CCHC-type domain-containing protein

Overview
NameCCHC-type domain-containing protein
Smed IDSMED30026346
Length (bp)2939
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CCHC-type domain-containing protein (SMED30026346) t-SNE clustered cells

Violin plots show distribution of expression levels for CCHC-type domain-containing protein (SMED30026346) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026346

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30026346 SmedASXL_005248SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026346 dd_Smed_v4_17809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026346 dd_Smed_v4_17809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026346 dd_Smed_v4_17809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026346 dd_Smed_v4_17809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026346 dd_Smed_v4_17809_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A5S6Q1P2 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 7.640e-50
Identity = 44/114 (38.60%), Postives = 70/114 (61.40%), Query Frame = 2
Query: 1505 VLSKEIEEMVEMG*RCVAIDLKSAYLQIRVAESL*AFEVVKLQRKTFALTRLGFGLNVAPKIMTTVLKHVLSMDAGICKGMDAYINDKFVNTSLVSAESVVKHL*KFELDAKNP 1846
            V + ++ +    G     +DLK AYLQ+RV E+L  ++ V+ + + + LTRLGFGLNVAP ++  +L  VLS D  I +G  AY++D  VN  ++ A  V + L ++ L+ K+P
Sbjct:  791 VCADKLRQWRRQGANVAMVDLKDAYLQVRVNEALWPYQTVEFRGRRYCLTRLGFGLNVAPLVLKAILNFVLSQDPAIKRGTSAYVDDILVNEDVIPASRVKEELERYGLECKSP 904          

HSP 2 Score: 85.5001 bits (210), Expect = 7.640e-50
Identity = 55/211 (26.07%), Postives = 92/211 (43.60%), Query Frame = 1
Query: 2056 WDQELDTMTVA-IMRKITDKV*KQDPVEGEWNVKNTDSAIFWCDASSLAYGVVV*IGT----------------------------------------------------VRERVNGNMDLILS-YHMDHYFGVNRTLFSARKMDLLVSKSSIKEIVGQCKTSKRVYSLPIKSSKGKSSVTEVWQRLAVDTTHYLNSVFWSIIDCGPSRFS 2526
            WD+ +D  T+  ++++I  +V + DP  G WNV   D A  W DAS +A GV + +G                                                     + + + G   LI + +H   + GV RT +  R+ D  +++S ++ +V +C+  + +   P K  +G   V  VWQR+A+D TH  +    ++IDCGPSRF+
Sbjct:  980 WDEPIDDGTIGPLLKEIAARVKEHDPARGIWNVSG-DRARIWVDASGVALGVALEVGGAIVEDASWLRRDDAQHINMAELDAVIRGLNLAIAWKMTIIELMTDSSTVYRWIADGLTGAKRLITAVHHAAGHPGVRRTSYFVRRADPTLNRSLVRRVVSECQVCQSIDPPPAKWERGSLEVPRVWQRVAIDITHCGSRPVLTLIDCGPSRFA 1189          

HSP 3 Score: 65.4698 bits (158), Expect = 7.640e-50
Identity = 32/93 (34.41%), Postives = 51/93 (54.84%), Query Frame = 1
Query: 1240 TVKWDWIDS-APETKKPSISQYKVSHKAENEFNEAVENWIKNGWLQTYS----GEIKAVLPLLAVIQQNKAKVRPVLDYGKINEHVSSHNAQA 1503
            +  W W     P   K S+ +Y  S  A   + + +E WI+  WL  Y     G +K ++PL+AV+Q++K KVRPV+D+ ++N H+    A A
Sbjct:  697 SAAWKWTGGEGPAVLKNSVKEYSPSAWARASYEKELEKWIQKAWLVPYDCRRYGPVKGLIPLMAVVQRHKQKVRPVMDFRELNAHIEPFTAAA 789          

HSP 4 Score: 25.7942 bits (55), Expect = 7.640e-50
Identity = 11/33 (33.33%), Postives = 22/33 (66.67%), Query Frame = 3
Query: 1944 EITKRQLLSWAGQMIEHFPV-EVV*SSCSFVKR 2039
            E+T+R + ++ G+++ H PV   +  + +FVKR
Sbjct:  939 ELTRRAVFAYCGELVGHLPVCGWLRVAAAFVKR 971          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A085NTN9 (Uncharacterized protein OS=Trichuris suis OX=68888 GN=M514_14739 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 4.754e-44
Identity = 52/119 (43.70%), Postives = 74/119 (62.18%), Query Frame = 2
Query: 1490 TMRKRVLSKEIEEMVEMG*RCVAIDLKSAYLQIRVAESL*AFEVVKLQRKTFALTRLGFGLNVAPKIMTTVLKHVLSMDAGICKGMDAYINDKFVNTSLVSAESVVKHL*KFELDAKNP 1846
            T +  V ++ + E    G     +DL+ AYLQ+ V  +L  ++ V ++ + + LTRLGFGLNVAP IM  V+  VLS+D  I KG  AYI+D FVN ++VSA  V++HL K+ L  K P
Sbjct:  699 TAKSDVCAQMLREWRRQGVNVSILDLRKAYLQVCVDRTLWPYQTVVVKDRRYCLTRLGFGLNVAPMIMKAVISRVLSLDPDIQKGTSAYIDDIFVNENVVSANHVIQHLAKYGLSCKVP 817          

HSP 2 Score: 84.3445 bits (207), Expect = 4.754e-44
Identity = 39/110 (35.45%), Postives = 67/110 (60.91%), Query Frame = 1
Query: 1195 IDDKDL*ANFE--RNA*TVKWDWI-DSAPETKKPSISQYKVSHKAENEFNEAVENWIKNGWLQTYS----GEIKAVLPLLAVIQQNKAKVRPVLDYGKINEHVSSHNAQA 1503
            +D+KD  A ++   N  T  W W  D+APE  + +  ++ +       + E +E WI+NGWL  Y     G  KA++PL+AVIQ++K KVRPV+D+ ++N ++ ++ A++
Sbjct:  593 VDEKDFVATYDPATNTWTTAWKWANDAAPEVLRNTKEEFPLPEGIREAYTEELEQWIQNGWLIPYDESKFGPAKALIPLMAVIQRSKGKVRPVMDFRELNSYIDTYTAKS 702          

HSP 3 Score: 41.2022 bits (95), Expect = 4.754e-44
Identity = 21/54 (38.89%), Postives = 32/54 (59.26%), Query Frame = 1
Query: 2056 WDQE-LDTMTVAIMRKITDKV*KQDPVEGEWNVKNTDSAIFWCDASSLAYGVVV 2214
            WD+  LD      +R+I  ++   DP +G W+V +T   + W DAS+LA GVV+
Sbjct:  893 WDEPILDEQVQEHLREIAARLKVHDPAQGRWDVASTKVRL-WVDASALALGVVL 945          

HSP 4 Score: 25.0238 bits (53), Expect = 4.754e-44
Identity = 12/41 (29.27%), Postives = 26/41 (63.41%), Query Frame = 3
Query: 1947 ITKRQLLSWAGQMIEHFPV-EVV*SSCSFVKRLSGDRMGSR 2066
            +T+R + ++ G ++ H+PV   +  + +F+KR   +R+ SR
Sbjct:  853 LTRRTVFAYCGALVGHYPVCGWLRPATAFIKR-EANRVTSR 892          

HSP 5 Score: 63.929 bits (154), Expect = 2.572e-6
Identity = 28/79 (35.44%), Postives = 44/79 (55.70%), Query Frame = 1
Query: 2290 GVNRTLFSARKMDLLVSKSSIKEIVGQCKTSKRVYSLPIKSSKGKSSVTEVWQRLAVDTTHYLNSVFWSIIDCGPSRFS 2526
            GV RTL+ A++ D  VSK+    +V  C   + +   P+K   G   V    QR+++D T +    + ++IDCGPSRF+
Sbjct: 1097 GVKRTLYFAKRRDPTVSKTQKNRVVSNCHICRSIDPAPVKWRHGNHGVAGWRQRVSIDVTQFRGKAYLTLIDCGPSRFA 1175          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A085LPJ9 (Uncharacterized protein OS=Trichuris suis OX=68888 GN=M513_12253 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 7.291e-44
Identity = 52/119 (43.70%), Postives = 74/119 (62.18%), Query Frame = 2
Query: 1490 TMRKRVLSKEIEEMVEMG*RCVAIDLKSAYLQIRVAESL*AFEVVKLQRKTFALTRLGFGLNVAPKIMTTVLKHVLSMDAGICKGMDAYINDKFVNTSLVSAESVVKHL*KFELDAKNP 1846
            T +  V ++ + E    G     +DL+ AYLQ+ V  +L  ++ V ++ + + LTRLGFGLNVAP IM  V+  VLS+D  I KG  AYI+D FVN ++VSA  V++HL K+ L  K P
Sbjct:  265 TAKSDVCAQMLREWRRQGVNVSILDLRKAYLQVCVDRTLWPYQTVVVKDRRYCLTRLGFGLNVAPMIMKAVISRVLSLDPDIQKGTSAYIDDIFVNENVVSANHVIQHLAKYGLSCKVP 383          

HSP 2 Score: 80.8777 bits (198), Expect = 7.291e-44
Identity = 39/111 (35.14%), Postives = 67/111 (60.36%), Query Frame = 1
Query: 1192 NIDDKDL*ANFE--RNA*TVKWDWI-DSAPETKKPSISQYKVSHKAENEFNEAVENWIKNGWLQTYS----GEIKAVLPLLAVIQQNKAKVRPVLDYGKINEHVSSHNAQA 1503
             +D+KD  A ++   N  T  W W  D+APE  + +  ++ +       + E +E WI+NGWL  Y     G  KA++PL+AVIQ++K KVRPV+D+ ++N ++ ++ A++
Sbjct:  158 RVDEKDFVATYDPATNTWTTAWKWANDAAPEVLRNTKEEFPLPEGIREAYTEELEQWIQNGWLIPYDESKFGPAKALIPLMAVIQRSKGKVRPVMDFRELNSYIDTYTAKS 268          

HSP 3 Score: 43.8986 bits (102), Expect = 7.291e-44
Identity = 55/225 (24.44%), Postives = 102/225 (45.33%), Query Frame = 1
Query: 2056 WDQE-LDTMTVAIMRKITDKV*KQDPVEGEWNVKNTDSAIFWCDASSLAYGVVV*I-GTVRE-------------------RVNGNMDLILSYHMDHYFGVNRTLFSARKM-DLLVSKSSIK-EIVGQCKTSKRVYSL--------------PIKSSKGKS-SVTEVWQR--------------LAVDTTHYLNSVFWSIIDCGPSRFSN-QEIKY-TFVIIFDQ 2568
            WD+  LD      +R+I  ++   DP +G W+V +T   + W DAS+LA GVV+ + G V E                    V   ++L LS+ M     +  +L   R + D L  ++ +K +   +    +R+ ++               ++S++ ++ ++T V +R              +++D T +    + ++IDCGPSRF+  + +KY T V I +Q
Sbjct:  459 WDEPILDEQVQEHLREIAARLKVHDPAQGRWDVASTKVRL-WVDASALALGVVLEVNGAVIEDAAWLRSDDTQHINMAELDAVIKGLNLGLSWQMKDIELMTDSLTVHRWLNDSLSGRTRLKTKAASEMLIRRRMATILALVEEYNLNLGVTLVRSAENRADALTRVPRRWLTPTERTEVAACRVSIDVTQFRGKAYLTLIDCGPSRFAIWRPLKYHTSVDICEQ 682          

HSP 4 Score: 24.6386 bits (52), Expect = 7.291e-44
Identity = 12/41 (29.27%), Postives = 26/41 (63.41%), Query Frame = 3
Query: 1947 ITKRQLLSWAGQMIEHFPV-EVV*SSCSFVKRLSGDRMGSR 2066
            +T+R + ++ G ++ H+PV   +  + +F+KR   +R+ SR
Sbjct:  419 LTRRTVFAYCGALVGHYPVCGWLRPATAFIKR-EANRVTSR 458          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A5S6R6C8 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.063e-42
Identity = 51/112 (45.54%), Postives = 68/112 (60.71%), Query Frame = 2
Query: 1505 VLSKEIEEMVEMG*RCVAIDLKSAYLQIRVAESL*AFEVVKLQRKTFALTRLGFGLNVAPKIMTTVLKHVLSMDAGICKGMDAYINDKFVNTSLVSAESVVKHL*KFELDAK 1840
            V ++++ E  + G     +DLK AYLQI V  SL  ++ V  + + + LTRLGFGLNVAP IM  VL  VLS D+ + KG  AYI+D  VN  +V A  V +HL +F L  K
Sbjct:  487 VCAQKLREWRKQGANVSVVDLKRAYLQIHVDRSLWPYQTVMYKGRRYCLTRLGFGLNVAPLIMKAVLNCVLSQDSTVKKGTSAYIDDILVNEDVVKATRVERHLARFGLTCK 598          

HSP 2 Score: 75.8702 bits (185), Expect = 2.063e-42
Identity = 52/188 (27.66%), Postives = 87/188 (46.28%), Query Frame = 1
Query:  964 GNEINLNVLVTPKVVPACEVQLEMDVISILKGVIFRGIK-VTLANGHMRP*ICCLGVNVDTNEQGVIESRRVPNSV*NIDDKDL*A--NFERNA*TVKWDWIDS-APETKKPSISQYKVSHKAENEFNEAVENWIKNGWLQTYS----GEIKAVLPLLAVIQQNKAKVRPVLDYGKINEHVSSHNAQA 1503
            G+E  +  +VT K     E+ L M+ I+ L GV  R  + +    G+      C G  +                   ++++D  A  N    A T +W W +   P + +  + +Y  S +   ++ E +  WIKNGWL  Y     G  K ++PL+AV Q NK KVRPV+D+ ++N ++ +  A +
Sbjct:  316 GSEAAVEAIVTDKRPLGFELILGMNGIAALGGVTVRDERRINFGVGNTFAAAVCNGGEI------------------RLEERDFTAIYNPTVRAWTARWKWTNGMQPTSLRNKVREYPPSGEVREKYEEELGEWIKNGWLVPYDESKWGPAKGLIPLMAVSQDNKGKVRPVMDFRELNSYIEAFTADS 485          

HSP 3 Score: 54.6842 bits (130), Expect = 2.063e-42
Identity = 35/110 (31.82%), Postives = 57/110 (51.82%), Query Frame = 1
Query: 1909 WNRDN*IDESQERSPSDNCFHGLGK*SNIFQ----LKLFDRLVRL*NDYLVTGWDQELDTMTV-AIMRKITDKV*KQDPVEGEWNVKNTDSAIFWCDASSLAYGVVV*IG 2223
            W RD  +  + ER    + F   GK +  F     L++    ++   + + T WDQ ++   + +++ ++  KV   DPV G WNV   + A  W DASSLA+GVV+ +G
Sbjct:  623 WRRDAEVCNAPERLTRRSVFSFCGKLTGHFPVCGWLRVAAAFIKRKANEVTTSWDQVIENAELESLINEVASKVRSNDPVGGRWNVSG-EKARVWVDASSLAHGVVIEVG 731          

HSP 4 Score: 76.2554 bits (186), Expect = 3.282e-10
Identity = 32/86 (37.21%), Postives = 54/86 (62.79%), Query Frame = 1
Query: 2269 YHMDHYFGVNRTLFSARKMDLLVSKSSIKEIVGQCKTSKRVYSLPIKSSKGKSSVTEVWQRLAVDTTHYLNSVFWSIIDCGPSRFS 2526
            +H   + GV RTL+  ++++ +VSK  +++ +  C   + V   P+K  +G   V E+WQR+A+D THY    + S++DCGPSRF+
Sbjct:  873 HHKMGHPGVRRTLYFVKRINPMVSKRQVRQTIVNCDACQSVDPAPVKWKQGCLGVKEIWQRVAMDITHYRGMSYLSLVDCGPSRFA 958          
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Match: A0A5S6Q4C2 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.076e-42
Identity = 51/112 (45.54%), Postives = 68/112 (60.71%), Query Frame = 2
Query: 1505 VLSKEIEEMVEMG*RCVAIDLKSAYLQIRVAESL*AFEVVKLQRKTFALTRLGFGLNVAPKIMTTVLKHVLSMDAGICKGMDAYINDKFVNTSLVSAESVVKHL*KFELDAK 1840
            V ++++ E  + G     +DLK AYLQI V  SL  ++ V  + + + LTRLGFGLNVAP IM  VL  VLS D+ + KG  AYI+D  VN  +V A  V +HL +F L  K
Sbjct:  487 VCAQKLREWRKQGANVSVVDLKRAYLQIHVDRSLWPYQTVMYKGRRYCLTRLGFGLNVAPLIMKAVLNCVLSQDSTVKKGTSAYIDDILVNEDVVKATRVERHLARFGLTCK 598          

HSP 2 Score: 76.2554 bits (186), Expect = 2.076e-42
Identity = 52/188 (27.66%), Postives = 87/188 (46.28%), Query Frame = 1
Query:  964 GNEINLNVLVTPKVVPACEVQLEMDVISILKGVIFRGIK-VTLANGHMRP*ICCLGVNVDTNEQGVIESRRVPNSV*NIDDKDL*A--NFERNA*TVKWDWIDS-APETKKPSISQYKVSHKAENEFNEAVENWIKNGWLQTYS----GEIKAVLPLLAVIQQNKAKVRPVLDYGKINEHVSSHNAQA 1503
            G+E  +  +VT K     E+ L M+ I+ L GV  R  + +    G+      C G  +                   ++++D  A  N    A T +W W +   P + +  + +Y  S +   ++ E +  WIKNGWL  Y     G  K ++PL+AV Q NK KVRPV+D+ ++N ++ +  A +
Sbjct:  316 GSEAAVEAIVTDKRPLGFELILGMNGIAALGGVTVRDERRINFGVGNTFAAAVCNGGEI------------------RLEERDFTAIYNPTVRAWTARWKWTNGMQPTSLRNKVQEYPPSGEVREKYEEELGEWIKNGWLVPYDESKWGPAKGLIPLMAVSQDNKGKVRPVMDFRELNSYIEAFTADS 485          

HSP 3 Score: 54.6842 bits (130), Expect = 2.076e-42
Identity = 35/110 (31.82%), Postives = 57/110 (51.82%), Query Frame = 1
Query: 1909 WNRDN*IDESQERSPSDNCFHGLGK*SNIFQ----LKLFDRLVRL*NDYLVTGWDQELDTMTV-AIMRKITDKV*KQDPVEGEWNVKNTDSAIFWCDASSLAYGVVV*IG 2223
            W RD  +  + ER    + F   GK +  F     L++    ++   + + T WDQ ++   + +++ ++  KV   DPV G WNV   + A  W DASSLA+GVV+ +G
Sbjct:  623 WRRDAEVCNAPERLTRRSVFSFCGKLTGHFPVCGWLRVAAAFIKRKANEVTTSWDQVIENAELESLINEVASKVRSNDPVGGRWNVSG-EKARVWVDASSLAHGVVIEVG 731          

HSP 4 Score: 76.2554 bits (186), Expect = 3.531e-10
Identity = 32/86 (37.21%), Postives = 54/86 (62.79%), Query Frame = 1
Query: 2269 YHMDHYFGVNRTLFSARKMDLLVSKSSIKEIVGQCKTSKRVYSLPIKSSKGKSSVTEVWQRLAVDTTHYLNSVFWSIIDCGPSRFS 2526
            +H   + GV RTL+  ++++ +VSK  +++ +  C   + V   P+K  +G   V E+WQR+A+D THY    + S++DCGPSRF+
Sbjct:  873 HHKMGHPGVRRTLYFVKRINPMVSKRQVRQTIVNCDACQSVDPAPVKWKQGCLGVKEIWQRVAMDITHYRGMSYLSLVDCGPSRFA 958          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064797.1 (SMESG000064797.1)

HSP 1 Score: 201.445 bits (511), Expect = 6.913e-69
Identity = 99/133 (74.44%), Postives = 111/133 (83.46%), Query Frame = 1
Query:  964 GNEINLNVLVTPKVVPACEVQLEMDVISILKGVIFRGIKVTLANGHMRP*ICCLGVNVDTNEQGVIESRRVPNSV*NIDDKDL*ANFERNA*TVKWDWIDSAPETKKPSISQYKVSHKAENEFNEAVENWIKN 1362
            G +INLNVLVTPKV+P CEV LEMD  SIL+GVI RG KV LAN HMRP ICCL +NVDTN++GVIES+RVPNSV NI+DKD  ANF+ NA TVKW+WIDSA E  KPSISQYKV HKA+NEFNE VE+W KN
Sbjct:   49 GKDINLNVLVTPKVIPRCEVLLEMDATSILRGVIVRGTKVELANEHMRPEICCLSINVDTNKRGVIESKRVPNSVKNIEDKDFLANFDGNAWTVKWNWIDSASEALKPSISQYKVPHKAKNEFNEVVESWTKN 181          

HSP 2 Score: 80.8777 bits (198), Expect = 6.913e-69
Identity = 40/48 (83.33%), Postives = 42/48 (87.50%), Query Frame = 2
Query:  821 MSNRALWVTGCSQTMIEGYCNSRIKRNVLLVVGGKLTCYERSVSMNVM 964
            MS +AL  TGCSQTM+EGYCNS IKRNVLLV GGKLTCYERSV MNVM
Sbjct:    1 MSKQALLYTGCSQTMVEGYCNSGIKRNVLLVGGGKLTCYERSVWMNVM 48          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000076049.1 (SMESG000076049.1)

HSP 1 Score: 199.904 bits (507), Expect = 3.412e-54
Identity = 103/127 (81.10%), Postives = 113/127 (88.98%), Query Frame = 2
Query:  104 RLPKLIQVLGIYSENDESNVQEFIKKSRRAARVFGEAEVLAILPLVLTGNAYSMFDMLEDNLGGKTSLENMLLTLGKTFGKTPWMAVDELKKMQWKSNENLGVHLGNLRTLMELTAKEPDGLLTLFL 484
            R PKLIQ+LGI S++DESNVQEFIKKSRRAARVFGEAEVLAIL LVLTGNA+ MFD+L+DNLG K SL+NMLLTLGKTFGKT W+A+ ELKKMQ KSNENL V+LGNLRTLMELT KE DGLL LF 
Sbjct:    8 RPPKLIQLLGICSDDDESNVQEFIKKSRRAARVFGEAEVLAILLLVLTGNAFKMFDILKDNLGEKMSLKNMLLTLGKTFGKTHWVALIELKKMQSKSNENLDVYLGNLRTLMELTGKEQDGLLRLFF 134          

HSP 2 Score: 137.117 bits (344), Expect = 1.474e-42
Identity = 67/79 (84.81%), Postives = 69/79 (87.34%), Query Frame = 2
Query:  728 HFGKRYGRSVSATGFGQGNVHAPIILIRVYGMSNRALWVTGCSQTMIEGYCNSRIKRNVLLVVGGKLTCYERSVSMNVM 964
            HFGKRYGRSV  TGFGQGNV APIILI+VYG+S  AL  TGCSQTMIEGYCNS IKRNVLLV GGKLT YERSVSMNVM
Sbjct:  135 HFGKRYGRSVYETGFGQGNVCAPIILIQVYGISKPALLDTGCSQTMIEGYCNSGIKRNVLLVGGGKLTFYERSVSMNVM 213          

HSP 3 Score: 56.9954 bits (136), Expect = 1.474e-42
Identity = 27/39 (69.23%), Postives = 30/39 (76.92%), Query Frame = 1
Query:  964 GNEINLNVLVTPKVVPACEVQLEMDVISILKGVIFRGIK 1080
            G EINLNVLVTPKV+P  EV L MD  SIL+ +I RGIK
Sbjct:  214 GKEINLNVLVTPKVIPGYEVLLRMDATSILRDLIVRGIK 252          

HSP 4 Score: 127.487 bits (319), Expect = 1.882e-35
Identity = 60/85 (70.59%), Postives = 70/85 (82.35%), Query Frame = 1
Query: 2272 HMDHYFGVNRTLFSARKMDLLVSKSSIKEIVGQCKTSKRVYSLPIKSSKGKSSVTEVWQRLAVDTTHYLNSVFWSIIDCGPSRFS 2526
            H+DH+FG+NRTLFSARKMD  + +SS++EIVGQC+T K+ +S PIK SKG  SV EVWQRLAVDT HY N VF S IDCGPSRFS
Sbjct:  374 HVDHHFGINRTLFSARKMDPSILRSSVEEIVGQCQTCKQAHSSPIKWSKGNLSVPEVWQRLAVDTMHYDNYVFLSEIDCGPSRFS 458          

HSP 5 Score: 42.743 bits (99), Expect = 1.882e-35
Identity = 31/64 (48.44%), Postives = 37/64 (57.81%), Query Frame = 2
Query: 2567 NNARSWWL-----LEILLDNSRTFLYIEIRTL*SILCKDNLLK-----RLSTLGRQYCG*SRSN 2728
            +N RS +L      EILLDNSRTF + EIRT    LCK   +K      L TLG+ YCG S +N
Sbjct:  473 DNLRSIFLDHAVPFEILLDNSRTFHFSEIRT----LCKLFYVKMIYPNALYTLGKPYCGKSPTN 532          

HSP 6 Score: 63.929 bits (154), Expect = 3.880e-10
Identity = 34/63 (53.97%), Postives = 43/63 (68.25%), Query Frame = 1
Query: 2044 LVTGWDQELDTMTVAIMRK-ITDKV*KQDPVEGEWNVKNTDSAIFWCDASSLAYGVVV*IGTV 2229
            ++ G++  L     +I+R  I   + KQ+PV GE NVKNTDS I WCDASSLA GVVV IGT+
Sbjct:  227 VIPGYEVLLRMDATSILRDLIVRGIKKQNPVGGECNVKNTDSGIVWCDASSLAIGVVVEIGTM 289          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000064600.1 (SMESG000064600.1)

HSP 1 Score: 169.088 bits (427), Expect = 1.260e-45
Identity = 82/99 (82.83%), Postives = 87/99 (87.88%), Query Frame = 2
Query:  104 RLPKLIQVLGIYSENDESNVQEFIKKSRRAARVFGEAEVLAILPLVLTGNAYSMFDMLEDNLGGKTSLENMLLTLGKTFGKTPWMAVDELKKMQWKSNE 400
            R PKLIQ+LGI S +DESNV EFIKKSRRAARVFG+AEVL ILPLVL GNAYSMFDMLEDNLG K SLEN+LLTLGKT G TPWM V ELKKMQWKSN+
Sbjct:    8 RPPKLIQILGICSRDDESNVNEFIKKSRRAARVFGKAEVLVILPLVLIGNAYSMFDMLEDNLGEKMSLENVLLTLGKTLGNTPWMTVAELKKMQWKSNK 106          

HSP 2 Score: 91.6633 bits (226), Expect = 8.700e-30
Identity = 47/72 (65.28%), Postives = 54/72 (75.00%), Query Frame = 1
Query: 2311 SARKMDLLVSKSSIKEIVGQCKTSKRVYSLPIKSSKGKSSVTEVWQRLAVDTTHYLNSVFWSIIDCGPSRFS 2526
            ++R+ D   S+SS+KEIVGQC T KRV   PIK  KG  SV EVWQRLAVDTT+Y N VF S+IDCG SRFS
Sbjct:  111 ASRRTDSSASRSSVKEIVGQCHTCKRVDPSPIKWLKGHLSVPEVWQRLAVDTTNYGNFVFLSVIDCGSSRFS 182          

HSP 3 Score: 59.3066 bits (142), Expect = 8.700e-30
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 3
Query: 2505 LWTKQILKSGNKIYLRNHL*SIMLDHGGYSKYSWTIVERSSTLKLER----CDLFCVKIIY*NVYRPSVDSIVDKVDRTVKRTMAR 2750
            +W K  LKS N+I +R++  S+ L+HG   +    +++ S T         C+L C+K+IY N Y+PS + IV++V RTVKRTM R
Sbjct:  183 IWRK--LKSENEIDVRDNHRSVFLEHGVPVEI---LLDNSRTFNFNEIRTLCELLCLKMIYRNTYQPSGNGIVERVHRTVKRTMER 263          

HSP 4 Score: 55.0694 bits (131), Expect = 1.723e-7
Identity = 37/94 (39.36%), Postives = 50/94 (53.19%), Query Frame = 2
Query: 2591 LEILLDNSRTFLYIEIRTL*SILCKDNLLKRLSTLGRQYCG*SRSNS*KNHGKGEV*YRKAAFLYNSLPTNGISLDSVPENLRSQHVWRYPFLY 2872
            +EILLDNSRTF + EIRTL  +LC   + +               N+ +  G G V  R    +  ++  +GI    +P NLRSQHVWRYPF +
Sbjct:  210 VEILLDNSRTFNFNEIRTLCELLCLKMIYR---------------NTYQPSGNGIV-ERVHRTVKRTMERSGI----IPANLRSQHVWRYPFEF 283          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000018454.1 (SMESG000018454.1)

HSP 1 Score: 100.523 bits (249), Expect = 6.227e-40
Identity = 62/120 (51.67%), Postives = 72/120 (60.00%), Query Frame = 1
Query: 1876 IKMSQKIWEWIWNRDN*IDESQERSPSDNCFHGLGK*SNIFQLKLFDRLVRL*NDYLVTG--WDQELDTMTVAIMRKITDKV*KQDPVEGEWNVKNTDSAIFWCDASSLAYGVVV*IGTV 2229
            +K  +K  + IWNRDN +DE QER      F  +G+    F L  + R        L+    WDQE+D MTV IMRKI DKV KQ PV GEWNVKNT   I WC+AS LA GVVV IGTV
Sbjct:   53 LKRVRKYGKLIWNRDNQVDELQERVTKRQLFSWVGQMIGNFSLARWLRPTCSFVKQLIGDREWDQEVDIMTVMIMRKIADKVQKQVPVGGEWNVKNTHPGIVWCNASRLAIGVVVEIGTV 172          

HSP 2 Score: 84.7297 bits (208), Expect = 6.227e-40
Identity = 45/60 (75.00%), Postives = 48/60 (80.00%), Query Frame = 2
Query: 1721 MDAGICKGMDAYINDKFVNTSLVSAESVVKHL*KFELDAKNPYFIVRA*VLELK*VRKYG 1900
            MDAGICK MDAYI+D FVNTSLVSAES VKHL KF L+AK+P FI    VL LK VRKYG
Sbjct:    1 MDAGICKAMDAYIDDIFVNTSLVSAESGVKHLRKFGLEAKDPEFIDGDRVLGLKRVRKYG 60          
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Match: SMESG000059416.1 (SMESG000059416.1)

HSP 1 Score: 89.3521 bits (220), Expect = 5.024e-25
Identity = 43/102 (42.16%), Postives = 67/102 (65.69%), Query Frame = 2
Query: 1505 VLSKEIEEMVEMG*RCVAIDLKSAYLQIRVAESL*AFEVVKLQRKTFALTRLGFGLNVAPKIMTTVLKHVLSMDAGICKGMDAYINDKFVNTSLVSAESVVK 1810
            V ++ I E  + G +   +DL  AY+QIRV ES+  ++   +  + +ALTRLGFG+N+AP IMT ++ HVLS++  I +G  AYI+D F++  +V AE  V+
Sbjct:   81 VCNETIREWRKKGNKIAILDLSDAYMQIRVDESMWKYQSCIINGRRYALTRLGFGINIAPGIMTEIVNHVLSLNDRIKQGASAYIDDIFIDKKVVPAEEEVE 182          

HSP 2 Score: 45.8246 bits (107), Expect = 5.024e-25
Identity = 19/60 (31.67%), Postives = 35/60 (58.33%), Query Frame = 1
Query: 1336 EAVENWIKNGWLQTYS----GEIKAVLPLLAVIQQNKAKVRPVLDYGKINEHVSSHNAQA 1503
            + ++ WI NGWL  Y     GE    + L  V+Q+NK+K+ P+ D+  +N ++  ++ +A
Sbjct:   20 KVIKQWITNGWLVEYDENRFGEPVGAVTLFPVMQKNKSKISPIFDFRALNHYLDIYSGEA 79          
The following BLAST results are available for this feature:
BLAST of CCHC-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5S6Q1P27.640e-5038.60Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A085NTN94.754e-4443.70Uncharacterized protein OS=Trichuris suis OX=68888... [more]
A0A085LPJ97.291e-4443.70Uncharacterized protein OS=Trichuris suis OX=68888... [more]
A0A5S6R6C82.063e-4245.54Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6Q4C22.076e-4245.54Uncharacterized protein OS=Trichuris muris OX=7041... [more]
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CCHC-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064797.16.913e-6974.44SMESG000064797.1[more]
SMESG000076049.13.412e-5481.10SMESG000076049.1[more]
SMESG000064600.11.260e-4582.83SMESG000064600.1[more]
SMESG000018454.16.227e-4051.67SMESG000018454.1[more]
SMESG000059416.15.024e-2542.16SMESG000059416.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026346 ID=SMED30026346|Name=CCHC-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2939bp
GTCCTCGTAATGTAATTATTTAAAAGAATTTTATTTTAATAATTAGTTTA
ATTAGCCAATTTTGAAATATAAATAAATTATTAATTAGTTTTACTTCCAC
AAGCGGCTGCCAAAGTTGATCCAGGTTCTCGGGATTTACAGTGAGAATGA
TGAATCAAATGTCCAAGAATTTATAAAGAAAAGCAGAAGAGCGGCTAGGG
TTTTTGGGGAAGCAGAAGTCTTGGCCATTCTACCTTTGGTTTTGACAGGA
AACGCATATTCAATGTTCGATATGCTTGAAGACAATTTGGGAGGAAAGAC
GTCTTTAGAAAACATGCTTTTAACATTGGGAAAAACATTTGGTAAAACGC
CTTGGATGGCAGTAGACGAGTTAAAGAAAATGCAGTGGAAATCTAACGAA
AATTTGGGCGTGCACTTGGGAAATCTTAGAACACTGATGGAACTCACTGC
AAAAGAACCAGATGGCTTACTAACACTATTTTTGGTAAATAGTCTACTAC
AGTGCCAGCCCTGATGTTCTTTCAATCCCTTTGGCACAATTGGTAGAAAG
AACAGAGTCTCTATCAACGTTTTATGGATTGGAATTCACTAATCATGCTT
GTGCTACTTCTAGGAGTCATATCAAATGTTACTAGTGTGTCAAAGATAGT
TATGTGAGGTCTCAATGCCCACAATTAAAATTCCATAAGTGTGGTAATCC
TGGTCATTATGCAAGAAATTGTAAAGTCATTTCGGGAAACGATATGGTCG
ATCCGTCAGCGCGACCGGATTTGGCCAAGGGAATGTTCACGCGCCAATAA
TACTCATTCGAGTGTATGGAATGAGTAACCGAGCTCTTTGGGTTACTGGA
TGCTCGCAAACAATGATTGAAGGGTATTGTAATTCAAGGATCAAAAGAAA
CGTATTGCTGGTTGTAGGTGGTAAATTAACTTGCTATGAAAGATCTGTGT
CGATGAACGTCATGGTAATGAAATTAATTTAAATGTTTTAGTTACGCCCA
AGGTCGTTCCTGCATGTGAAGTTCAGCTAGAAATGGATGTGATATCTATT
CTAAAAGGTGTAATTTTTCGTGGAATCAAGGTGACGTTGGCAAATGGACA
CATGCGACCATAAATTTGTTGCTTGGGTGTCAATGTTGATACAAATGAGC
AAGGAGTGATAGAATCAAGGAGAGTGCCAAATTCGGTTTAAAACATCGAT
GACAAGGATTTGTAGGCAAATTTTGAGCGAAATGCATAGACGGTGAAATG
GGATTGGATTGATAGCGCTCCAGAAACTAAGAAGCCTTCTATATCTCAGT
ACAAAGTTTCTCACAAAGCCGAAAACGAATTTAACGAGGCTGTTGAAAAT
TGGATTAAGAATGGGTGGTTGCAGACTTATAGTGGAGAGATTAAAGCCGT
ACTTCCTTTGTTGGCGGTTATTCAACAAAATAAAGCAAAAGTTAGACCAG
TCTTGGATTATGGAAAAATAAACGAACATGTCTCAAGTCACAATGCGCAA
GCGGGTTCTGTCAAAAGAAATTGAGGAAATGGTGGAGATGGGGTGACGAT
GTGTTGCTATTGATTTAAAATCAGCATATTTACAAATACGTGTTGCCGAA
TCTTTGTGAGCCTTCGAAGTAGTTAAATTACAGAGAAAGACGTTTGCTCT
TACAAGACTCGGTTTCGGTCTTAACGTTGCACCGAAAATCATGACAACTG
TGTTAAAGCATGTTTTATCAATGGATGCTGGCATCTGCAAAGGAATGGAT
GCATACATTAATGATAAATTTGTAAATACAAGCCTGGTTTCAGCGGAATC
TGTGGTAAAACACTTGTAAAAGTTTGAATTGGATGCGAAGAATCCATATT
TTATTGTTAGAGCTTGAGTTCTTGAATTAAAATGAGTCAGAAAATATGGG
AATGGATCTGGAATCGGGATAATTAAATTGATGAATCGCAGGAGAGATCA
CCAAGCGACAACTGCTTTCATGGGCTGGGCAAATGATCGAACATTTTCCA
GTTGAAGTTGTTTGATCGTCTTGTTCGTTTGTAAAACGACTATCTGGTGA
CAGGATGGGATCAAGAACTGGATACAATGACAGTAGCGATAATGAGAAAA
ATCACAGATAAAGTATAGAAACAAGATCCAGTGGAAGGAGAATGGAACGT
GAAAAATACTGATTCAGCAATTTTTTGGTGCGACGCAAGCAGTCTTGCTT
ATGGAGTAGTTGTATAAATTGGAACAGTGCGTGAGAGGGTTAATGGAAAC
ATGGATTTAATACTGAGTTACCACATGGATCACTATTTTGGAGTTAACCG
GACATTGTTCTCAGCTAGAAAAATGGATCTATTGGTCTCAAAATCATCAA
TCAAAGAAATTGTGGGACAGTGCAAAACAAGTAAACGAGTCTATTCATTA
CCTATAAAATCGTCAAAGGGGAAATCGAGTGTGACAGAAGTTTGGCAAAG
ACTAGCAGTGGATACAACGCATTACCTTAACTCTGTATTTTGGAGCATAA
TCGACTGTGGACCAAGCAGATTCTCAAATCAGGAAATAAAATATACCTTC
GTAATCATCTTTGATCAATAATGCTCGATCATGGTGGTTACTCGAAATAC
TCCTGGACAATAGTAGAACGTTCCTCTACATTGAAATTAGAACGCTGTGA
TCTATTCTGTGTAAAGATAATTTATTGAAACGTCTATCGACCCTCGGTAG
ACAGTATTGTGGATAAAGTCGATCGAACAGTTAAAAGAACCATGGCAAGG
GTGAGGTATGATACAGGAAAGCAGCATTTTTGTATAATTCTCTTCCGACG
AATGGAATTAGCTTAGATTCCGTCCCAGAAAATCTAAGATCACAACATGT
TTGGCGTTATCCATTTTTGTATAATTCTCTTCCTACGAATAGAATTAGCT
TATATTCCGTCCCAGCAAATCTAAGATCACAACATGTTT
back to top

protein sequence of SMED30026346-orf-1

>SMED30026346-orf-1 ID=SMED30026346-orf-1|Name=SMED30026346-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=107bp
MDLILSYHMDHYFGVNRTLFSARKMDLLVSKSSIKEIVGQCKTSKRVYSL
PIKSSKGKSSVTEVWQRLAVDTTHYLNSVFWSIIDCGPSRFSNQEIKYTF
VIIFDQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004523RNA-DNA hybrid ribonuclease activity
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0090502RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0015074DNA integration
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001878Znf_CCHC