orf-1|Name=SMED30026350-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=760bp
MDEFKDSTDVGFLLEGSDLHINKTSVNVISIKRPIYTQHEFDLNHGGNYI
KKSWKRKFMSKVRSTKKEYVNKQGMKRCIREKLPFISIMMKYKWREWLLA
DFIAGLIVGIMHIPQSMAYAHLAGLKPIYGLYGSFFPVIVYFFFGTSRHI
SIGTIAIISLLTGKFLEKSLLDFPIKIANNSLTFLANENISFLSSNDSLR
LSQETSKITELLKANRVAGFAFLVGVVQLIMGIFNLGFLTKYLSDPLISG
FTVGASMHVFTSQIKYCFGLNIPKQFGVFNIAKTYFYIAKNLPKTNIPTL
VLTVVVIIVLFVTKEWINPRVVKKIRVPIPMELIVVIIGTVVSKYLLLNE
NHKVRIVGEISQGLPAPSLPDLNNFSMYVADIFITAIIAFSVGISLAKLF
SKKHGYEIDTNQELIAYGIMNFVASFFLCYPSASSLSRSAVQESVGGKTQ
LTSLVSSFLLLFVLLFIGPVFHTLPNCILSAIIIVALKGMFMQFAELKEL
WLFSIWDFSTWVVAFLGTAFIDVEYGLMIGIGFSILMIMLRTQNPKSHIL
GQIKGTDLYKNVEVYNEFMESNCNCHFTCEEIDGIKIFRYEGSLYYACSD
NFKSSLYNKISYNPRLIKLRILKLERKLKKLKQHNNNFENSPFFEEKTQL
ETELEKLKHPIIHHLIIDCSTWGYIDYVGVKTLNQVIEEYKSINITVLLA
NPKTDVRATIFRNDASSIIDDRIIFVSVHDAVINSVYERKMENVNSNGTY
HNSEPNDEC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001902SLC26A/SulP_fam
IPR036513STAS_dom_sf
IPR002645STAS_dom
IPR011547SLC26A/SulP_dom
IPR018045S04_transporter_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0015116sulfate transmembrane transporter activity
GO:0008271secondary active sulfate transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0008272sulfate transport
GO:0006810transport
GO:0055085transmembrane transport
GO:1902358sulfate transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 621..641
NoneNo IPR availablePANTHERPTHR11814:SF185SOLUTE CARRIER FAMILY 26, MEMBER 10coord: 31..741
NoneNo IPR availableCDDcd07042STAS_SulP_like_sulfate_transportercoord: 576..728
e-value: 7.83884E-18
score: 77.667
NoneNo IPR availableTMHMMTMhelixcoord: 379..401
NoneNo IPR availableTMHMMTMhelixcoord: 414..436
NoneNo IPR availableTMHMMTMhelixcoord: 477..494
NoneNo IPR availableTMHMMTMhelixcoord: 514..536
NoneNo IPR availableTMHMMTMhelixcoord: 325..347
NoneNo IPR availableTMHMMTMhelixcoord: 295..312
NoneNo IPR availableTMHMMTMhelixcoord: 96..113
NoneNo IPR availableTMHMMTMhelixcoord: 451..470
NoneNo IPR availableTMHMMTMhelixcoord: 128..145
NoneNo IPR availableTMHMMTMhelixcoord: 217..239
IPR001902SLC26A/SulP transporterTIGRFAMTIGR00815TIGR00815coord: 84..731
e-value: 1.0E-155
score: 517.3
IPR001902SLC26A/SulP transporterPANTHERPTHR11814SULFATE TRANSPORTERcoord: 31..741
IPR002645STAS domainPFAMPF01740STAScoord: 579..731
e-value: 1.1E-24
score: 86.3
IPR002645STAS domainPROSITEPS50801STAScoord: 575..735
score: 18.87
IPR011547SLC26A/SulP transporter domainPFAMPF00916Sulfate_transpcoord: 98..514
e-value: 8.8E-114
score: 380.2
IPR018045Sulphate anion transporter, conserved sitePROSITEPS01130SLC26Acoord: 127..148
IPR036513STAS domain superfamilySUPERFAMILYSSF52091SpoIIaa-likecoord: 576..732