Ankyrin

Overview
NameAnkyrin
Smed IDSMED30026337
Length (bp)9304
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ankyrin (SMED30026337) t-SNE clustered cells

Violin plots show distribution of expression levels for Ankyrin (SMED30026337) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ankyrin (SMED30026337) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ankyrin (SMED30026337) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026337

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30026337SMESG000000606.1 Contig939newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026337SMESG000000606.1 Contig939uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026337SMESG000060548.1 Contig939newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026337SMESG000060548.1 Contig939uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
headSMED30026337SMESG000019789.1 SmedASXL_007962SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026337SMESG000019789.1 SmedASXL_007960SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026337SMESG000019789.1 SmedASXL_007961SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026337SMESG000000606.1 dd_Smed_v4_2072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026337SMESG000000606.1 dd_Smed_v4_2072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026337SMESG000000606.1 dd_Smed_v4_2072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal cellSMED30026337SMESG000000606.1 dd_Smed_v4_2072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026337SMESG000000606.1 dd_Smed_v4_2072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026337SMESG000019783.1 SMESG000019789.1 dd_Smed_v4_4438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30026337SMESG000019783.1 SMESG000019789.1 dd_Smed_v4_4438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026337SMESG000000606.1 dd_Smed_v4_2072_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026337SMESG000019783.1 SMESG000019789.1 dd_Smed_v4_4438_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ankyrin vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 445/780 (57.05%), Postives = 585/780 (75.00%), Query Frame = 1
Query:  100 SNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            +N S+LRAARAG+L K +D+++ G DIN CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N +  DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK++IK++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH++A+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VA++LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+TPLH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+
Sbjct:   41 ANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 2 Score: 463.766 bits (1192), Expect = 4.761e-130
Identity = 238/498 (47.79%), Postives = 333/498 (66.87%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  P+ SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P EIV ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +AT +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L
Sbjct:  918 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFL 1415          
BLAST of Ankyrin vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 897.116 bits (2317), Expect = 0.000e+0
Identity = 447/788 (56.73%), Postives = 589/788 (74.75%), Query Frame = 1
Query:   76 KSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            K   + S++N S+LRAARAG+L K +D+++ G DIN CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N +  DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK++IK++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH++A+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VA++LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+TPLH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+
Sbjct:   16 KRKGKKSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 799          

HSP 2 Score: 480.715 bits (1236), Expect = 1.175e-137
Identity = 274/649 (42.22%), Postives = 395/649 (60.86%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQR-NQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIK-TTICTD-------KIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIR--NNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  P+ SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P EIV ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +AT +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L   +  +G+           Q  +  L I LP+    +  T RR+   +    K  +  T+          ++++ +  VAD +G  W +LA  L  S  E ++ IR  N +S    ++ LL  W ++ G  A  + L   L  I R D+V
Sbjct:  919 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGL----------PQTAVCNLNITLPAH-KKIEKTDRRQSFASLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDE-INQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1555          
BLAST of Ankyrin vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 446/786 (56.74%), Postives = 589/786 (74.94%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            ++  S++N S+LRAARAG+L K +D+++ G DIN CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N +  DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK++IK++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH++A+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VA++LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+TPLH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+
Sbjct:   29 SSRKSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 810          

HSP 2 Score: 481.1 bits (1237), Expect = 1.051e-137
Identity = 274/649 (42.22%), Postives = 395/649 (60.86%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQR-NQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIK-TTICTD-------KIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIR--NNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  P+ SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P EIV ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +AT +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L   +  +G+           Q  +  L I LP+    +  T RR+   +    K  +  T+          ++++ +  VAD +G  W +LA  L  S  E ++ IR  N +S    ++ LL  W ++ G  A  + L   L  I R D+V
Sbjct:  912 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGL----------PQTAVCNLNITLPAH-KKIEKTDRRQSFASLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDE-INQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1548          
BLAST of Ankyrin vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 894.419 bits (2310), Expect = 0.000e+0
Identity = 444/784 (56.63%), Postives = 585/784 (74.62%), Query Frame = 1
Query:   88 ENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            + S+SN SFLRAARAGNL KV+++L+ G DINTCN  GL+ALHLAAKEGH+ +V+EL+ R   +D+ TKKGN+ALHIASLAG+ EVVK+LV+ GAN+N QS NGFTPLYMAAQENH++VV +L+ NGA+Q+  TEDGFTPLAVALQQGH + VA+LLEND + K RLPALHIA +K+D  +  LLL N    DV  QS SGFTPLHIAAHYGN   A LL+ + A V+F A+N ITPLHVA+K G + MV+LL+D G  +  +TRDGLTPLHC+ARSGH Q+ E L++ GA ++++T+NGL+ LHMAAQGD  +  + LL  +A +++ T D+LT LHV AH G+ +V ++LLD+R +PNARALNGFTPLHIACKK++IK++ELL+KYGA I+A TE+GLTP+HV+AF+G    V +LLQ GA+ +   +RGETALH+A R  Q E V+ LL+ GA+ DA+ARE QTPLH+A+++G  E++ L LQ  + P+ AT + YT LH++A+EG+ +  S+LL++GA     TK+GFTPLH+AAKY  + VA +LLQ++A  ++ GKNGLTPLHVA HY+++KVA LLL+  A P   AKNGYTPLHIAAKKN   +A  LL   A++N  ++ G +PL LASQEGHTD+V+LLL   A+++   K+GLTS+HL AQEDKV VA IL   GAD    T   YTPL  A H+G + M  +L  L     +N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IA++  Y+++ + L+
Sbjct:    6 QKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADV--QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFL--LKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 785          

HSP 2 Score: 452.595 bits (1163), Expect = 1.063e-126
Identity = 234/476 (49.16%), Postives = 323/476 (67.86%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRN-QGMGAGNALGTSAVQKPITTLEICLP 4662
            +NV +   P+ SGFLVSFMVDARGG M+  R   LR  +PP     PTR+ CRL+K  ++ + P + +G+G A R++E+GP   QF  P+++E+PH+A+LR +ERE+++LRSENG++WKEH  + T+  +   +    E L + E++   RI RI+T D PQYFA++SRI+Q+  LIGPEG V+SS+VVPQVQAVFPEGAL K+ RVG+QA  +  E+V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+PK  +  M+N       +LRLLCSITGG+ PA WEDI+G+TPL+F  +CVSFTT VSAR WLIDC  +Q     A+ VYRE   VPYM +FVV+ + HD  EA+ R   +TDD VDKTLE QENF  +A    VEVL  +P +++  GNLVP+TK+G     +  A  ENR+   V+V+D  QEP G+L+ +   ++ +G+          V + I  L I LP
Sbjct:  926 DNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL----------VHQAICNLNITLP 1391          
BLAST of Ankyrin vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 893.649 bits (2308), Expect = 0.000e+0
Identity = 443/798 (55.51%), Postives = 590/798 (73.93%), Query Frame = 1
Query:   64 STMTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            S+  +   + S+SN SFLRAARAGNL KV+++L+ G DINTCN  GL+ALHLAAKEGH+ +V+EL+ R   +D+ TKKGN+ALHIASLAG+ EVVK+LV+ GAN+N QS NGFTPLYMAAQENH++VV +L+ NGA+Q+  TEDGFTPLAVALQQGH + VA+LLEND + K RLPALHIA +K+D  +  LLL +       S++ VN  + SGFTPLHIAAHYGN   A LL+ + A V+F A+N ITPLHVA+K G + MV+LL+D G  +  +TRDGLTPLHC+ARSGH Q+ E L++ GA ++++T+NGL+ LHMAAQGD  +  + LL  +A +++ T D+LT LHV AH G+ +V ++LLD+R +PNARALNGFTPLHIACKK++IK++ELL+KYGA I+A TE+GLTP+HV+AF+G    V +LLQ GA+ +   +RGETALH+A R  Q E V+ LL+ GA+ DA+ARE QTPLH+A+++G  E++ L LQ  + P+ AT + YT LH++A+EG+ +  S+LL++GA     TK+GFTPLH+AAKY  + VA +LLQ++A  ++ GKNGLTPLHVA HY+++KVA LLL+  A P   AKNGYTPLHIAAKKN   +A  LL   A++N  ++ G +PL LASQEGHTD+V+LLL   A+++   K+GLTS+HL AQEDKV VA IL   GAD    T   YTPL  A H+G + M  +L  L     +N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IA++  Y+++ + L+
Sbjct:   19 SSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFL--LKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 814          

HSP 2 Score: 452.595 bits (1163), Expect = 1.082e-126
Identity = 234/476 (49.16%), Postives = 323/476 (67.86%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRN-QGMGAGNALGTSAVQKPITTLEICLP 4662
            +NV +   P+ SGFLVSFMVDARGG M+  R   LR  +PP     PTR+ CRL+K  ++ + P + +G+G A R++E+GP   QF  P+++E+PH+A+LR +ERE+++LRSENG++WKEH  + T+  +   +    E L + E++   RI RI+T D PQYFA++SRI+Q+  LIGPEG V+SS+VVPQVQAVFPEGAL K+ RVG+QA  +  E+V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+PK  +  M+N       +LRLLCSITGG+ PA WEDI+G+TPL+F  +CVSFTT VSAR WLIDC  +Q     A+ VYRE   VPYM +FVV+ + HD  EA+ R   +TDD VDKTLE QENF  +A    VEVL  +P +++  GNLVP+TK+G     +  A  ENR+   V+V+D  QEP G+L+ +   ++ +G+          V + I  L I LP
Sbjct:  955 DNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL----------VHQAICNLNITLP 1420          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 463/782 (59.21%), Postives = 595/782 (76.09%), Query Frame = 1
Query:   94 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            +E + SFLRAARAG+L KV++ L  GTDINT N  GL++LHLA+KEGH  +V+ELIKR+ ++DA T+KGN+ALHIASLAG+  +V ILVENGANVN+QS NGFTPLYMAAQENH EVV +L+ +GA+Q ++TEDGFTPLAVALQQGH+R+VA+LLEND++ K RLPALHIA KK+D  A  LLL N    DV   S SGFTPLHIAAHYG+E   QLL+E+ A+VN+QA++NI+PLHVA KWGR+ M  LL+  GA++  RT+D LTPLHC+ARSGH Q+ + L+  GA + +KT+NGL  LHMAAQGD  D AR LL  RA +++ T D+LTPLHV AH G+ +VA++LLDR  DPN+RALNGFTPLHIACKK++IK+VELLLKY A IEATTE+GLTPLHV+AF+G+   V  LLQ+GAN +  T+RGET LHLA R NQT+ V++L++ GA  DA+ARE QTPLH+A+++GN +++ L LQ+G++ N  TRDNY+ LH+AAKEG+ E   +LLD  A     TK+GFTPLH+A+KY  + V  +LL++    +  GKN +TPLHVA HYN++KVA LLL+N A  K  AKNGYTPLHIAAKKN  ++A  LL   AD NA+SR GF+PL L++QEGH ++  LL+++ +DV  KA NGLT+MHL AQED V VA+IL + GA+I   T A YTPLH A HFGQ+NM K+L+   +   + +KT+  +TPLH AAQQGH   V  LLE+ A PN +   G T   IA++  Y+++ E LR
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE--NGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 2 Score: 470.7 bits (1210), Expect = 1.876e-132
Identity = 282/634 (44.48%), Postives = 394/634 (62.15%), Query Frame = 1
Query: 3238 ENVPI---VRKPVS---SGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSF--ERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-----SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVK---DIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPS---EIH---PVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVK-------NCMINISFVTDEDEKSQALK 5052
            +NVPI   V +P       FL+SF+VDARGG M+  R + +R  VPP  A  P R+ CR ++  K+  PP L++G+  A RI+EM P   +F  P+++EVPH+ASLRDREREI+ILRS++G+ WKEH +EAT+ A+Q  +  SF  E L   ++++  RI RILTSD P YFA+++R+RQEV  +GPEG V+ SSVVP+VQA+FP+G+L K  +V +QA  +P E+VTRL GNRVA SPI+++EPRRRKFHKPITL +PLP++ N+GM+    SG       +LRLLCSITGGSAPA WEDI+G+T L+F  D VSFTTTVSAR WL+DC   +  A MA  VY E+  +PYM +F V+ RR    E Q R+  +TDD  DKTLE QE+F+LIA    VEVL  +  ++E +GNLVP+TK+GDQLS+      ENR++F+V+ +   D +   +G++  +   + +     +AL     Q+PI TL I LP    EI    P    L   + + G  ++  +        E   + V   IG DW +L  AL +    D+ +IR N   +     L I    K+ D    N L++ALR IGR+D+V+       + +IN S      +K + ++
Sbjct:  989 DNVPIGHHVTQPSKLQHRTFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQ-YSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIR----SDAL---PPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEKDLP-------EFVHQNVLKGIGADWPRLGRALEVP-HRDIQHIRQNYPGQECKNTLKIWIHLKKEDANQDN-LDQALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIR 1605          

HSP 3 Score: 174.096 bits (440), Expect = 1.355e-42
Identity = 127/396 (32.07%), Postives = 208/396 (52.53%), Query Frame = 1
Query: 1339 LQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKV-----------------------------AQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRK 2439
            +Q  A  E G   G  +   A R    E V  LL+AG   +         LH+A+K G+ E++   ++  +  + ATR   TALH+A+  G+S  +++L+++GA +  ++  GFTPL++AA+ +   V   LL+  AN   + ++G TPL VA    H++V                             A LLL N+ +P   +K+G+TPLHIAA   ++++  +LL   A+ N ++R+  SPL +A++ G T++ +LLL   A ++ + K+ LT +H  A+     V  +LV  GA I+  T     PLH AA    ++ A+ L  L  +  ++  T    TPLH+AA  GH+++  LLL+  ADPN +   G+T  HIA K++ + + E+L K
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL--LYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK 413          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 463/782 (59.21%), Postives = 595/782 (76.09%), Query Frame = 1
Query:   94 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            +E + SFLRAARAG+L KV++ L  GTDINT N  GL++LHLA+KEGH  +V+ELIKR+ ++DA T+KGN+ALHIASLAG+  +V ILVENGANVN+QS NGFTPLYMAAQENH EVV +L+ +GA+Q ++TEDGFTPLAVALQQGH+R+VA+LLEND++ K RLPALHIA KK+D  A  LLL N    DV   S SGFTPLHIAAHYG+E   QLL+E+ A+VN+QA++NI+PLHVA KWGR+ M  LL+  GA++  RT+D LTPLHC+ARSGH Q+ + L+  GA + +KT+NGL  LHMAAQGD  D AR LL  RA +++ T D+LTPLHV AH G+ +VA++LLDR  DPN+RALNGFTPLHIACKK++IK+VELLLKY A IEATTE+GLTPLHV+AF+G+   V  LLQ+GAN +  T+RGET LHLA R NQT+ V++L++ GA  DA+ARE QTPLH+A+++GN +++ L LQ+G++ N  TRDNY+ LH+AAKEG+ E   +LLD  A     TK+GFTPLH+A+KY  + V  +LL++    +  GKN +TPLHVA HYN++KVA LLL+N A  K  AKNGYTPLHIAAKKN  ++A  LL   AD NA+SR GF+PL L++QEGH ++  LL+++ +DV  KA NGLT+MHL AQED V VA+IL + GA+I   T A YTPLH A HFGQ+NM K+L+   +   + +KT+  +TPLH AAQQGH   V  LLE+ A PN +   G T   IA++  Y+++ E LR
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE--NGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLR 808          

HSP 2 Score: 470.7 bits (1210), Expect = 1.876e-132
Identity = 282/634 (44.48%), Postives = 394/634 (62.15%), Query Frame = 1
Query: 3238 ENVPI---VRKPVS---SGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSF--ERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-----SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVK---DIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPS---EIH---PVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVK-------NCMINISFVTDEDEKSQALK 5052
            +NVPI   V +P       FL+SF+VDARGG M+  R + +R  VPP  A  P R+ CR ++  K+  PP L++G+  A RI+EM P   +F  P+++EVPH+ASLRDREREI+ILRS++G+ WKEH +EAT+ A+Q  +  SF  E L   ++++  RI RILTSD P YFA+++R+RQEV  +GPEG V+ SSVVP+VQA+FP+G+L K  +V +QA  +P E+VTRL GNRVA SPI+++EPRRRKFHKPITL +PLP++ N+GM+    SG       +LRLLCSITGGSAPA WEDI+G+T L+F  D VSFTTTVSAR WL+DC   +  A MA  VY E+  +PYM +F V+ RR    E Q R+  +TDD  DKTLE QE+F+LIA    VEVL  +  ++E +GNLVP+TK+GDQLS+      ENR++F+V+ +   D +   +G++  +   + +     +AL     Q+PI TL I LP    EI    P    L   + + G  ++  +        E   + V   IG DW +L  AL +    D+ +IR N   +     L I    K+ D    N L++ALR IGR+D+V+       + +IN S      +K + ++
Sbjct:  989 DNVPIGHHVTQPSKLQHRTFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQ-YSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIR----SDAL---PPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEKDLP-------EFVHQNVLKGIGADWPRLGRALEVP-HRDIQHIRQNYPGQECKNTLKIWIHLKKEDANQDN-LDQALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIR 1605          

HSP 3 Score: 174.096 bits (440), Expect = 1.355e-42
Identity = 127/396 (32.07%), Postives = 208/396 (52.53%), Query Frame = 1
Query: 1339 LQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKV-----------------------------AQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRK 2439
            +Q  A  E G   G  +   A R    E V  LL+AG   +         LH+A+K G+ E++   ++  +  + ATR   TALH+A+  G+S  +++L+++GA +  ++  GFTPL++AA+ +   V   LL+  AN   + ++G TPL VA    H++V                             A LLL N+ +P   +K+G+TPLHIAA   ++++  +LL   A+ N ++R+  SPL +A++ G T++ +LLL   A ++ + K+ LT +H  A+     V  +LV  GA I+  T     PLH AA    ++ A+ L  L  +  ++  T    TPLH+AA  GH+++  LLL+  ADPN +   G+T  HIA K++ + + E+L K
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL--LYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK 413          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 474/823 (57.59%), Postives = 611/823 (74.24%), Query Frame = 1
Query:   94 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGE 2559
            +E + SFLRAARAG+L KV++ L  GTDINT N  GL++LHLA+KEGH  +V+ELIKR+ ++DA T+KGN+ALHIASLAG+  +V ILVENGANVN+QS NGFTPLYMAAQENH EVV +L+ +GA+Q ++TEDGFTPLAVALQQGH+R+VA+LLEND++ K RLPALHIA KK+D  A  LLL N    DV   S SGFTPLHIAAHYG+E   QLL+E+ A+VN+QA++NI+PLHVA KWGR+ M  LL+  GA++  RT+D LTPLHC+ARSGH Q+ + L+  GA + +KT+NGL  LHMAAQGD  D AR LL  RA +++ T D+LTPLHV AH G+ +VA++LLDR  DPN+RALNGFTPLHIACKK++IK+VELLLKY A IEATTE+GLTPLHV+AF+G+   V  LLQ+GAN +  T+RGET LHLA R NQT+ V++L++ GA  DA+ARE QTPLH+A+++GN +++ L LQ+G++ N  TRDNY+ LH+AAKEG+ E   +LLD  A     TK+GFTPLH+A+KY  + V  +LL++    +  GKN +TPLHVA HYN++KVA LLL+N A  K  AKNGYTPLHIAAKKN  ++A  LL   AD NA+SR GF+PL L++QEGH ++  LL+++ +DV  KA NGLT+MHL AQED V VA+IL + GA+I   T A YTPLH A HFGQ+NM K+L+   +   + +KT+  +TPLH AAQQGH   V  LLE+ A PN +   G T   IA++  Y+++ E LR VT   +  E    +        +   M E   S+SEDEG+
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE--NGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQNPEA--MNETMFSESEDEGQ 847          

HSP 2 Score: 465.307 bits (1196), Expect = 2.781e-133
Identity = 282/634 (44.48%), Postives = 395/634 (62.30%), Query Frame = 1
Query: 3238 ENVPI---VRKPVS---SGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSF--ERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-----SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVK---DIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLP---SEIH---PVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVK-------NCMINISFVTDEDEKSQALK 5052
            +NVPI   V +P       FL+SF+VDARGG M+  R + +R  VPP  A  P R+ CR ++  K+  PP L++G+  A RI+EM P   +F  P+++EVPH+ASLRDREREI+ILRS++G+ WKEH +EAT+ A+Q  +  SF  E L   ++++  RI RILTSD P YFA+++R+RQEV  +GPEG V+ SSVVP+VQA+FP+G+L K  +V +QA  +P E+VTRL GNRVA SPI+++EPRRRKFHKPITL +PLP++ N+GM+    SG       +LRLLCSITGGSAPA WEDI+G+T L+F  D VSFTTTVSAR WL+DC   +  A MA  VY E+  +PYM +F V+ RR    E Q R+  +TDD  DKTLE QE+F+LIA    VEVL  +  ++E +GNLVP+TK+GDQLS+      ENR++F+V+ +   D +   +G++  +   + +     +AL     Q+PI TL I LP    EI    P    L   + + G  ++  +        E   + V   IG DW +L  AL +    D+ +IR N   +     L I    K+ D A  + L++ALR IGR+D+V+       + +IN S      +K + ++
Sbjct:  989 DNVPIGHHVTQPSKLQHRTFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQ-YSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIR----SDAL---PPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEKDL-------PEFVHQNVLKGIGADWPRLGRALEVP-HRDIQHIRQNYPGQECKNTLKIWIHLKKED-ANQDNLDQALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIR 1605          

HSP 3 Score: 177.563 bits (449), Expect = 7.171e-44
Identity = 127/396 (32.07%), Postives = 208/396 (52.53%), Query Frame = 1
Query: 1339 LQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKV-----------------------------AQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRK 2439
            +Q  A  E G   G  +   A R    E V  LL+AG   +         LH+A+K G+ E++   ++  +  + ATR   TALH+A+  G+S  +++L+++GA +  ++  GFTPL++AA+ +   V   LL+  AN   + ++G TPL VA    H++V                             A LLL N+ +P   +K+G+TPLHIAA   ++++  +LL   A+ N ++R+  SPL +A++ G T++ +LLL   A ++ + K+ LT +H  A+     V  +LV  GA I+  T     PLH AA    ++ A+ L  L  +  ++  T    TPLH+AA  GH+++  LLL+  ADPN +   G+T  HIA K++ + + E+L K
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL--LYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK 413          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 474/823 (57.59%), Postives = 611/823 (74.24%), Query Frame = 1
Query:   94 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGE 2559
            +E + SFLRAARAG+L KV++ L  GTDINT N  GL++LHLA+KEGH  +V+ELIKR+ ++DA T+KGN+ALHIASLAG+  +V ILVENGANVN+QS NGFTPLYMAAQENH EVV +L+ +GA+Q ++TEDGFTPLAVALQQGH+R+VA+LLEND++ K RLPALHIA KK+D  A  LLL N    DV   S SGFTPLHIAAHYG+E   QLL+E+ A+VN+QA++NI+PLHVA KWGR+ M  LL+  GA++  RT+D LTPLHC+ARSGH Q+ + L+  GA + +KT+NGL  LHMAAQGD  D AR LL  RA +++ T D+LTPLHV AH G+ +VA++LLDR  DPN+RALNGFTPLHIACKK++IK+VELLLKY A IEATTE+GLTPLHV+AF+G+   V  LLQ+GAN +  T+RGET LHLA R NQT+ V++L++ GA  DA+ARE QTPLH+A+++GN +++ L LQ+G++ N  TRDNY+ LH+AAKEG+ E   +LLD  A     TK+GFTPLH+A+KY  + V  +LL++    +  GKN +TPLHVA HYN++KVA LLL+N A  K  AKNGYTPLHIAAKKN  ++A  LL   AD NA+SR GF+PL L++QEGH ++  LL+++ +DV  KA NGLT+MHL AQED V VA+IL + GA+I   T A YTPLH A HFGQ+NM K+L+   +   + +KT+  +TPLH AAQQGH   V  LLE+ A PN +   G T   IA++  Y+++ E LR VT   +  E    +        +   M E   S+SEDEG+
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE--NGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQNPEA--MNETMFSESEDEGQ 847          

HSP 2 Score: 465.307 bits (1196), Expect = 2.781e-133
Identity = 282/634 (44.48%), Postives = 395/634 (62.30%), Query Frame = 1
Query: 3238 ENVPI---VRKPVS---SGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSF--ERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-----SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVK---DIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLP---SEIH---PVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVK-------NCMINISFVTDEDEKSQALK 5052
            +NVPI   V +P       FL+SF+VDARGG M+  R + +R  VPP  A  P R+ CR ++  K+  PP L++G+  A RI+EM P   +F  P+++EVPH+ASLRDREREI+ILRS++G+ WKEH +EAT+ A+Q  +  SF  E L   ++++  RI RILTSD P YFA+++R+RQEV  +GPEG V+ SSVVP+VQA+FP+G+L K  +V +QA  +P E+VTRL GNRVA SPI+++EPRRRKFHKPITL +PLP++ N+GM+    SG       +LRLLCSITGGSAPA WEDI+G+T L+F  D VSFTTTVSAR WL+DC   +  A MA  VY E+  +PYM +F V+ RR    E Q R+  +TDD  DKTLE QE+F+LIA    VEVL  +  ++E +GNLVP+TK+GDQLS+      ENR++F+V+ +   D +   +G++  +   + +     +AL     Q+PI TL I LP    EI    P    L   + + G  ++  +        E   + V   IG DW +L  AL +    D+ +IR N   +     L I    K+ D A  + L++ALR IGR+D+V+       + +IN S      +K + ++
Sbjct:  989 DNVPIGHHVTQPSKLQHRTFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQ-YSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIR----SDAL---PPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEKDL-------PEFVHQNVLKGIGADWPRLGRALEVP-HRDIQHIRQNYPGQECKNTLKIWIHLKKED-ANQDNLDQALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIR 1605          

HSP 3 Score: 177.563 bits (449), Expect = 7.171e-44
Identity = 127/396 (32.07%), Postives = 208/396 (52.53%), Query Frame = 1
Query: 1339 LQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKV-----------------------------AQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRK 2439
            +Q  A  E G   G  +   A R    E V  LL+AG   +         LH+A+K G+ E++   ++  +  + ATR   TALH+A+  G+S  +++L+++GA +  ++  GFTPL++AA+ +   V   LL+  AN   + ++G TPL VA    H++V                             A LLL N+ +P   +K+G+TPLHIAA   ++++  +LL   A+ N ++R+  SPL +A++ G T++ +LLL   A ++ + K+ LT +H  A+     V  +LV  GA I+  T     PLH AA    ++ A+ L  L  +  ++  T    TPLH+AA  GH+++  LLL+  ADPN +   G+T  HIA K++ + + E+L K
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL--LYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK 413          
BLAST of Ankyrin vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 920.228 bits (2377), Expect = 0.000e+0
Identity = 474/823 (57.59%), Postives = 611/823 (74.24%), Query Frame = 1
Query:   94 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGE 2559
            +E + SFLRAARAG+L KV++ L  GTDINT N  GL++LHLA+KEGH  +V+ELIKR+ ++DA T+KGN+ALHIASLAG+  +V ILVENGANVN+QS NGFTPLYMAAQENH EVV +L+ +GA+Q ++TEDGFTPLAVALQQGH+R+VA+LLEND++ K RLPALHIA KK+D  A  LLL N    DV   S SGFTPLHIAAHYG+E   QLL+E+ A+VN+QA++NI+PLHVA KWGR+ M  LL+  GA++  RT+D LTPLHC+ARSGH Q+ + L+  GA + +KT+NGL  LHMAAQGD  D AR LL  RA +++ T D+LTPLHV AH G+ +VA++LLDR  DPN+RALNGFTPLHIACKK++IK+VELLLKY A IEATTE+GLTPLHV+AF+G+   V  LLQ+GAN +  T+RGET LHLA R NQT+ V++L++ GA  DA+ARE QTPLH+A+++GN +++ L LQ+G++ N  TRDNY+ LH+AAKEG+ E   +LLD  A     TK+GFTPLH+A+KY  + V  +LL++    +  GKN +TPLHVA HYN++KVA LLL+N A  K  AKNGYTPLHIAAKKN  ++A  LL   AD NA+SR GF+PL L++QEGH ++  LL+++ +DV  KA NGLT+MHL AQED V VA+IL + GA+I   T A YTPLH A HFGQ+NM K+L+   +   + +KT+  +TPLH AAQQGH   V  LLE+ A PN +   G T   IA++  Y+++ E LR VT   +  E    +        +   M E   S+SEDEG+
Sbjct:   31 AEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVT--SKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVE--NGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQNPEA--MNETMFSESEDEGQ 847          

HSP 2 Score: 469.929 bits (1208), Expect = 1.193e-134
Identity = 280/628 (44.59%), Postives = 392/628 (62.42%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSF--ERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-----SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVK---DIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLP---SEIH---PVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVK-------NCMINISFVTDEDEKSQALK 5052
            +NVPI        FL+SF+VDARGG M+  R + +R  VPP  A  P R+ CR ++  K+  PP L++G+  A RI+EM P   +F  P+++EVPH+ASLRDREREI+ILRS++G+ WKEH +EAT+ A+Q  +  SF  E L   ++++  RI RILTSD P YFA+++R+RQEV  +GPEG V+ SSVVP+VQA+FP+G+L K  +V +QA  +P E+VTRL GNRVA SPI+++EPRRRKFHKPITL +PLP++ N+GM+    SG       +LRLLCSITGGSAPA WEDI+G+T L+F  D VSFTTTVSAR WL+DC   +  A MA  VY E+  +PYM +F V+ RR    E Q R+  +TDD  DKTLE QE+F+LIA    VEVL  +  ++E +GNLVP+TK+GDQLS+      ENR++F+V+ +   D +   +G++  +   + +     +AL     Q+PI TL I LP    EI    P    L   + + G  ++  +        E   + V   IG DW +L  AL +    D+ +IR N   +     L I    K+ D A  + L++ALR IGR+D+V+       + +IN S      +K + ++
Sbjct:  989 DNVPIGHHVTQPSFLISFLVDARGGAMRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQ-YSGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGFMAEPKIR----SDAL---PPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEKDL-------PEFVHQNVLKGIGADWPRLGRALEVP-HRDIQHIRQNYPGQECKNTLKIWIHLKKED-ANQDNLDQALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIR 1599          

HSP 3 Score: 177.563 bits (449), Expect = 7.959e-44
Identity = 127/396 (32.07%), Postives = 208/396 (52.53%), Query Frame = 1
Query: 1339 LQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKV-----------------------------AQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRK 2439
            +Q  A  E G   G  +   A R    E V  LL+AG   +         LH+A+K G+ E++   ++  +  + ATR   TALH+A+  G+S  +++L+++GA +  ++  GFTPL++AA+ +   V   LL+  AN   + ++G TPL VA    H++V                             A LLL N+ +P   +K+G+TPLHIAA   ++++  +LL   A+ N ++R+  SPL +A++ G T++ +LLL   A ++ + K+ LT +H  A+     V  +LV  GA I+  T     PLH AA    ++ A+ L  L  +  ++  T    TPLH+AA  GH+++  LLL+  ADPN +   G+T  HIA K++ + + E+L K
Sbjct:   20 VQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL--LYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLK 413          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0344224)

HSP 1 Score: 956.051 bits (2470), Expect = 0.000e+0
Identity = 473/830 (56.99%), Postives = 622/830 (74.94%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEG 2556
            M   N    + N SFLRAARAGNL +V++ L+   DINT N  GL+ALHLA+K+GHI +V EL++R   +D+ TKKGN+ALHIASLAG+ EVVK+L+E+ A+VN+QS NGFTPLYMAAQENH  VV  L++NGA+Q++ TEDGFTPLAVA+QQGH+++VA+LLE+D R K RLPALHIA KK+DV A  LLL N    DV   S SGFTPLHIA+HYGN+  A LLI++ ADVN+ AK+NI+PLHVAAKWG++ MV LL++ G  +  +TRDGLTPLHC+ARSGH Q+ + L++ GA + +KT+NGL  LHMAAQG+  D ARILL  RA ++E T D+LT LHV AH G+ +VA++LLDR  D NARALNGFTPLHIACKK+++K+VELLL++GA I ATTE+GLTPLHV+AF+G    V  LLQ  A+ +  T+RGET LHLA R NQT+ +++LL+ GA  DA+ARE QTPLH+A+++GN++++ L LQ G+  +  T+D YTALH+AAKEG+ E  ++L+++GA ++A TK+GFTPLH+ AKY  + VA +LLQK+A+ +A GKNG+TPLHVA HYN+++VA LLL+  A P   AKNG+TPLHIAA+KN  D+A  LL   A +NAES+ GF+PL L+SQEGH ++ +LL++HKA VNH AKNGLT MHL AQED V VA IL   GA+I   T A YTPLH A+HFGQ NM ++L  L +   ++  T +G+TPLH  AQQGH  +VNLLLE +A+ N +   G T  HIARK  Y+++ + L+ +T E  +     +  E+  ++     M E  +SDSE+EG
Sbjct:    1 MVTENGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVT--SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFL--LQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEA-MHESFMSDSEEEG 825          

HSP 2 Score: 480.715 bits (1236), Expect = 3.094e-135
Identity = 269/584 (46.06%), Postives = 381/584 (65.24%), Query Frame = 1
Query: 3274 GFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFE--RLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSEL--DLRAV--ADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYS--AYALLILWRSKRG-DLACGNELEKALRDIGREDVVKNC 4998
             FLVSF+VDARGG M+  R + +R  +P  S   PTR+ CR +KP +   PP L +G+  A R++E+GPC+T+F  P+++EVPH+ASLR +EREIIILRS+NGETW+EH I+ +++ I + +   FE   +   EE   N + R +T D PQYFA++SRIRQEV  IGPEG ++SS+VVPQVQAVFP+GAL KK +VG+QA  +  ++  +LLG  VA SPI+++EPRRRKFHK ITL++P PK  ++GMIN  +  T +LRLLCSITGG + A WED++GSTPL+F  DCVSFTTTVSAR WL+DC N+    +MAT +Y+E   VP++ +FVV+ ++ +  EA+ R+  +TDD  DKTLE  E +  +A    VEVL  +P +IE AGNLVPVTK+GDQL +  +A  ENR+ F VRVKD   +  G+    L  +   +  G        Q+PI  L I LP  + P S T    ++ T  +  +     K        D+R V  ++ +G DW +LA  +GI + E++  I N ++D  +  A +++ L++ K   D+     LE AL++IGR+D++K C
Sbjct:  927 SFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGR---TLFMKEPKVAKGE-----PPQQPICILNIVLPEAVIPDSTTAFSDRV-TSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGI-NGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS---LETALKNIGRDDIMKKC 1497          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303125)

HSP 1 Score: 955.281 bits (2468), Expect = 0.000e+0
Identity = 473/830 (56.99%), Postives = 622/830 (74.94%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEG 2556
            M   N    + N SFLRAARAGNL +V++ L+   DINT N  GL+ALHLA+K+GHI +V EL++R   +D+ TKKGN+ALHIASLAG+ EVVK+L+E+ A+VN+QS NGFTPLYMAAQENH  VV  L++NGA+Q++ TEDGFTPLAVA+QQGH+++VA+LLE+D R K RLPALHIA KK+DV A  LLL N    DV   S SGFTPLHIA+HYGN+  A LLI++ ADVN+ AK+NI+PLHVAAKWG++ MV LL++ G  +  +TRDGLTPLHC+ARSGH Q+ + L++ GA + +KT+NGL  LHMAAQG+  D ARILL  RA ++E T D+LT LHV AH G+ +VA++LLDR  D NARALNGFTPLHIACKK+++K+VELLL++GA I ATTE+GLTPLHV+AF+G    V  LLQ  A+ +  T+RGET LHLA R NQT+ +++LL+ GA  DA+ARE QTPLH+A+++GN++++ L LQ G+  +  T+D YTALH+AAKEG+ E  ++L+++GA ++A TK+GFTPLH+ AKY  + VA +LLQK+A+ +A GKNG+TPLHVA HYN+++VA LLL+  A P   AKNG+TPLHIAA+KN  D+A  LL   A +NAES+ GF+PL L+SQEGH ++ +LL++HKA VNH AKNGLT MHL AQED V VA IL   GA+I   T A YTPLH A+HFGQ NM ++L  L +   ++  T +G+TPLH  AQQGH  +VNLLLE +A+ N +   G T  HIARK  Y+++ + L+ +T E  +     +  E+  ++     M E  +SDSE+EG
Sbjct:    1 MVTENGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVT--SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFL--LQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEA-MHESFMSDSEEEG 825          

HSP 2 Score: 481.1 bits (1237), Expect = 2.343e-135
Identity = 269/584 (46.06%), Postives = 381/584 (65.24%), Query Frame = 1
Query: 3274 GFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFE--RLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSEL--DLRAV--ADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYS--AYALLILWRSKRG-DLACGNELEKALRDIGREDVVKNC 4998
             FLVSF+VDARGG M+  R + +R  +P  S   PTR+ CR +KP +   PP L +G+  A R++E+GPC+T+F  P+++EVPH+ASLR +EREIIILRS+NGETW+EH I+ +++ I + +   FE   +   EE   N + R +T D PQYFA++SRIRQEV  IGPEG ++SS+VVPQVQAVFP+GAL KK +VG+QA  +  ++  +LLG  VA SPI+++EPRRRKFHK ITL++P PK  ++GMIN  +  T +LRLLCSITGG + A WED++GSTPL+F  DCVSFTTTVSAR WL+DC N+    +MAT +Y+E   VP++ +FVV+ ++ +  EA+ R+  +TDD  DKTLE  E +  +A    VEVL  +P +IE AGNLVPVTK+GDQL +  +A  ENR+ F VRVKD   +  G+    L  +   +  G        Q+PI  L I LP  + P S T    ++ T  +  +     K        D+R V  ++ +G DW +LA  +GI + E++  I N ++D  +  A +++ L++ K   D+     LE AL++IGR+D++K C
Sbjct:  927 SFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGR---TLFMKEPKVAKGE-----PPQQPICILNIVLPEAVIPDSTTAFSDRV-TSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGI-NGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS---LETALKNIGRDDIMKKC 1497          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303113)

HSP 1 Score: 946.806 bits (2446), Expect = 0.000e+0
Identity = 473/830 (56.99%), Postives = 622/830 (74.94%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEG 2556
            M   N    + N SFLRAARAGNL +V++ L+   DINT N  GL+ALHLA+K+GHI +V EL++R   +D+ TKKGN+ALHIASLAG+ EVVK+L+E+ A+VN+QS NGFTPLYMAAQENH  VV  L++NGA+Q++ TEDGFTPLAVA+QQGH+++VA+LLE+D R K RLPALHIA KK+DV A  LLL N    DV   S SGFTPLHIA+HYGN+  A LLI++ ADVN+ AK+NI+PLHVAAKWG++ MV LL++ G  +  +TRDGLTPLHC+ARSGH Q+ + L++ GA + +KT+NGL  LHMAAQG+  D ARILL  RA ++E T D+LT LHV AH G+ +VA++LLDR  D NARALNGFTPLHIACKK+++K+VELLL++GA I ATTE+GLTPLHV+AF+G    V  LLQ  A+ +  T+RGET LHLA R NQT+ +++LL+ GA  DA+ARE QTPLH+A+++GN++++ L LQ G+  +  T+D YTALH+AAKEG+ E  ++L+++GA ++A TK+GFTPLH+ AKY  + VA +LLQK+A+ +A GKNG+TPLHVA HYN+++VA LLL+  A P   AKNG+TPLHIAA+KN  D+A  LL   A +NAES+ GF+PL L+SQEGH ++ +LL++HKA VNH AKNGLT MHL AQED V VA IL   GA+I   T A YTPLH A+HFGQ NM ++L  L +   ++  T +G+TPLH  AQQGH  +VNLLLE +A+ N +   G T  HIARK  Y+++ + L+ +T E  +     +  E+  ++     M E  +SDSE+EG
Sbjct:    1 MVTENGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVT--SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFL--LQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEA-MHESFMSDSEEEG 825          

HSP 2 Score: 484.182 bits (1245), Expect = 1.377e-136
Identity = 271/592 (45.78%), Postives = 384/592 (64.86%), Query Frame = 1
Query: 3250 IVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFE--RLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSEL--DLRAV--ADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYS--AYALLILWRSKRG-DLACGNELEKALRDIGREDVVKNC 4998
            + RK     FLVSF+VDARGG M+  R + +R  +P  S   PTR+ CR +KP +   PP L +G+  A R++E+GPC+T+F  P+++EVPH+ASLR +EREIIILRS+NGETW+EH I+ +++ I + +   FE   +   EE   N + R +T D PQYFA++SRIRQEV  IGPEG ++SS+VVPQVQAVFP+GAL KK +VG+QA  +  ++  +LLG  VA SPI+++EPRRRKFHK ITL++P PK  ++GMIN  +  T +LRLLCSITGG + A WED++GSTPL+F  DCVSFTTTVSAR WL+DC N+    +MAT +Y+E   VP++ +FVV+ ++ +  EA+ R+  +TDD  DKTLE  E +  +A    VEVL  +P +IE AGNLVPVTK+GDQL +  +A  ENR+ F VRVKD   +  G+    L  +   +  G        Q+PI  L I LP  + P S T    ++ T  +  +     K        D+R V  ++ +G DW +LA  +GI + E++  I N ++D  +  A +++ L++ K   D+     LE AL++IGR+D++K C
Sbjct:  919 VGRKLSWKSFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGR---TLFMKEPKVAKGE-----PPQQPICILNIVLPEAVIPDSTTAFSDRV-TSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGI-NGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS---LETALKNIGRDDIMKKC 1497          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303123)

HSP 1 Score: 946.421 bits (2445), Expect = 0.000e+0
Identity = 473/830 (56.99%), Postives = 622/830 (74.94%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEG 2556
            M   N    + N SFLRAARAGNL +V++ L+   DINT N  GL+ALHLA+K+GHI +V EL++R   +D+ TKKGN+ALHIASLAG+ EVVK+L+E+ A+VN+QS NGFTPLYMAAQENH  VV  L++NGA+Q++ TEDGFTPLAVA+QQGH+++VA+LLE+D R K RLPALHIA KK+DV A  LLL N    DV   S SGFTPLHIA+HYGN+  A LLI++ ADVN+ AK+NI+PLHVAAKWG++ MV LL++ G  +  +TRDGLTPLHC+ARSGH Q+ + L++ GA + +KT+NGL  LHMAAQG+  D ARILL  RA ++E T D+LT LHV AH G+ +VA++LLDR  D NARALNGFTPLHIACKK+++K+VELLL++GA I ATTE+GLTPLHV+AF+G    V  LLQ  A+ +  T+RGET LHLA R NQT+ +++LL+ GA  DA+ARE QTPLH+A+++GN++++ L LQ G+  +  T+D YTALH+AAKEG+ E  ++L+++GA ++A TK+GFTPLH+ AKY  + VA +LLQK+A+ +A GKNG+TPLHVA HYN+++VA LLL+  A P   AKNG+TPLHIAA+KN  D+A  LL   A +NAES+ GF+PL L+SQEGH ++ +LL++HKA VNH AKNGLT MHL AQED V VA IL   GA+I   T A YTPLH A+HFGQ NM ++L  L +   ++  T +G+TPLH  AQQGH  +VNLLLE +A+ N +   G T  HIARK  Y+++ + L+ +T E  +     +  E+  ++     M E  +SDSE+EG
Sbjct:    1 MVTENGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVT--SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFL--LQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEA-MHESFMSDSEEEG 825          

HSP 2 Score: 483.411 bits (1243), Expect = 2.201e-136
Identity = 271/592 (45.78%), Postives = 384/592 (64.86%), Query Frame = 1
Query: 3250 IVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFE--RLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSEL--DLRAV--ADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYS--AYALLILWRSKRG-DLACGNELEKALRDIGREDVVKNC 4998
            + RK     FLVSF+VDARGG M+  R + +R  +P  S   PTR+ CR +KP +   PP L +G+  A R++E+GPC+T+F  P+++EVPH+ASLR +EREIIILRS+NGETW+EH I+ +++ I + +   FE   +   EE   N + R +T D PQYFA++SRIRQEV  IGPEG ++SS+VVPQVQAVFP+GAL KK +VG+QA  +  ++  +LLG  VA SPI+++EPRRRKFHK ITL++P PK  ++GMIN  +  T +LRLLCSITGG + A WED++GSTPL+F  DCVSFTTTVSAR WL+DC N+    +MAT +Y+E   VP++ +FVV+ ++ +  EA+ R+  +TDD  DKTLE  E +  +A    VEVL  +P +IE AGNLVPVTK+GDQL +  +A  ENR+ F VRVKD   +  G+    L  +   +  G        Q+PI  L I LP  + P S T    ++ T  +  +     K        D+R V  ++ +G DW +LA  +GI + E++  I N ++D  +  A +++ L++ K   D+     LE AL++IGR+D++K C
Sbjct:  919 VGRKLSWKSFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGR---TLFMKEPKVAKGE-----PPQQPICILNIVLPEAVIPDSTTAFSDRV-TSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGI-NGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS---LETALKNIGRDDIMKKC 1497          
BLAST of Ankyrin vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303114)

HSP 1 Score: 946.421 bits (2445), Expect = 0.000e+0
Identity = 473/830 (56.99%), Postives = 622/830 (74.94%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEG 2556
            M   N    + N SFLRAARAGNL +V++ L+   DINT N  GL+ALHLA+K+GHI +V EL++R   +D+ TKKGN+ALHIASLAG+ EVVK+L+E+ A+VN+QS NGFTPLYMAAQENH  VV  L++NGA+Q++ TEDGFTPLAVA+QQGH+++VA+LLE+D R K RLPALHIA KK+DV A  LLL N    DV   S SGFTPLHIA+HYGN+  A LLI++ ADVN+ AK+NI+PLHVAAKWG++ MV LL++ G  +  +TRDGLTPLHC+ARSGH Q+ + L++ GA + +KT+NGL  LHMAAQG+  D ARILL  RA ++E T D+LT LHV AH G+ +VA++LLDR  D NARALNGFTPLHIACKK+++K+VELLL++GA I ATTE+GLTPLHV+AF+G    V  LLQ  A+ +  T+RGET LHLA R NQT+ +++LL+ GA  DA+ARE QTPLH+A+++GN++++ L LQ G+  +  T+D YTALH+AAKEG+ E  ++L+++GA ++A TK+GFTPLH+ AKY  + VA +LLQK+A+ +A GKNG+TPLHVA HYN+++VA LLL+  A P   AKNG+TPLHIAA+KN  D+A  LL   A +NAES+ GF+PL L+SQEGH ++ +LL++HKA VNH AKNGLT MHL AQED V VA IL   GA+I   T A YTPLH A+HFGQ NM ++L  L +   ++  T +G+TPLH  AQQGH  +VNLLLE +A+ N +   G T  HIARK  Y+++ + L+ +T E  +     +  E+  ++     M E  +SDSE+EG
Sbjct:    1 MVTENGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVT--SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFL--LQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAAPSQAEEKYRVVAPEA-MHESFMSDSEEEG 825          

HSP 2 Score: 484.182 bits (1245), Expect = 1.469e-136
Identity = 271/592 (45.78%), Postives = 384/592 (64.86%), Query Frame = 1
Query: 3250 IVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFE--RLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSEL--DLRAV--ADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYS--AYALLILWRSKRG-DLACGNELEKALRDIGREDVVKNC 4998
            + RK     FLVSF+VDARGG M+  R + +R  +P  S   PTR+ CR +KP +   PP L +G+  A R++E+GPC+T+F  P+++EVPH+ASLR +EREIIILRS+NGETW+EH I+ +++ I + +   FE   +   EE   N + R +T D PQYFA++SRIRQEV  IGPEG ++SS+VVPQVQAVFP+GAL KK +VG+QA  +  ++  +LLG  VA SPI+++EPRRRKFHK ITL++P PK  ++GMIN  +  T +LRLLCSITGG + A WED++GSTPL+F  DCVSFTTTVSAR WL+DC N+    +MAT +Y+E   VP++ +FVV+ ++ +  EA+ R+  +TDD  DKTLE  E +  +A    VEVL  +P +IE AGNLVPVTK+GDQL +  +A  ENR+ F VRVKD   +  G+    L  +   +  G        Q+PI  L I LP  + P S T    ++ T  +  +     K        D+R V  ++ +G DW +LA  +GI + E++  I N ++D  +  A +++ L++ K   D+     LE AL++IGR+D++K C
Sbjct:  919 VGRKLSWKSFLVSFLVDARGGAMRGCRHSGVRMIIPSRSTCQPTRVTCRYVKPQRTMHPPQLMEGEALASRVLELGPCSTKFIGPVVMEVPHFASLRGKEREIIILRSDNGETWREHTIDNSEEIIHDVLQQCFEPEEIAQLEEQAGNHVCRFVTYDFPQYFAVVSRIRQEVHAIGPEGGMVSSTVVPQVQAVFPQGALTKKIKVGLQAQPVDPDLTAKLLGRGVAVSPIVTVEPRRRKFHKAITLSMPAPKAHSQGMINQYSGNTPTLRLLCSITGGPSRAQWEDVTGSTPLTFVNDCVSFTTTVSARFWLMDCRNISDATKMATELYKEVIHVPFIAKFVVFAKKVEPFEAKLRVFCMTDDREDKTLEKHELYTEVAKSRDVEVLEGKPQYIEMAGNLVPVTKSGDQLQVQFKAFRENRLPFTVRVKDQHADIVGR---TLFMKEPKVAKGE-----PPQQPICILNIVLPEAVIPDSTTAFSDRV-TSAYRTSMFSLSKHQNDHYIGDIRIVDLSNLLGKDWIQLAPEIGI-NGEEIDEIINQNTDSIARQAQSMIRLYKDKPNYDILS---LETALKNIGRDDIMKKC 1497          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 447/797 (56.09%), Postives = 590/797 (74.03%), Query Frame = 1
Query:   76 KSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            K   + S+SN S+LRAARAGNL KV+D+L+TG DIN CN  GL+ALHLA+KEGH+ +V EL+K    +DA TKKGN+ALHIASLAG+ EVV+ LV NGANVN QS NGFTPLYMAAQENHL+VV FL+ N + Q+I TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  +  LLL +       S++ VN  + SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G   MV+LL+D G+ +  +T+DGLTPLHC ARSGH Q+ E L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL   A +++ T D+LT LHV AH G+ KVA+V++D++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA ++A TE+GLTP+HV+AF+G +  V  L   GA+     +RGETALH+A R  Q + V+ LL+ GA  D KA+++QT LH+A+++G LE++   LQ G+ PN AT   YT LH++A+EG  E  +LLL+ G+ + A TK+GFTPLH+AAKY ++ VA++LLQKKA P+A GK+GLTPLHVA HY++++VA LLLD  A P   AKNGYTPLHIAAKKN  ++   LL   A+ N  +R G SPL LA+QEG  D+VSLLL  +A+VN   KNGLT +HL AQ+DK  V  +L++ GA+I   T + YTPLH A H+G + MA +L  L +Q + N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IAR+  Y+++ + LR VT
Sbjct:   17 KKKGKKSDSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFL--LENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVT 811          

HSP 2 Score: 420.624 bits (1080), Expect = 3.813e-117
Identity = 212/437 (48.51%), Postives = 291/437 (66.59%), Query Frame = 1
Query: 3271 SGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLP----KTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            S FLVSFMVDARGG M+  R   +R  VPP     PTR+ CRL K  ++  PP + +G+G   R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRS+NGETWKEH  +     + + +    E + +  E+   RI RI+T D PQYFA++SRI+QE   +GPEG V++S  VP V+A FP+GAL KK RVG+QA  +P ++V  ++GNR + SPI+++EPRRRKFHKPIT+T+P+P    + V  G   +P      LRLLCSITGG++PA WEDI+G+TPLSF  DCVSFTT VSAR WL DC  +     +A+ +YRE   VPY+ +FVV+ +  D  E   R   +TDD VDKTLE QENF+ +A    +E+L  +P   E  GN+ P+ K+G QL     A  ENR+ F ++V+DI QEP G+++ L
Sbjct:  965 SRFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEP---APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFL 1398          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 447/792 (56.44%), Postives = 589/792 (74.37%), Query Frame = 1
Query:   73 TKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            ++   + S+SN S+LRAARAGNL KV+D+L+TG DIN CN  GL+ALHLA+KEGH+ +V EL+K    +DA TKKGN+ALHIASLAG+ EVV+ LV NGANVN QS NGFTPLYMAAQENHL+VV FL+ N + Q+I TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  +  LLL N    DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G   MV+LL+D G+ +  +T+DGLTPLHC ARSGH Q+ E L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL   A +++ T D+LT LHV AH G+ KVA+V++D++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA ++A TE+GLTP+HV+AF+G +  V  L   GA+     +RGETALH+A R  Q + V+ LL+ GA  D KA+++QT LH+A+++G LE++   LQ G+ PN AT   YT LH++A+EG  E  +LLL+ G+ + A TK+GFTPLH+AAKY ++ VA++LLQKKA P+A GK+GLTPLHVA HY++++VA LLLD  A P   AKNGYTPLHIAAKKN  ++   LL   A+ N  +R G SPL LA+QEG  D+VSLLL  +A+VN   KNGLT +HL AQ+DK  V  +L++ GA+I   T + YTPLH A H+G + MA +L  L +Q + N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IAR+  Y+++ + LR VT
Sbjct:   33 SRDQKKKSDSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADV--ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFL--LENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVT 820          

HSP 2 Score: 446.432 bits (1147), Expect = 3.711e-127
Identity = 250/600 (41.67%), Postives = 353/600 (58.83%), Query Frame = 1
Query: 3253 VRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLP----KTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPV-------SDTLRRKKM------KTGEFIKTTICTDKIAKSELDLRA--VADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLIL--WRSKRGDLACGNELEKALRDIGREDVV 4989
            V  PV SGFLVSFMVDARGG M+  R   +R  VPP     PTR+ CRL K  ++  PP + +G+G   R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRS+NGETWKEH  +     + + +    E + +  E+   RI RI+T D PQYFA++SRI+QE   +GPEG V++S  VP V+A FP+GAL KK RVG+QA  +P ++V  ++GNR + SPI+++EPRRRKFHKPIT+T+P+P    + V  G   +P      LRLLCSITGG++PA WEDI+G+TPLSF  DCVSFTT VSAR WL DC  +     +A+ +YRE   VPY+ +FVV+ +  D  E   R   +TDD VDKTLE QENF+ +A    +E+L  +P   E  GN+ P+ K+G QL     A  ENR+ F ++V+DI QEP G+++ L   +               Q  I  L   LP+    +       +D  RR         K   ++     + +      DLR   VAD +G  W +LA  +  S  E +++IR  + +  +A + ++L  W S+ G  A  + L   L  + R D+V
Sbjct:  969 VCSPVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEP---APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFLREPKT---------AKGLPQSAICNLNFTLPTHRKEMESDPDDENDKDRRHTFASLALRKRYSYLADPASSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDE-INHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAVLTKVNRMDIV 1555          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 886.33 bits (2289), Expect = 0.000e+0
Identity = 447/792 (56.44%), Postives = 589/792 (74.37%), Query Frame = 1
Query:   73 TKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            ++   + S+SN S+LRAARAGNL KV+D+L+TG DIN CN  GL+ALHLA+KEGH+ +V EL+K    +DA TKKGN+ALHIASLAG+ EVV+ LV NGANVN QS NGFTPLYMAAQENHL+VV FL+ N + Q+I TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  +  LLL N    DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G   MV+LL+D G+ +  +T+DGLTPLHC ARSGH Q+ E L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL   A +++ T D+LT LHV AH G+ KVA+V++D++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA ++A TE+GLTP+HV+AF+G +  V  L   GA+     +RGETALH+A R  Q + V+ LL+ GA  D KA+++QT LH+A+++G LE++   LQ G+ PN AT   YT LH++A+EG  E  +LLL+ G+ + A TK+GFTPLH+AAKY ++ VA++LLQKKA P+A GK+GLTPLHVA HY++++VA LLLD  A P   AKNGYTPLHIAAKKN  ++   LL   A+ N  +R G SPL LA+QEG  D+VSLLL  +A+VN   KNGLT +HL AQ+DK  V  +L++ GA+I   T + YTPLH A H+G + MA +L  L +Q + N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IAR+  Y+++ + LR VT
Sbjct:   33 SRDQKKKSDSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADV--ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFL--LENQAKPNAKTKNGYTPLHQAAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVT 820          

HSP 2 Score: 446.432 bits (1147), Expect = 3.711e-127
Identity = 250/600 (41.67%), Postives = 353/600 (58.83%), Query Frame = 1
Query: 3253 VRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLP----KTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPV-------SDTLRRKKM------KTGEFIKTTICTDKIAKSELDLRA--VADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLIL--WRSKRGDLACGNELEKALRDIGREDVV 4989
            V  PV SGFLVSFMVDARGG M+  R   +R  VPP     PTR+ CRL K  ++  PP + +G+G   R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRS+NGETWKEH  +     + + +    E + +  E+   RI RI+T D PQYFA++SRI+QE   +GPEG V++S  VP V+A FP+GAL KK RVG+QA  +P ++V  ++GNR + SPI+++EPRRRKFHKPIT+T+P+P    + V  G   +P      LRLLCSITGG++PA WEDI+G+TPLSF  DCVSFTT VSAR WL DC  +     +A+ +YRE   VPY+ +FVV+ +  D  E   R   +TDD VDKTLE QENF+ +A    +E+L  +P   E  GN+ P+ K+G QL     A  ENR+ F ++V+DI QEP G+++ L   +               Q  I  L   LP+    +       +D  RR         K   ++     + +      DLR   VAD +G  W +LA  +  S  E +++IR  + +  +A + ++L  W S+ G  A  + L   L  + R D+V
Sbjct:  969 VCSPVHSGFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEP---APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFLREPKT---------AKGLPQSAICNLNFTLPTHRKEMESDPDDENDKDRRHTFASLALRKRYSYLADPASSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDE-INHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAVLTKVNRMDIV 1555          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: ank2b (ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041010-165])

HSP 1 Score: 879.782 bits (2272), Expect = 0.000e+0
Identity = 438/785 (55.80%), Postives = 583/785 (74.27%), Query Frame = 1
Query:   88 ENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGK-NGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            + S+SN SFLRAARAGN+ KV+++L+ G DI T N  GL+ALHLAAKEGH+ +V+EL+ R   +D+ TKKGN+ALHIASLAG+ +VVKIL + GAN+N QS NGFTPLYMA+QENHL+VV +L+ NG +Q+I TEDGFTPLA+ALQQGH ++V++LLEND + K RLPALHIA +K+D  +  LLL N    DV  QS SGFTPLHIAAHYGN   A LL+ + A V+F A+N ITPLHVA+K G + MV LL+D GA +  +TRDGLTPLHC+ARSGH    E L++ GA ++++T+NGL+ LHMAAQGD  +  + LL  +A +++ T D+LT LHV AH G+ +V ++LLD+R +PNARALNGFTPLHIACKK+++K++ELL+KYGA I+A TE+GLTP+HV+AF+G    V +LLQ GA+ +   +RGETALH+A R  Q E V+ LL+ GA+ DA+ARE+QTPLH+A+++G  E++ L LQ  + P+ AT + YT LH+AA+EG  +  ++LL++GA     TK+GFTPLH+A+KY  + VA +LLQ++A P++ GK NGLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  ++A  LL   A++N +++ G  P+ LASQEGH+++ +LLLQ  A VN   K+GLTS+HL AQEDKV V  ILV  GA++   T   YTPL  A H+G   M  +L  L     +N KT+ G+TPLH AAQQG+  ++N+LL+  A PN   N G TA  IAR+  Y+++ + LR
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSSVDSATKKGNTALHIASLAGQGDVVKILSKRGANINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADV--QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATANGYTPLHIAAREGHLDVTTVLLEAGAAHSLATKKGFTPLHVASKYGSLEVAKLLLQRRAPPDSAGKQNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYGAETNIQTKQGVMPIHLASQEGHSEMAALLLQRGAQVNVTTKSGLTSLHLAAQEDKVGVGEILVKQGANLDQQTKLGYTPLIVACHYGNAKMVNFL--LKSGASVNDKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITN-GNTALAIARRLGYISVVDTLR 807          

HSP 2 Score: 440.269 bits (1131), Expect = 3.619e-123
Identity = 231/492 (46.95%), Postives = 316/492 (64.23%), Query Frame = 1
Query: 3214 KSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKM---------------------------------NSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSG-TSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRN 4584
            K  W+ E  +N+ +   P  SGFLVSFMVDARGG M+  R   LR  +PP     PTR+ CRL+K  ++                                  +PP LN+G+    RI+++GP  T+F  P+++E+PH+A+LR +ERE++ILRSE GE+WKEH  E T++ +   +    ERL   EE+   RI RI+T D PQYFA++SRI+Q+  LIGPEG V+SS+VVP+VQAVFPEGAL K+ RVG+Q   + V++V  +LGN+   SPI+++EPRRRKFHKPIT+T+P+PK+     +     G T +LRLLCSITGG+ PA WEDI+G+TPL+F  DCVSFTT VSAR WLIDC  VQ     AT +YRE   VPYM +FV++ + HD  EA+ R   +TDD +DKTLE QENF  +A    VEVL  +P +++  GNLVP+TK+G     +  A  ENR++  ++++D  QEP G+L+     R+
Sbjct:  922 KDSWETENLDNIALSSSPAHSGFLVSFMVDARGGAMRGCRHNGLRLIIPPRKCSAPTRVTCRLVKRHRLATMPPMVEGDGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVILRSETGESWKEHHCEYTEEELNQVLNGMDERLDPPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPEVQAVFPEGALTKRIRVGLQTQPMSVDVVRNMLGNKATFSPIVTLEPRRRKFHKPITMTIPVPKSSADPALGSFGGGETPTLRLLCSITGGTTPAQWEDITGTTPLTFTNDCVSFTTNVSARFWLIDCRQVQESVNFATLMYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKMDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHVFSFYAFKENRLALFIKIRDNTQEPCGRLSFTKEPRS 1413          
BLAST of Ankyrin vs. Ensembl Zebrafish
Match: BX469921.1 (ankyrin 3a [Source:NCBI gene;Acc:103909035])

HSP 1 Score: 876.315 bits (2263), Expect = 0.000e+0
Identity = 441/796 (55.40%), Postives = 586/796 (73.62%), Query Frame = 1
Query:   94 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQL---GFTPX--XXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            S+SN S+LRAARAGNL KV+D+L+TG DIN CN  GL+ALHLA+KEGH+ +V EL+K    +DA TKKGN+ALHIASLAG+ EVV+ LV NGANVN QS NGFTPLYMAAQENHL+VV FL+ N + Q+I TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  +  LLL +       S++ VN  + SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G   MV+LL+D G+ +  +T+DGLTPLHC ARSGH Q+ E L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL   A +++ T D+LT LHV AH G+ KVA+V++D++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA ++A TE+GLTP+HV+AF+G +  V  L   GA+     +RGETALH+A R  Q + V+ LL+ GA  D KA+++QT LH+A+++G LE++   LQ G+ PN AT   YT LH++A+EG  E  +LLL+ G+ + A TK+GFTPLH+AAKY ++ VA++LLQKKA P+A GK+GLTPLHVA HY++++VA LLLD  A P   AKNGYTPLHIAAKKN  ++   LL   A+ N  +R G SPL LA+QEG  D+VSLLL  +A+VN   KNGLT +HL AQ+DK  V  +L++ GA+I   T + YTPLH A H+G + MA +L  L +Q + N KT++   G+  +    +AQQGH  ++N+LL+  A PN     G TA  IAR+  Y+++ + LR VT
Sbjct:   18 SDSNASYLRAARAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLLLDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNAPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYGAECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFL--LENQAKPNAKTKVIVNGYFDMLIPFSAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTLRGVT 811          

HSP 2 Score: 348.977 bits (894), Expect = 2.553e-95
Identity = 187/437 (42.79%), Postives = 263/437 (60.18%), Query Frame = 1
Query: 3271 SGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLP----KTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            S FLVSFMVDARGG M+  R   +R  VPP     PTR+ CRL K  ++  PP + +G+G   R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRS+NGETWKEH  +     + + +    E + +  E+   RI RI+T D PQYFA++SRI+QE   +GPEG V++S  VP V+A FP+GAL KK RVG+QA  +P ++V  ++GNR + SPI+++EPRRRKFHKPIT+T+P+P    + V  G   +P      LRLLCSIT                     +            WL DC  +     +A+ +YRE   VPY+ +FVV+ +  D  E   R   +TDD VDKTLE QENF+ +A    +E+L  +P   E  GN+ P+ K+G QL     A  ENR+ F ++V+DI QEP G+++ L
Sbjct:  965 SRFLVSFMVDARGGSMRGSRHDGMRIIVPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSDNGETWKEHHYDCKVTELTSILNGMDEEMDSPAELEKKRICRIITKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVKAAFPQGALTKKIRVGLQAQPVPEDMVRTIIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRSKEAVANGRKGEP---APCLRLLCSIT--------------------VEYCVCVCVCVCVFWLADCQQISETVGLASQLYRELICVPYLAKFVVFAKMIDHIEFSMRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIHGECYGNIYPLAKSGQQLIFNFYAFKENRLPFNIKVRDIGQEPCGRISFL 1378          

HSP 3 Score: 187.193 bits (474), Expect = 2.243e-46
Identity = 134/443 (30.25%), Postives = 217/443 (48.98%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLEND----NRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHL 1398
            NT N     +   AARAG +  V   L+ G  ++       +ALH+A++ G + IV++L+++    +A T  G + LH+++  G  E+  +L+E G++++  +  GFTPL++AA+   LEV   L+   A      + G TPL VA    ++R+  LLL+      + +K     LHIA KKN +     LL     + N  +  G +PLH+AA  G+     LL+ ++A+VN   KN +TPLH+AA+  ++G+ ++L++ GA +  +T+ G TPLH +   G+ ++   L++N A   +KT+       +   G F                   D L P   +A  G+  +  +LL     PN   LNG T L IA +   I +V+ L   G   E  T T +T  H    I   E +N  L    +  +  M GET  +L
Sbjct:  447 NTTNVRGETALHMAARAGQIDVVRYLLQNGAKVDIKAKDDQTALHIASRLGKLEIVQQLLQKGALPNAATTSGYTPLHLSAREGHQEIAALLLEQGSSLSAATKKGFTPLHVAAKYGQLEVANLLLQKKAAPDAAGKSGLTPLHVAAHYDNQRVALLLLDQGASPHSPAKNGYTPLHIAAKKNQLEIGTTLLEYG-AECNTVTRQGISPLHLAAQEGSVDLVSLLLTKQANVNMGNKNGLTPLHLAAQDDKAGVTEVLLNHGAEIDAQTKSGYTPLHVACHYGNMKMANFLLENQAKPNAKTK-------VIVNGYF-------------------DMLIPF--SAQQGHTHIINMLLQYGASPNELTLNGNTALSIARRLGYISVVDTL--RGVTDENLTATPITEKHK---INVPETMNEFLDMSDDEGEDAMTGETEKYL 855          

HSP 4 Score: 160.614 bits (405), Expect = 2.314e-38
Identity = 115/333 (34.53%), Postives = 180/333 (54.05%), Query Frame = 1
Query: 1459 DAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQ--HKAD------VNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            D K+  N + L  A + GNLE +  +L++G D N+  ++   ALH+A+KEG  E ++ LL  GA ++A TK+G T LHIA+   +  V   L+   AN NA  +NG TPL++A   NH  V + LL+N +      ++G+TPL +A ++ +  +  +LL +D             L +A+++  T   +LLLQ  H AD      VN   ++G T +H+ A    + VA +L++ GA +      + TPLH A+  G  NM K L  L   ++I  KT+ G TPLH  A+ GH Q+V +LL+  A    K   G +  H+A +  +LN  ++L
Sbjct:   15 DRKSDSNASYLRAA-RAGNLEKVLDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGANVDAATKKGNTALHIASLAGQTEVVRELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRFLLENNSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKSAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVASKRGNGNMVKLL--LDRGSKIEAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 340          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 447/786 (56.87%), Postives = 590/786 (75.06%), Query Frame = 1
Query:   91 NSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            +S++N S+LRAAR+GNL K +D+L+ G DIN CN  GL+ALHLA+KEGH+ IV ELI+R   +DA+TKKGN+ALHIASLAG+ EVV++LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N    DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D G+ +  +TRDGLTPLHC ARSGH Q+   L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L   GA+     +RGETALH+A R  Q+E V+ LL+ GA  +AKA+++QTPLH++ ++G  +++   L+ G+ P+ AT   YT LH++++EG  +  S+LL+ GA     TK+GFTPLH+AAKY K+ V  +LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA ++ G +P+ LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V+VA +L + GA I  TT   YTPLH A+H+G I M  +L  L   +++N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IAR+  Y+++ + L+ VT
Sbjct:   16 HSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADV--ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFL--LQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVT 797          

HSP 2 Score: 461.07 bits (1185), Expect = 3.225e-129
Identity = 229/445 (51.46%), Postives = 309/445 (69.44%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGE WKEH  +   + +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG V+ S+ VP+VQA FPEGAL K+ RVG+QA  +P ++V +++GNR   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ SLRLLCSITGG++PA WEDI+G+TPL+F  DCVSFTT VSAR WL DC  +     +AT +YRE   VPYM +FVV+ + +D  EA+ R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     A  ENR+ F V+V+D  QEP G+L+ L
Sbjct:  945 DNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFL 1389          

HSP 3 Score: 186.422 bits (472), Expect = 6.284e-46
Identity = 119/358 (33.24%), Postives = 188/358 (52.51%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFL-ETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLEND----NRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVL 1140
            NT N     +   AARAG  S+V+ FL + G  +        + LH++A+ G   IV++L+K+    DA T  G + LH++S  G  +V  +L+E+GA+  + +  GFTPL++AA+   +EVV  L+   A      + G TPL VA    ++++  LLL+        +K     LHIA KKN ++    LL     D N  +  G  P+H+AA  G+     LL+ + A+VN   K+ +TPLH+AA+  R  + ++L + GA++   T+   TPLH ++  G+ ++   L+ +G+ V +KT+NG T LH AAQ        +LL   A+ NE T +  T L +    G   V   L
Sbjct:  438 NTTNVRGETALHMAARAGQ-SEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYG-ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 793          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 892.878 bits (2306), Expect = 0.000e+0
Identity = 446/791 (56.38%), Postives = 591/791 (74.72%), Query Frame = 1
Query:   94 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            S++N S+LRAAR+GNL K +D+L+ G DIN CN  GL+ALHLA+KEGH+ IV ELI+R   +DA+TKKGN+ALHIASLAG+ EVV++LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL +       S++ VN  + SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D G+ +  +TRDGLTPLHC ARSGH Q+   L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L   GA+     +RGETALH+A R  Q+E V+ LL+ GA  +AKA+++QTPLH++ ++G  +++   L+ G+ P+ AT   YT LH++++EG  +  S+LL+ GA     TK+GFTPLH+AAKY K+ V  +LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA ++ G +P+ LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V+VA +L + GA I  TT   YTPLH A+H+G I M  +L  L   +++N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IAR+  Y+++ + L+ VT
Sbjct:   25 SDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKMMVNRTTESGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFL--LQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVT 813          

HSP 2 Score: 444.506 bits (1142), Expect = 2.491e-124
Identity = 229/478 (47.91%), Postives = 310/478 (64.85%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCN---------------------------------TQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP                                   T+F  P+++E+PH+ S+R +ERE+I+LRSENGE WKEH  +   + +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG V+ S+ VP+VQA FPEGAL K+ RVG+QA  +P ++V +++GNR   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ SLRLLCSITGG++PA WEDI+G+TPL+F  DCVSFTT VSAR WL DC  +     +AT +YRE   VPYM +FVV+ + +D  EA+ R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     A  ENR+ F V+V+D  QEP G+L+ L
Sbjct:  939 DNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGKLHLPTNTPPVNEAESLISRILQLGPHGTKFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFL 1416          

HSP 3 Score: 187.963 bits (476), Expect = 1.654e-46
Identity = 124/391 (31.71%), Postives = 199/391 (50.90%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFL-ETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLEN----DNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELL 1239
            NT N     +   AARAG  S+V+ FL + G  +        + LH++A+ G   IV++L+K+    DA T  G + LH++S  G  +V  +L+E+GA+  + +  GFTPL++AA+   +EVV  L+   A      + G TPL VA    ++++  LLL+        +K     LHIA KKN ++    LL     D N  +  G  P+H+AA  G+     LL+ + A+VN   K+ +TPLH+AA+  R  + ++L + GA++   T+   TPLH ++  G+ ++   L+ +G+ V +KT+NG T LH AAQ        +LL   A+ NE T +  T L +    G   V   L               T + +  +KHK+ + E +
Sbjct:  454 NTTNVRGETALHMAARAGQ-SEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYG-ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL-------KVVTEETLTTVQLVTEKHKMNVPETM 835          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 892.493 bits (2305), Expect = 0.000e+0
Identity = 448/789 (56.78%), Postives = 591/789 (74.90%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            N+  S++N S+LRAAR+GNL K +D+L+ G DIN CN  GL+ALHLA+KEGH+ IV ELI+R   +DA+TKKGN+ALHIASLAG+ EVV++LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N    DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D G+ +  +TRDGLTPLHC ARSGH Q+   L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L   GA+     +RGETALH+A R  Q+E V+ LL+ GA  +AKA+++QTPLH++ ++G  +++   L+ G+ P+ AT   YT LH++++EG  +  S+LL+ GA     TK+GFTPLH+AAKY K+ V  +LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA ++ G +P+ LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V+VA +L + GA I  TT   YTPLH A+H+G I M  +L  L   +++N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IAR+  Y+++ + L+ VT
Sbjct:   20 NSPKSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADV--ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFL--LQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVT 804          

HSP 2 Score: 464.922 bits (1195), Expect = 3.744e-132
Identity = 262/615 (42.60%), Postives = 368/615 (59.84%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSG-----------FLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQR-NQGMGAGNALGTSAVQKPITTLEICLPS---EIHPVSDTLRRKKMKTGEFIKTTI-------------CTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLIL--WRSKRGDLACGNELEKALRDIGREDVV 4989
            +NV +V  PV SG           FLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGE WKEH  +   + +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG V+ S+ VP+VQA FPEGAL K+ RVG+QA  +P ++V +++GNR   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ SLRLLCSITGG++PA WEDI+G+TPL+F  DCVSFTT VSAR WL DC  +     +AT +YRE   VPYM +FVV+ + +D  EA+ R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     A  ENR+ F V+V+D  QEP G+L+ L   +  +G+           Q  +  L I LP+   E     D    K  +   F+   +                   ++++ +  VAD +G  W +LA  L  S  E ++ IR  + +  +A + ++L  W  + G  A  + L   L  I R D+V
Sbjct:  936 DNVNLVSSPVHSGYVSPLPQYDASFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKTTKGLP----------QTAVCNLNITLPTQKKETESDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDE-INQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIV 1539          

HSP 3 Score: 141.739 bits (356), Expect = 1.460e-32
Identity = 105/332 (31.63%), Postives = 172/332 (51.81%), Query Frame = 1
Query: 1531 LFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQ-------------------------------HKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            +F +  S  N    D   +   AA+ G  E     L +G  I    + G   LH+A+K   V + S L+Q+ A+ +A+ K G T LH+A+     +V ++L+ N A+   +++NG+TPL++AA++N+ ++   LL + A  +  + +GF+PL +A Q+GH  VVSLLL+                               H ADV  ++K+G T +H+ A    + VA +L++ GA +  T   + TPLH A+  G  NM K L+     ++I+ KT+ G TPLH  A+ GH Q+V +LL+  A    K   G +  H+A +  +LN  ++L
Sbjct:   11 VFQKISSPRNSPKSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADV--ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLD--RGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLL 338          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 892.108 bits (2304), Expect = 0.000e+0
Identity = 446/791 (56.38%), Postives = 590/791 (74.59%), Query Frame = 1
Query:   91 NSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQ-----SSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            +S++N S+LRAAR+GNL K +D+L+ G DIN CN  GL+ALHLA+KEGH+ IV ELI+R   +DA+TKKGN+ALHIASLAG+ EVV++LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N    DV  +     + SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D G+ +  +TRDGLTPLHC ARSGH Q+   L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L   GA+     +RGETALH+A R  Q+E V+ LL+ GA  +AKA+++QTPLH++ ++G  +++   L+ G+ P+ AT   YT LH++++EG  +  S+LL+ GA     TK+GFTPLH+AAKY K+ V  +LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA ++ G +P+ LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V+VA +L + GA I  TT   YTPLH A+H+G I M  +L  L   +++N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IAR+  Y+++ + L+ VT
Sbjct:   16 HSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKVCSRNTKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFL--LQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVT 804          

HSP 2 Score: 461.07 bits (1185), Expect = 2.987e-129
Identity = 229/445 (51.46%), Postives = 309/445 (69.44%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGE WKEH  +   + +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG V+ S+ VP+VQA FPEGAL K+ RVG+QA  +P ++V +++GNR   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ SLRLLCSITGG++PA WEDI+G+TPL+F  DCVSFTT VSAR WL DC  +     +AT +YRE   VPYM +FVV+ + +D  EA+ R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     A  ENR+ F V+V+D  QEP G+L+ L
Sbjct:  952 DNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFL 1396          

HSP 3 Score: 186.037 bits (471), Expect = 6.776e-46
Identity = 119/358 (33.24%), Postives = 188/358 (52.51%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFL-ETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLEND----NRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVL 1140
            NT N     +   AARAG  S+V+ FL + G  +        + LH++A+ G   IV++L+K+    DA T  G + LH++S  G  +V  +L+E+GA+  + +  GFTPL++AA+   +EVV  L+   A      + G TPL VA    ++++  LLL+        +K     LHIA KKN ++    LL     D N  +  G  P+H+AA  G+     LL+ + A+VN   K+ +TPLH+AA+  R  + ++L + GA++   T+   TPLH ++  G+ ++   L+ +G+ V +KT+NG T LH AAQ        +LL   A+ NE T +  T L +    G   V   L
Sbjct:  445 NTTNVRGETALHMAARAGQ-SEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYG-ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL 800          
BLAST of Ankyrin vs. Ensembl Xenopus
Match: tpm4 (tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097])

HSP 1 Score: 891.338 bits (2302), Expect = 0.000e+0
Identity = 447/788 (56.73%), Postives = 591/788 (75.00%), Query Frame = 1
Query:   85 TENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            ++ S++N S+LRAAR+GNL K +D+L+ G DIN CN  GL+ALHLA+KEGH+ IV ELI+R   +DA+TKKGN+ALHIASLAG+ EVV++LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N    DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D G+ +  +TRDGLTPLHC ARSGH Q+   L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L   GA+     +RGETALH+A R  Q+E V+ LL+ GA  +AKA+++QTPLH++ ++G  +++   L+ G+ P+ AT   YT LH++++EG  +  S+LL+ GA     TK+GFTPLH+AAKY K+ V  +LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA ++ G +P+ LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V+VA +L + GA I  TT   YTPLH A+H+G I M  +L  L   +++N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IAR+  Y+++ + L+ VT
Sbjct:   10 SDQSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADV--ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFL--LQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTLKVVT 793          

HSP 2 Score: 473.781 bits (1218), Expect = 5.863e-135
Identity = 262/604 (43.38%), Postives = 368/604 (60.93%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQR-NQGMGAGNALGTSAVQKPITTLEICLPS---EIHPVSDTLRRKKMKTGEFIKTTI-------------CTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLIL--WRSKRGDLACGNELEKALRDIGREDVV 4989
            +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGE WKEH  +   + +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG V+ S+ VP+VQA FPEGAL K+ RVG+QA  +P ++V +++GNR   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ SLRLLCSITGG++PA WEDI+G+TPL+F  DCVSFTT VSAR WL DC  +     +AT +YRE   VPYM +FVV+ + +D  EA+ R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     A  ENR+ F V+V+D  QEP G+L+ L   +  +G+           Q  +  L I LP+   E     D    K  +   F+   +                   ++++ +  VAD +G  W +LA  L  S  E ++ IR  + +  +A + ++L  W  + G  A  + L   L  I R D+V
Sbjct:  925 DNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLATPPPMVEGEGLASRLVEMGPSGAQFLGPVIVEIPHFGSMRSKERELIVLRSENGENWKEHQYDCRVEELTELLNGMDEELDSAEELEKKRICRIVTKDFPQYFAVVSRIKQESNQIGPEGGVLKSTTVPRVQASFPEGALTKRIRVGLQAQPVPDDLVKKVIGNRATFSPIVTVEPRRRKFHKPITMTIPIPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLGDCHQIPETVSLATQLYRELICVPYMAKFVVFAKMNDPVEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLIFNFYAFKENRLPFSVKVRDHSQEPCGRLSFLKEPKTTKGLP----------QTAVCNLNITLPTQKKETESDQDDENEKVDRRQNFVSLALRKRYSYLTEPGMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDE-INQIRVENPNSLTAQSFMLLKKWVVRDGKNATTDALTNVLTKINRIDIV 1517          

HSP 3 Score: 247.284 bits (630), Expect = 1.202e-64
Identity = 176/559 (31.48%), Postives = 270/559 (48.30%), Query Frame = 1
Query:  943 IDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGET-----------------------------ALHLATRNNQTETVKLLLK---------------------------------AGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            +++G  +  ++    + L  A  G+ E  A   L    +IN    + L  LH+ +  G+ ++   L+ R  D +A    G T LHIA    + ++V +L+  GA + A ++ G TPL+++A     E V  LL  GA+    T  G T                             ALH+A R + T+   LLL+                                  GA  D  AR + TPLHVA+K GN  ++ L L  GS  +  TRD  T LH  A+ G  + + +LLD GA I ++TK G +PLH+A + D +    +LLQ     +    + LT LHVA H  H KVA++LLD KA+P  KA NG+TPLHIA KKN   +  +LL   A   A + +G +P+ +A+  GH ++VS L  H A  N     G T++H+ A+  +  V R L+  GA +      + TPLH +A  G+ ++ + L  L      +  T  G+TPLHL++++GH  + ++LLE  A   I   +G+T  H+A K   + + ++L
Sbjct:    3 VEDGDCLSDQSDTNASYLRAARSGNLEK-ALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFTARNDITPLHVASKRGNANMVKLLLDRGSKIDAKTRDGLTPLHCGARSGHEQVVGMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRLKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLNHHGASPNTTNVRGETALHMAARAGQSEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQL--LKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLL 558          

HSP 4 Score: 187.963 bits (476), Expect = 1.410e-46
Identity = 124/391 (31.71%), Postives = 199/391 (50.90%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFL-ETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLEND----NRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELL 1239
            NT N     +   AARAG  S+V+ FL + G  +        + LH++A+ G   IV++L+K+    DA T  G + LH++S  G  +V  +L+E+GA+  + +  GFTPL++AA+   +EVV  L+   A      + G TPL VA    ++++  LLL+        +K     LHIA KKN ++    LL     D N  +  G  P+H+AA  G+     LL+ + A+VN   K+ +TPLH+AA+  R  + ++L + GA++   T+   TPLH ++  G+ ++   L+ +G+ V +KT+NG T LH AAQ        +LL   A+ NE T +  T L +    G   V   L               T + +  +KHK+ + E +
Sbjct:  434 NTTNVRGETALHMAARAGQ-SEVVRFLLQNGAQVEAKAKDDQTPLHISARLGKADIVQQLLKQGAYPDAATTSGYTPLHLSSREGHDDVASVLLEHGASFGIVTKKGFTPLHVAAKYGKIEVVKLLLQKNASPDAAGKSGLTPLHVAAHYDNQKVALLLLDKGASPHGAAKNGYTPLHIAAKKNQMDIATTLLEYG-ADANAITKQGIAPVHLAAQEGHVDMVSLLLTRSANVNVSNKSGLTPLHLAAQEDRVSVAEVLANQGAVIDGTTKMFYTPLHVASHYGNIKMVTFLLQHGSKVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGASPNEVTVNGNTALAIARRLGYISVVDTL-------KVVTEETLTTVQLVTEKHKMNVPETM 815          

HSP 5 Score: 65.855 bits (159), Expect = 1.534e-9
Identity = 48/168 (28.57%), Postives = 93/168 (55.36%), Query Frame = 1
Query: 1930 LLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            + V D D  ++  +  +    A++ G+ +     L++  D+N   +NGL ++HL ++E  V +   L+  GAD+  +T    T LH A+  GQ  + + L++  +   +N ++Q GFTPL++AAQ+ HL++V  LL++ A  ++    G+T   +A +Q +  +  +L
Sbjct:    1 MAVEDGDCLSDQSDTNASYLRAARSGNLEKALDYLKNGVDINICNQNGLNALHLASKEGHVEIVSELIQRGADVDASTKKGNTALHIASLAGQTEVVRVLVT--NGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLL 166          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 447/790 (56.58%), Postives = 588/790 (74.43%), Query Frame = 1
Query:   76 KSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKV 2442
            K   + S++N S+LRAARAG+L K +D+++ G D+N CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N +  DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++  PNA+ALNGFTPLHIACKK++I+++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH+AA+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VAS+LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+T LH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+ V
Sbjct:   16 KRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 477.633 bits (1228), Expect = 2.134e-136
Identity = 273/650 (42.00%), Postives = 392/650 (60.31%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIND-PNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQR-NQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKK-------MKTGEFIKTTICTDKIAKSELDLRA--VADQIGGDWEKLAAALGISDSEDLHNIR--NNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P E V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N      T +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +A+ +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L   +  +G+           Q  +  L I LP+  H  ++   R++        K   ++     + +      D+R   VAD +G  W +LA  L  S  E ++ IR  N +S    ++ LL  W ++ G  A  + L   L  I R D+V
Sbjct:  901 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGL----------PQTAVCNLNITLPA--HKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDE-INQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1537          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 447/790 (56.58%), Postives = 588/790 (74.43%), Query Frame = 1
Query:   76 KSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKV 2442
            K   + S++N S+LRAARAG+L K +D+++ G D+N CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N +  DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++  PNA+ALNGFTPLHIACKK++I+++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH+AA+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VAS+LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+T LH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+ V
Sbjct:   16 KRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 476.863 bits (1226), Expect = 3.721e-136
Identity = 273/650 (42.00%), Postives = 392/650 (60.31%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIND-PNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQR-NQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKK-------MKTGEFIKTTICTDKIAKSELDLRA--VADQIGGDWEKLAAALGISDSEDLHNIR--NNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P E V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N      T +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +A+ +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L   +  +G+           Q  +  L I LP+  H  ++   R++        K   ++     + +      D+R   VAD +G  W +LA  L  S  E ++ IR  N +S    ++ LL  W ++ G  A  + L   L  I R D+V
Sbjct:  919 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGL----------PQTAVCNLNITLPA--HKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDE-INQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1555          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 444/788 (56.35%), Postives = 585/788 (74.24%), Query Frame = 1
Query:  100 SNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKV 2442
            +N S+LRAARAG+L K +D+++ G D+N CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL +       S++ VN  + SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++  PNA+ALNGFTPLHIACKK++I+++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH+AA+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VAS+LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+T LH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+ V
Sbjct:   41 ANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 826          

HSP 2 Score: 461.455 bits (1186), Expect = 5.527e-130
Identity = 237/498 (47.59%), Postives = 331/498 (66.47%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIND-PNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P E V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N      T +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +A+ +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L
Sbjct:  926 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFL 1423          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 447/790 (56.58%), Postives = 588/790 (74.43%), Query Frame = 1
Query:   76 KSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKV 2442
            K   + S++N S+LRAARAG+L K +D+++ G D+N CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N +  DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++  PNA+ALNGFTPLHIACKK++I+++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH+AA+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VAS+LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+T LH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+ V
Sbjct:   16 KRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 476.863 bits (1226), Expect = 3.721e-136
Identity = 273/650 (42.00%), Postives = 392/650 (60.31%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIND-PNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQR-NQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKK-------MKTGEFIKTTICTDKIAKSELDLRA--VADQIGGDWEKLAAALGISDSEDLHNIR--NNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P E V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N      T +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +A+ +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L   +  +G+           Q  +  L I LP+  H  ++   R++        K   ++     + +      D+R   VAD +G  W +LA  L  S  E ++ IR  N +S    ++ LL  W ++ G  A  + L   L  I R D+V
Sbjct:  919 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGL----------PQTAVCNLNITLPA--HKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDE-INQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1555          
BLAST of Ankyrin vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 895.19 bits (2312), Expect = 0.000e+0
Identity = 447/790 (56.58%), Postives = 588/790 (74.43%), Query Frame = 1
Query:   76 KSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKV 2442
            K   + S++N S+LRAARAG+L K +D+++ G D+N CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N +  DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++  PNA+ALNGFTPLHIACKK++I+++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH+AA+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VAS+LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+T LH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+ V
Sbjct:   16 KRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 476.863 bits (1226), Expect = 3.015e-136
Identity = 273/650 (42.00%), Postives = 392/650 (60.31%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIND-PNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQR-NQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKK-------MKTGEFIKTTICTDKIAKSELDLRA--VADQIGGDWEKLAAALGISDSEDLHNIR--NNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P E V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N      T +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +A+ +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L   +  +G+           Q  +  L I LP+  H  ++   R++        K   ++     + +      D+R   VAD +G  W +LA  L  S  E ++ IR  N +S    ++ LL  W ++ G  A  + L   L  I R D+V
Sbjct:  880 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGL----------PQTAVCNLNITLPA--HKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDE-INQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1516          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|Q12955|ANK3_HUMAN (Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3)

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 445/780 (57.05%), Postives = 585/780 (75.00%), Query Frame = 1
Query:  100 SNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            +N S+LRAARAG+L K +D+++ G DIN CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N +  DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK++IK++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH++A+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VA++LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+TPLH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+
Sbjct:   41 ANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLGRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALGIARRLGYISVVDTLK 816          

HSP 2 Score: 463.766 bits (1192), Expect = 2.286e-129
Identity = 238/498 (47.79%), Postives = 333/498 (66.87%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  P+ SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P EIV ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +AT +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L
Sbjct:  918 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFL 1415          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|O70511|ANK3_RAT (Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3)

HSP 1 Score: 898.271 bits (2320), Expect = 0.000e+0
Identity = 444/788 (56.35%), Postives = 587/788 (74.49%), Query Frame = 1
Query:  100 SNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKV 2442
            +N S+LRAARAG+L K +D+++ G D+N CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL +       S++ VN  + SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++ +PNA+ALNGFTPLHIACKK++I+++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH++A+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VAS+LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+TPLH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+ V
Sbjct:   41 ANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADIESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 826          

HSP 2 Score: 462.996 bits (1190), Expect = 1.539e-129
Identity = 239/498 (47.99%), Postives = 332/498 (66.67%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTS-SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P E V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N     T+ SLRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +A+ +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++V+D  QEP G+L+ L
Sbjct:  926 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLPFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLSELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKVRDTSQEPCGRLSFL 1423          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|G5E8K5|ANK3_MOUSE (Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1)

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 447/790 (56.58%), Postives = 588/790 (74.43%), Query Frame = 1
Query:   76 KSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKV 2442
            K   + S++N S+LRAARAG+L K +D+++ G D+N CN  GL+ALHLA+KEGH+ +V EL++RE  +DA TKKGN+ALHIASLAG+ EVVK+LV NGANVN QS NGFTPLYMAAQENHLEVV FL++NGA Q++ TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N +  DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVA+K G + MV+LL+D GA +  +TRDGLTPLHC ARSGH Q+ E L+D  A ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+VLLD++  PNA+ALNGFTPLHIACKK++I+++ELLLK+GA I+A TE+GLTP+HV+AF+G    V+ L+  GA+     +RGETALH+A R+ Q E V+ L++ GA  +AKA+++QTPLH++ ++G  +++   LQ G+ PN AT   YT LH+AA+EG  +  + LLD GA +   TK+GFTPLH+AAKY K+ VAS+LLQK A+P+A GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A  LL   AD+NA +R G + + LA+QEGH D+VSLLL   A+VN   K+GLT +HL AQED+V VA +LV+ GA +   T   YTPLH   H+G I +  +L  L    ++N KT+ G+T LH AAQQGH  ++N+LL++ A PN     G TA  IAR+  Y+++ + L+ V
Sbjct:   16 KRKGKKSDANASYLRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVV 801          

HSP 2 Score: 476.863 bits (1226), Expect = 2.603e-135
Identity = 273/650 (42.00%), Postives = 392/650 (60.31%), Query Frame = 1
Query: 3094 SGDESFLENMNSRDLNCHKLTEIQ-PERIESVNFATE---EAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIND-PNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQR-NQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKK-------MKTGEFIKTTICTDKIAKSELDLRA--VADQIGGDWEKLAAALGISDSEDLHNIR--NNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            S D S+  N +S   +   + E+  P + + + F  E   ++     W  +  +NV +V  PV SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ +PP + +G+G A R++EMGP   QF  P+++E+PH+ S+R +ERE+I+LRSENGETWKEH  ++ ++ +   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   IGPEG ++SS+ VP VQA FPEGAL K+ RVG+QA  +P E V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N      T +LRLLCSITGG++PA WEDI+G+TPL+F KDCVSFTT VSAR WL DC  V     +A+ +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL     +  ENR+ F ++++D  QEP G+L+ L   +  +G+           Q  +  L I LP+  H  ++   R++        K   ++     + +      D+R   VAD +G  W +LA  L  S  E ++ IR  N +S    ++ LL  W ++ G  A  + L   L  I R D+V
Sbjct:  919 SSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGL----------PQTAVCNLNITLPA--HKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDE-INQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIV 1555          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 893.264 bits (2307), Expect = 0.000e+0
Identity = 443/798 (55.51%), Postives = 590/798 (73.93%), Query Frame = 1
Query:   64 STMTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            S+  +   + S+SN SFLRAARAGNL KV+++L+ G DINTCN  GL+ALHLAAKEGH+ +V+EL+ R   +D+ TKKGN+ALHIASLAG+ EVVK+LV+ GAN+N QS NGFTPLYMAAQENH++VV +L+ NGA+Q+  TEDGFTPLAVALQQGH + VA+LLEND + K RLPALHIA +K+D  +  LLL +       S++ VN  + SGFTPLHIAAHYGN   A LL+ + A V+F A+N ITPLHVA+K G + MV+LL+D G  +  +TRDGLTPLHC+ARSGH Q+ E L++ GA ++++T+NGL+ LHMAAQGD  +  + LL  +A +++ T D+LT LHV AH G+ +V ++LLD+R +PNARALNGFTPLHIACKK++IK++ELL+KYGA I+A TE+GLTP+HV+AF+G    V +LLQ GA+ +   +RGETALH+A R  Q E V+ LL+ GA+ DA+ARE QTPLH+A+++G  E++ L LQ  + P+ AT + YT LH++A+EG+ +  S+LL++GA     TK+GFTPLH+AAKY  + VA +LLQ++A  ++ GKNGLTPLHVA HY+++KVA LLL+  A P   AKNGYTPLHIAAKKN   +A  LL   A++N  ++ G +PL LASQEGHTD+V+LLL   A+++   K+GLTS+HL AQEDKV VA IL   GAD    T   YTPL  A H+G + M  +L  L     +N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IA++  Y+++ + L+
Sbjct:   19 SSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFL--LKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 814          

HSP 2 Score: 440.269 bits (1131), Expect = 3.168e-122
Identity = 235/509 (46.17%), Postives = 324/509 (63.65%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKM---------------------------------NSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRN-QGMGAGNALGTSAVQKPITTLEICLP 4662
            +NV +   P+ SGFLVSFMVDARGG M+  R   LR  +PP     PTR+ CRL+K  ++                                  +PP LN+G+    RI+++GP  T+F  P+++E+PH+A+LR +ERE+++LRSENG++WKEH  + T+  +   +    E L + E++   RI RI+T D PQYFA++SRI+Q+  LIGPEG V+SS+VVPQVQAVFPEGAL K+ RVG+QA  +  E+V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+PK  +  M+N       +LRLLCSITGG+ PA WEDI+G+TPL+F  +CVSFTT VSAR WLIDC  +Q     A+ VYRE   VPYM +FVV+ + HD  EA+ R   +TDD VDKTLE QENF  +A    VEVL  +P +++  GNLVP+TK+G     +  A  ENR+   V+V+D  QEP G+L+ +   ++ +G+          V + I  L I LP
Sbjct:  955 DNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGKLHLPTAPPPLNEGESLVSRILQLGPPGTKFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL----------VHQAICNLNITLP 1453          
BLAST of Ankyrin vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 885.945 bits (2288), Expect = 0.000e+0
Identity = 442/798 (55.39%), Postives = 589/798 (73.81%), Query Frame = 1
Query:   64 STMTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            S+  +   + S+SN SFLRAARAGNL KV+++L+ G DINTCN  GL+ALHLAAKEGH+ +V+EL+ R   +D+ TKKGN+ALHIASLAG+ EVVK+LV+ GAN+N QS NGFTPLYMAAQENH++VV +L+ NGA+Q+  TEDGFTPLAVALQQGH + VA+LLEND + K RLPALHIA +K+D  +  LLL +       S++ VN  + SGFTPLHIAAHYGN   A LL+ + A V+F A+N ITPLHVA+K G + MV+LL+D G  +  +TRDGLTPLHC+ARSGH Q+ E L++  A ++++T+NGL+ LHMAAQGD  +  + LL  +A +++ T D+LT LHV AH G+ +V ++LLD+R +PNARALNGFTPLHIACKK++IK++ELL+KYGA I+A TE+GLTP+HV+AF+G    V +LLQ GA+ +   +RGETALH+A R  Q E V+ LL+ GA+ DA+ARE QTPLH+A+++G  E++ L LQ  + P+ AT + YT LH++A+EG+ +  S+LL++GA     TK+GFTPLH+AAKY  + VA +LLQ++A  ++ GKNGLTPLHVA HY+++KVA LLL+  A P   AKNGYTPLHIAAKKN   +A  LL   A++N  ++ G +PL LASQEGHTD+V+LLL   A+++   K+GLTS+HL AQEDKV VA IL   GAD    T   YTPL  A H+G + M  +L  L     +N KT+ G+TPLH AAQQGH  ++N+LL+  A PN     G TA  IA++  Y+++ + L+
Sbjct:   19 SSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFL--LKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTLK 814          

HSP 2 Score: 451.055 bits (1159), Expect = 1.419e-125
Identity = 233/476 (48.95%), Postives = 322/476 (67.65%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRN-QGMGAGNALGTSAVQKPITTLEICLP 4662
            +NV +   P+ SGFLVSFMVDARGG M+  R   LR  +PP     PTR+ CRL+K  ++ + P + +G+G A R++E+GP   QF  P+++E+PH+A+LR +ERE+++LRSENG++WKEH  + T+  +   +    E L + E++   RI RI+T D PQYFA++SRI+Q+  LIGPEG V+SS+VV QVQAVFPEGAL K+ RVG+QA  +  E+V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+PK  +  M+N       +LRLLCSITGG+ PA WEDI+G+TPL+F  +CVSFTT VSAR WLIDC  +Q     A+ VYRE   VPYM +FVV+ + HD  EA+ R   +TDD VDKTLE QENF  +A    VEVL  +P +++  GNLVP+TK+G     +  A  ENR+   V+V+D  QEP G+L+ +   ++ +G+          V + I  L I LP
Sbjct:  955 DNVALSSSPIHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVSQVQAVFPEGALTKRIRVGLQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDAPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVAFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFSEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPKSTRGL----------VHQAICNLNITLP 1420          
BLAST of Ankyrin vs. TrEMBL
Match: A0A267H5D2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001678g5 PE=4 SV=1)

HSP 1 Score: 1568.52 bits (4060), Expect = 0.000e+0
Identity = 884/1794 (49.28%), Postives = 1192/1794 (66.44%), Query Frame = 1
Query:   67 TMTKSNTENS----ESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARIL-VHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDS-RDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRI---SSLDF------------------DSTMIGDSEFRSELSIAPIEVSQEXXXXXXXXXXXXEVDFTAMPPSPCVMKNHISGSQGRS--------EASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYS-AYALLILWRSKRGDLACGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEI 5340
            T  K + E+S    + + +FLR ARAGNL+KV+DFL +G  I+TCN  GL+ALHLA+KEGH  +V+EL+ R    DA+TKKGN+ALHIASLAG+ +VVK+LVE GA VN QS NGFTPLYMAAQENHL+VV FL+ +GA QT+ T DGFTPLAVALQQ H+++VA LLEND+R + R+PALH+A KK+DV +  LLL +S+ + N Q+ SGFT LHIAAHYG++  A LLIE+ ADVNFQA+NNITPLHVAAKWG   +VQ LI++ A V C+TRDGLTPLHC++RSG   + ++L+ +GA    K+R+GL++LHMA QGD  D AR+LL++  NI++TT D LTPLHV AH G  +VA++LLD RC  NARALNGFTPLHIACKK++I+++ELLL+Y   IEATTE+GLTPLHV+AF+G      +L+Q GAN    T+R ET LHLA R+NQ E V+ LL++ A  DA+A++NQTPLH+A+++GN E+ T+ L++G++P+   +DNYTALHVAA+EG  +  ++LLD+ A ++  TK+G TPLH AAKYDK+GVA +LL + A+PNA G+NGLTPLH+A HYN   +A  LL+ KA+  C A NGYTPLHIAA+KN+ DLA  L+   A++ AES++GF+PL LA+QEGH ++ + LL   A V+  + NG+T +HL AQED+VT A +L V  G  I P T A YTPLHTA  F Q+NM ++L  L     +N  TQ  FTPLH+A+QQGHLQ+V LLLE+ AD N++N + WT AHIA+KQ+Y+NIFEVLR+VTT +I    EE   EE I + KP+ + +H +S+S+D+G  G T K+   N   S +     +HL   + +  R S S D ++ E     +   +  +    + SVD   D  +Y +  +  V+E  +++         +S  I G+   +    S +F                  +S++I + E +   S A  +  Q   S+  + +    V  T  PP P  +    S S  RS        E + D   +  ++S+  N   + +I+P    S     E      ++    +NV   R PV SGFLVSF+VDARGG M   RF  LR  +PP++A  PTR+ CRL++  +++ PP  NDG+G ACR++EMGP N  FNS +LIEVPH+AS+RDREREI++LRS+NGETWKEH +E T+Q++ ++VG +F  + TN+++R  RI RILT+  PQYFAL++RIRQE ALIGPEG V+SS+V+ QVQAVFPE AL KK RVGIQA  +P E V RLLGNRVA SP+++IEPRRRKFHKPITLT+PLPK   +G+ N   S T  LRLLCSITGG  PA WEDI+GSTPLS+ KDCVSFTTTVSAR WL+DCPN    A+MA  +YR++ +VPYMG+FV++ +R ++EEA+ R   +TDD VDKTLEC E F+  A    VEVL ++P WIE  GNL P +K GDQL +   A  ENR++F V++KD  +   GK+A L   R        +L      KPI TLE+ LP  +   S + +  K  T +    +  TD+IA+SELDLR +AD +  DW  LA  LG+  S D+ N + N  D+   A+A+L  W+ +RG  A GNE+E+ALR IGR+DVVK CM N+ +V  EDEK QA   + K E  +  +     S  +  + +V DD A        A D+ +   D    P   P      ++ KE   + K EAF++LI+  + + P+PE+
Sbjct:    4 TEEKGHAEDSNQPVDPSQNFLRVARAGNLAKVLDFLNSGMKIDTCNANGLNALHLASKEGHTAVVRELLMRNADPDASTKKGNTALHIASLAGQLDVVKLLVEKGARVNCQSQNGFTPLYMAAQENHLDVVKFLLASGASQTLATTDGFTPLAVALQQCHDKVVACLLENDSRGRSRMPALHVAAKKDDVRSATLLL-TSDCNPNQQAGSGFTALHIAAHYGSQSVAALLIEKGADVNFQARNNITPLHVAAKWGMLPVVQKLIENNAEVDCKTRDGLTPLHCASRSGQYAVVDQLLTSGASFGMKSRSGLSALHMATQGDHVDCARLLLVRGTNIDDTTIDLLTPLHVAAHCGYTRVAKLLLDHRCMVNARALNGFTPLHIACKKNRIRVIELLLQYSCAIEATTESGLTPLHVAAFMGHTNVAVLLMQHGANPNSPTVRSETPLHLAVRSNQVEVVRALLRSNAQVDARAKDNQTPLHIASRLGNAEMTTVLLEAGANPDATCKDNYTALHVAAREGHEDVAAVLLDNKASLQLATKKGATPLHNAAKYDKIGVAKLLLARGADPNARGRNGLTPLHLAAHYNRTSIAAALLEAKANANCLASNGYTPLHIAARKNHLDLARQLMSGGANTRAESKSGFAPLHLAAQEGHPEMCAALLSSNAAVDQASHNGITPLHLAAQEDRVTSAEVLVVQHGGQIDPQTKAGYTPLHTACFFNQVNMIRFL--LRHGAGVNALTQQKFTPLHVASQQGHLQVVYLLLEAGADANMRNARNWTPAHIAKKQNYINIFEVLRQVTT-IIENWEEEIILEETIEISKPDTIADHHMSESDDDG--GVTPKLRRPNHAGSPT---GAQHLGASDTLRSRGSESADSVFDERHVNANTLMRSDSYNKYTTSVDYLEDEMLYTTTKLGSVLETDNKTGGA-----AASASIGGMSALLQPEGSTEFLLCDDASSSAAVSEHEHDESSLIEEPEMKK--STAGQQQLQSRPSTRSKGAQKLPVLLT--PPQPASVARKGSKSSNRSKGDAVSVDETTHDIEKIGTLSSQKDNV-AMEQIEPSSYMSQYREPEALTPPENYITGKDNVAPQRIPVVSGFLVSFLVDARGGAMNGSRFPGLRIVIPPNAASAPTRITCRLMRQGRVSRPPQFNDGEGLACRVIEMGPSNATFNSNVLIEVPHFASMRDREREIVVLRSDNGETWKEHTVEVTEQSVIDAVGGAFGSMPTNDDLRKKRIVRILTNSFPQYFALVTRIRQESALIGPEGGVISSTVIGQVQAVFPESALTKKIRVGIQALPVPTEQVNRLLGNRVAVSPVVTIEPRRRKFHKPITLTIPLPKPATRGITNPGESPT--LRLLCSITGGVQPATWEDITGSTPLSYVKDCVSFTTTVSARFWLMDCPNTTESADMAGKLYRDAFLVPYMGRFVIFAKRTEQEEAKLRCFCITDDKVDKTLECNEGFERKAESREVEVLDSKPQWIEGVGNLTPTSKNGDQLFLPFRAFKENRLAFPVKIKDPNEPAIGKIAFLKDPRPTKPTDSPSL------KPICTLEVQLPDYVSDGS-SPKPDKSTTDQPELLSFTTDRIARSELDLRDLADCVRADWPMLARELGVGQS-DITNAKVNFRDDRDRAFAVLCQWQRERGPEATGNEMERALRRIGRDDVVKKCMRNVEYVVGEDEKRQAKSLLDKQEAEDRHSGSNRSS--QPPLEDVADDEAG-------AGDFVKPSVDERHGP--PPPAKSEAEQAKE--REAKSEAFLSLIDSMNSMTPEPEV 1755          
BLAST of Ankyrin vs. TrEMBL
Match: A0A158R8M6 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5746 PE=4 SV=1)

HSP 1 Score: 1537.7 bits (3980), Expect = 0.000e+0
Identity = 864/1753 (49.29%), Postives = 1154/1753 (65.83%), Query Frame = 1
Query:   73 TKSNTENSESNHSFLRAARAGNLSKVIDFLET-GTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNK---------ADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQEXXXXXXXXXXXXEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTV-----NKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNAL--------GTSAVQ----KPITTLEICLPSEI---------------------------------------HPV-----SDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLH----------NIRNNSSDEYS---------------AYALLILWRSKRGDLACGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQ 5043
            T S++  SE++ S LRAARAGNL K+ID +   G DINTCN  GL+ALHLA+KEGH+ IV+EL++R   ++  T KGN+ALHIASLAG+FEV K+L+ENGA VN QS NGFTPLYMAAQENHLEVVT L+ NGA+ +ITT DGFTPLAVALQQGHER VA+LLE+D R K  LPALHIA KK+DV A +LLLN  +V+V+HQS+SGFT LHIA+HYGN K   LLI + AD+NFQAKNN+T LHVA+KWG   +V+ L+ SGA + C TRDGLTPLHC++RSGHAQ+ + L++ GA+  +KTR+GLT+LHMAAQGD  +  ++LLL+ AN+++ T D LTPLHV AH G+ +VA++LLD   + NARA NGF PLHIACKK++IK+VEL LK+G +++  TE+GLTPLHV+AF+G+   V +LL+ GA+    TM  ET+LHLA+R  + ETVKLLL+ GAI DAK+R NQT LHVA  +GN ELIT+ LQ+G++   AT+D ++ALHVA K G  EA+SLLL+SGA  +  TK GFTPLH+AAKY ++  A +L++  A  +  G+NGLTPLH+A+HY    V + LLD           A  K + KNGYTPLH+AA++   ++A +LL + AD NAESRNGF+PL LA+Q+G  ++V LLL +KA VN +AKNGLT MHL AQED V  A +L  AGA + PTT A YTPLHTA HFGQ+NM K+LIS      +N +T+LG + LHLAAQQGH Q++  LLES ADPN+KNN GWTA H+A+ QHYLNIFEVLR+VTT V SWE  +   E++                  D G TG ++ +D  +++ +  + R    L+ P+ +     T  +D   E EY         +   S Q+++   VE  E+ D+      L + +S     + ++  +RGV TR+S  D  S + G+                              + +T       V ++  +  +G +E  G          R     + ++       +V F +   Y   +WDF  +NVPI RKP++SGFLVSF+VDARGG M+A R   LR  VPPS+A  PTR+ CR+++P +  +PP LNDG+G ACRI+E+GP   QFNSP+L+E+PH+A+LR R+REI++LRS++ ETWKEH +EATDQA+++++G  F+ L T E+++  RI R+L +D PQY A+++R+RQE+ALIG +G V+SS+VVPQVQAVFPEGAL K+ RVG+QAH+IP ++VTRL+GN+V  SPI++IEPRRRKFHKPITLT+PLP++      + G  +  ++  SSLRLLCSITGG+APAVWEDI+GSTPLS  KDCVSFTTTVSARLWLIDCP +  V E+A  +Y+E++ VPYMG+F+V+ +R + +EA  R   +TDD VDKTLECQE F L+A+   +EV+ NR  W+E +GNLVPV K  DQL +   A  ENR++F VR+KD Q EP GKLA +   R+   G+ N +        GT+  +    +PI  LE+ LPSEI                                       HP      +D+  R  +       T++  + IA+++LDL  +A QIG DW +L  AL   DS +L           + R  S+D  S               A A+L+ W  + GD A GNEL+  LR IGRED+VKNCM +I  V + DE+ +
Sbjct:   14 TTSSSRKSENSQSILRAARAGNLPKLIDAIAIHGIDINTCNASGLNALHLASKEGHVEIVRELLRRHIDVNQPTHKGNTALHIASLAGQFEVAKVLIENGALVNAQSQNGFTPLYMAAQENHLEVVTLLLANGANPSITTVDGFTPLAVALQQGHERTVAVLLESDARGKVCLPALHIAAKKDDVKAASLLLNG-DVNVDHQSASGFTALHIASHYGNVKMVDLLISRGADINFQAKNNVTALHVASKWGNVAVVEHLLASGAELECFTRDGLTPLHCASRSGHAQVVQLLLNAGANYSAKTRSGLTALHMAAQGDHPECVKLLLLQGANVDDVTIDNLTPLHVAAHCGSVRVAKILLDSHSNLNARARNGFAPLHIACKKNRIKVVELFLKHGCVVDVATESGLTPLHVAAFMGNTNIVVLLLKHGADPNGQTMHNETSLHLASRAGRIETVKLLLRNGAIVDAKSRGNQTCLHVAALLGNCELITVLLQNGANVQAATKDGHSALHVATKAGHDEAVSLLLESGAPTDVLTKSGFTPLHLAAKYSRLKPAQLLIEAGAQLDVPGRNGLTPLHLASHYGSVSVVKALLDKGVSHSFDWLIASTKLQTKNGYTPLHVAAQRCQVEVARLLLKAKADPNAESRNGFTPLHLAAQDGSVEMVRLLLDYKAKVNARAKNGLTPMHLAAQEDSVKAAEVLYAAGALLDPTTKAGYTPLHTACHFGQLNMIKFLIS--KGCNVNARTELGSSTLHLAAQQGHPQVIYTLLESGADPNLKNNSGWTAGHVAQHQHYLNIFEVLRRVTTCVESWEEIDTYDEQV---------------GGMDGGATGPSAAVDYFDSHRTSGIPRLE--LEKPDLMAEHPVTDTEDDQGETEYTAIPSSPMFSRATSQQAIEEERVEQVEA-DLTNQKVVLRKQLS-----NDNAAFVRGVSTRLS--DKHSVVSGEDSI------------------------DEGIGYT-------VNQSQFTRDKGANEVFGSGDGFRASGQRLKRADRGSKFAGNGSGNVGFPS--GYGGLEWDFVADNVPISRKPITSGFLVSFLVDARGGSMRASRHPGLRIMVPPSAASAPTRVTCRMLRPERTTAPPQLNDGEGLACRIIELGPHPCQFNSPVLLEIPHFAALRGRQREIVVLRSDDAETWKEHSLEATDQAVRSALGSVFDTLETAEQLKEKRILRVLMNDFPQYLAVVTRLRQEIALIGSDGGVLSSTVVPQVQAVFPEGALQKRIRVGLQAHQIPSDMVTRLVGNQVTVSPIVTIEPRRRKFHKPITLTIPLPRSAVITKQHHGGASADSAANSSLRLLCSITGGTAPAVWEDITGSTPLSRVKDCVSFTTTVSARLWLIDCPVINAVVEVAMRLYKEASAVPYMGKFIVFAKRPEVDEALMRCFCITDDKVDKTLECQEGFDLVAASNEIEVVDNRLTWLEASGNLVPVVKADDQLRLHFNAFRENRLAFPVRIKDPQLEPSGKLAFV---RDPRPGSANEIKPMFQELGGTTITEALPVRPICGLEVVLPSEIGGTRSGSVLISGADGAHTIASTAATSVVSLSCSQPQHFEHPTQNLPEADSHGRCLVVPPPEWATSMTAESIARTQLDLVEIATQIGSDWPRLVKALFARDSSELPPSADQLIDWISRRCASADTLSAAGLTYEGLRCDRDRALAILLAWTIEAGDAATGNELDVVLRQIGREDIVKNCMRDIRPVLELDEREK 1702          

HSP 2 Score: 65.855 bits (159), Expect = 2.544e-6
Identity = 54/166 (32.53%), Postives = 89/166 (53.61%), Query Frame = 1
Query: 1936 VSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            ++   S+ +S N  S L+ A       ++  +  H  D+N    +GL ++HL ++E  V + R L+    D+   T    T LH A+  GQ  +AK LI   +   +N ++Q GFTPL++AAQ+ HL++V LLL + A+P+I    G+T   +A +Q +     VL
Sbjct:   12 INTTSSSRKSENSQSILRAARAGNLPKLIDAIAIHGIDINTCNASGLNALHLASKEGHVEIVRELLRRHIDVNQPTHKGNTALHIASLAGQFEVAKVLIE--NGALVNAQSQNGFTPLYMAAQENHLEVVTLLLANGANPSITTVDGFTPLAVALQQGHERTVAVL 175          
BLAST of Ankyrin vs. TrEMBL
Match: A0A0B7BMH0 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF194146 PE=4 SV=1)

HSP 1 Score: 1227.23 bits (3174), Expect = 0.000e+0
Identity = 696/1376 (50.58%), Postives = 913/1376 (66.35%), Query Frame = 1
Query:   67 TMTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGETGRTSKIDI--------------------DNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYM-KSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSE-----------FRSELSIAPIEVSQEXXXXXXXXXXXXEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLE-NMNSRDLNCHKLTEIQPERIESVNFATE------EAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALIS---RIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSI 4068
            T +      S+ N  FLRAAR GNL +V+++L+  TDINT N  GL+ALHLA+KEGH+ IV EL+ R+  ++A TKKGN+ALHIASLAG  ++VK LVE+GA VNLQ+  GFTPLYMA+QE H EVV FL+ +GA+Q ++TEDGFTPLAVALQQGH+++V++LLE+D + K RLPALHIA KK+DV +  LLL + +  +  Q+ SGFTPLHIAAHYGN   A LLI++ ADVNF+AKNNITPLHV ++WG+  MV LL+D+ A +  +TRDGLTPLHC++RSGH  + + L++ GA   +KT+NGLT LHM+AQGD ED AR+LL  +A++NE T D+LTPLHV AH GN K A++LLDR+C+PNARALNGFTPLHIACKK++IK+VELLLKYGA IE+ TE+GLTPLHV++F+G    V  L+Q  AN    T+RGET+LHLA R NQ++ +++LL+ GA  DA+ARE QTPLH+A ++GN++ + L LQ G+  + AT+D YT LH+AAKEG  E   +LL+  A+ +  TK+GFTPLHIAAKY  + VA +LLQK ANPNA GKNGLTPLHVATHYNH  VAQLLL+NKADP   AKNGYTPLHIAAKKN  D+A MLL   A  NAES+NGF+PL LASQEGHTD+V LLL+  A+VN +A+NGLT MHL AQED+V VA IL   G++    T A YTPLHTA HFGQ+NM ++L  L  Q  +N  T++G+TPLH AAQQGH+Q+VN LL+++A PN   N G T   IA+K  Y+++ E+L+ VT      ++    +E+   +  PE M E  +SDSEDEG      +  I                     N  +S SL+R      L  + D R     D ++ E  Y   S +  +GA  + SQ               V V ++   + S  S  D    + R   T I    F ++ I   E           ++ E SI+P E+                 DF    P   V      G+QG    + D  +++  + S+    H +    P     +   TE       + +     F+P+NVP+ + PV SGFL+SFMVDARGG M+  R   +R  +PP     PTR+ CRL+   K++ PP L +G+G A RI+EMGP  T+F  P+L+EVPH+ASLR +ERE++ILRS+NGETW EHP++AT+ A+  ++G S E L T E++   RI+RILT DLP +FAL+S   R++QE  +IG EG V+SS+VVPQVQAV PEG L +   VG+QA  I  E+V +LLGNRVA SPI++IEPRRRKFHKPITLT+P+P+   KGMIN       +LRLL S+
Sbjct:    5 TQSPPKHHKSDGNAGFLRAARDGNLEEVLEYLKGSTDINTSNPNGLNALHLASKEGHLNIVTELLNRKANVEAATKKGNTALHIASLAGHEDIVKKLVESGAQVNLQAQAGFTPLYMASQEGHSEVVKFLLASGANQGLSTEDGFTPLAVALQQGHDKVVSVLLEHDAKGKVRLPALHIAAKKDDVKSAALLLQNEQNSLELQTKSGFTPLHIAAHYGNTNVATLLIQRNADVNFRAKNNITPLHVCSRWGKLNMVNLLLDNNATIDEKTRDGLTPLHCASRSGHESVVDTLLERGAPHSAKTKNGLTPLHMSAQGDHEDCARLLLYHKASLNEVTVDYLTPLHVAAHCGNVKTAKLLLDRKCEPNARALNGFTPLHIACKKNRIKVVELLLKYGASIESKTESGLTPLHVASFMGHMNIVIYLIQHNANPNTATVRGETSLHLAARANQSDIIRILLRNGATVDARAREQQTPLHIAARLGNVDNVVLLLQHGAAVDAATKDKYTPLHIAAKEGHDEVAQILLEHEAQHDMTTKKGFTPLHIAAKYGNIKVARLLLQKDANPNAQGKNGLTPLHVATHYNHANVAQLLLENKADPHATAKNGYTPLHIAAKKNQMDIATMLLEYGAKPNAESKNGFTPLHLASQEGHTDIVGLLLEKDANVNSQAQNGLTPMHLAAQEDRVPVAEILSKHGSETDTHTKAGYTPLHTACHFGQVNMVRFL--LEHQASVNATTKVGYTPLHQAAQQGHVQVVNTLLKNQASPNAVTNNGQTPLAIAQKLGYISVVEILKPVT----EVQVITPSSEDKYKVVSPETMQETFISDSEDEGVDDFLPQSPIFGKPISEQHVYLPYYEGQKMHNREDSISLERGGSASPLDTSFDKR----PDQLFTEDLYAHHSFRYGKGAPQLISQGAWRNHKSDDRLSKAVRVCQEQTETSS--STGDLVPTKFRNA-TTIYQEQFSASPISTEEILPHWQKANIVYQGEYSISPTEIEH-------------HFDFVTSLPDDSVK----PGNQGLVYQTQD--YMDAQITSQSF--HAVYSAAPPSAGRLPVGTEANRFSSYSGSSFSTSFDPDNVPVDKSPVYSGFLISFMVDARGGAMRGCRHPGVRVIIPPRKCCMPTRVTCRLVTKEKLSKPPPLLEGEGLAARILEMGPVGTKFLGPVLLEVPHFASLRGKEREVVILRSDNGETWYEHPMQATEDAVAEALGSSAEELDTEEDLSKKRIKRILTGDLPMFFALVSRVTRVKQESTVIGMEGGVLSSNVVPQVQAVLPEGTLTRPIPVGLQAQPIAPELVAKLLGNRVAVSPIVTIEPRRRKFHKPITLTIPVPRAAQKGMINQYGGERPTLRLLFSL 1346          

HSP 2 Score: 142.124 bits (357), Expect = 1.520e-29
Identity = 97/299 (32.44%), Postives = 161/299 (53.85%), Query Frame = 1
Query: 1540 QSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGAD-ITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            Q+ S P     D       AA++G  E +   L     I      G   LH+A+K   + + + LL +KAN  A  K G T LH+A+   HE + + L+++ A    +A+ G+TPL++A+++ + ++   LL S A+    + +GF+PL +A Q+GH  VVS+LL+H A    K K  L ++H+ A++D V  A +L+    + +   T + +TPLH AAH+G  N+A  LI       +N + +   TPLH+ ++ G L +VNLLL++ A  + K   G T  H A +  + ++ + L
Sbjct:    4 QTQSPPKHHKSDGNAGFLRAARDGNLEEVLEYLKGSTDINTSNPNGLNALHLASKEGHLNIVTELLNRKANVEAATKKGNTALHIASLAGHEDIVKKLVESGAQVNLQAQAGFTPLYMASQEGHSEVVKFLLASGANQGLSTEDGFTPLAVALQQGHDKVVSVLLEHDA----KGKVRLPALHIAAKKDDVKSAALLLQNEQNSLELQTKSGFTPLHIAAHYGNTNVATLLIQ--RNADVNFRAKNNITPLHVCSRWGKLNMVNLLLDNNATIDEKTRDGLTPLHCASRSGHESVVDTL 296          
BLAST of Ankyrin vs. TrEMBL
Match: A0A0B7BKD9 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF194102 PE=4 SV=1)

HSP 1 Score: 1221.07 bits (3158), Expect = 0.000e+0
Identity = 696/1382 (50.36%), Postives = 913/1382 (66.06%), Query Frame = 1
Query:   67 TMTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGETGRTSKIDI--------------------DNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYM-KSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSE-----------FRSELSIAPIEVSQEXXXXXXXXXXXXEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLE-NMNSRDLNCHKLTEIQPERIESVNFATE------EAYNKSDWDFEPENVPIVRKPVSSG------FLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALIS---RIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSI 4068
            T +      S+ N  FLRAAR GNL +V+++L+  TDINT N  GL+ALHLA+KEGH+ IV EL+ R+  ++A TKKGN+ALHIASLAG  ++VK LVE+GA VNLQ+  GFTPLYMA+QE H EVV FL+ +GA+Q ++TEDGFTPLAVALQQGH+++V++LLE+D + K RLPALHIA KK+DV +  LLL + +  +  Q+ SGFTPLHIAAHYGN   A LLI++ ADVNF+AKNNITPLHV ++WG+  MV LL+D+ A +  +TRDGLTPLHC++RSGH  + + L++ GA   +KT+NGLT LHM+AQGD ED AR+LL  +A++NE T D+LTPLHV AH GN K A++LLDR+C+PNARALNGFTPLHIACKK++IK+VELLLKYGA IE+ TE+GLTPLHV++F+G    V  L+Q  AN    T+RGET+LHLA R NQ++ +++LL+ GA  DA+ARE QTPLH+A ++GN++ + L LQ G+  + AT+D YT LH+AAKEG  E   +LL+  A+ +  TK+GFTPLHIAAKY  + VA +LLQK ANPNA GKNGLTPLHVATHYNH  VAQLLL+NKADP   AKNGYTPLHIAAKKN  D+A MLL   A  NAES+NGF+PL LASQEGHTD+V LLL+  A+VN +A+NGLT MHL AQED+V VA IL   G++    T A YTPLHTA HFGQ+NM ++L  L  Q  +N  T++G+TPLH AAQQGH+Q+VN LL+++A PN   N G T   IA+K  Y+++ E+L+ VT      ++    +E+   +  PE M E  +SDSEDEG      +  I                     N  +S SL+R      L  + D R     D ++ E  Y   S +  +GA  + SQ               V V ++   + S  S  D    + R   T I    F ++ I   E           ++ E SI+P E+                 DF    P   V      G+QG    + D  +++  + S+    H +    P     +   TE       + +     F+P+NVP+ + PV SG      FL+SFMVDARGG M+  R   +R  +PP     PTR+ CRL+   K++ PP L +G+G A RI+EMGP  T+F  P+L+EVPH+ASLR +ERE++ILRS+NGETW EHP++AT+ A+  ++G S E L T E++   RI+RILT DLP +FAL+S   R++QE  +IG EG V+SS+VVPQVQAV PEG L +   VG+QA  I  E+V +LLGNRVA SPI++IEPRRRKFHKPITLT+P+P+   KGMIN       +LRLL S+
Sbjct:    5 TQSPPKHHKSDGNAGFLRAARDGNLEEVLEYLKGSTDINTSNPNGLNALHLASKEGHLNIVTELLNRKANVEAATKKGNTALHIASLAGHEDIVKKLVESGAQVNLQAQAGFTPLYMASQEGHSEVVKFLLASGANQGLSTEDGFTPLAVALQQGHDKVVSVLLEHDAKGKVRLPALHIAAKKDDVKSAALLLQNEQNSLELQTKSGFTPLHIAAHYGNTNVATLLIQRNADVNFRAKNNITPLHVCSRWGKLNMVNLLLDNNATIDEKTRDGLTPLHCASRSGHESVVDTLLERGAPHSAKTKNGLTPLHMSAQGDHEDCARLLLYHKASLNEVTVDYLTPLHVAAHCGNVKTAKLLLDRKCEPNARALNGFTPLHIACKKNRIKVVELLLKYGASIESKTESGLTPLHVASFMGHMNIVIYLIQHNANPNTATVRGETSLHLAARANQSDIIRILLRNGATVDARAREQQTPLHIAARLGNVDNVVLLLQHGAAVDAATKDKYTPLHIAAKEGHDEVAQILLEHEAQHDMTTKKGFTPLHIAAKYGNIKVARLLLQKDANPNAQGKNGLTPLHVATHYNHANVAQLLLENKADPHATAKNGYTPLHIAAKKNQMDIATMLLEYGAKPNAESKNGFTPLHLASQEGHTDIVGLLLEKDANVNSQAQNGLTPMHLAAQEDRVPVAEILSKHGSETDTHTKAGYTPLHTACHFGQVNMVRFL--LEHQASVNATTKVGYTPLHQAAQQGHVQVVNTLLKNQASPNAVTNNGQTPLAIAQKLGYISVVEILKPVT----EVQVITPSSEDKYKVVSPETMQETFISDSEDEGVDDFLPQSPIFGKPISEQHVYLPYYEGQKMHNREDSISLERGGSASPLDTSFDKR----PDQLFTEDLYAHHSFRYGKGAPQLISQGAWRNHKSDDRLSKAVRVCQEQTETSS--STGDLVPTKFRNA-TTIYQEQFSASPISTEEILPHWQKANIVYQGEYSISPTEIEH-------------HFDFVTSLPDDSVK----PGNQGLVYQTQD--YMDAQITSQSF--HAVYSAAPPSAGRLPVGTEANRFSSYSGSSFSTSFDPDNVPVDKSPVYSGKLKWKSFLISFMVDARGGAMRGCRHPGVRVIIPPRKCCMPTRVTCRLVTKEKLSKPPPLLEGEGLAARILEMGPVGTKFLGPVLLEVPHFASLRGKEREVVILRSDNGETWYEHPMQATEDAVAEALGSSAEELDTEEDLSKKRIKRILTGDLPMFFALVSRVTRVKQESTVIGMEGGVLSSNVVPQVQAVLPEGTLTRPIPVGLQAQPIAPELVAKLLGNRVAVSPIVTIEPRRRKFHKPITLTIPVPRAAQKGMINQYGGERPTLRLLFSL 1352          

HSP 2 Score: 142.124 bits (357), Expect = 1.289e-29
Identity = 97/299 (32.44%), Postives = 161/299 (53.85%), Query Frame = 1
Query: 1540 QSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGAD-ITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            Q+ S P     D       AA++G  E +   L     I      G   LH+A+K   + + + LL +KAN  A  K G T LH+A+   HE + + L+++ A    +A+ G+TPL++A+++ + ++   LL S A+    + +GF+PL +A Q+GH  VVS+LL+H A    K K  L ++H+ A++D V  A +L+    + +   T + +TPLH AAH+G  N+A  LI       +N + +   TPLH+ ++ G L +VNLLL++ A  + K   G T  H A +  + ++ + L
Sbjct:    4 QTQSPPKHHKSDGNAGFLRAARDGNLEEVLEYLKGSTDINTSNPNGLNALHLASKEGHLNIVTELLNRKANVEAATKKGNTALHIASLAGHEDIVKKLVESGAQVNLQAQAGFTPLYMASQEGHSEVVKFLLASGANQGLSTEDGFTPLAVALQQGHDKVVSVLLEHDA----KGKVRLPALHIAAKKDDVKSAALLLQNEQNSLELQTKSGFTPLHIAAHYGNTNVATLLIQ--RNADVNFRAKNNITPLHVCSRWGKLNMVNLLLDNNATIDEKTRDGLTPLHCASRSGHESVVDTL 296          
BLAST of Ankyrin vs. TrEMBL
Match: A0A4Z2D3U0 (Ankyrin-3 isoform 2 (Fragment) OS=Schistosoma japonicum OX=6182 GN=EWB00_004838 PE=4 SV=1)

HSP 1 Score: 1026.54 bits (2653), Expect = 0.000e+0
Identity = 543/934 (58.14%), Postives = 691/934 (73.98%), Query Frame = 1
Query:   76 KSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANP-NATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDAD----SNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXN-MGEHAVSDSEDEG-----------ETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRI--STSNDDIWKELEYMKSVQGKRGAAT--VSSQSVDSRDVE--VYESMDVVEVV 2808
            K + + +E+  +FLRAARAG+L KV++ L TG  IN  N IGL+ALHLA+KEG++ IV EL++R    DA TKKGN+ALHIASLAG FEVVK+L++ GAN+N QS  GFTPLYMAAQENHL+VV  L+  GA+Q +TTEDGFTPLAVALQQGH+R+VA LLE D+RS+  +PALHIA +K+D NAV+LLLN++EV+VNHQS  GFTPLHIAAHYGN   A++LIE+ ADVNFQAKNNITPLHVAAKWGR GMVQLL++S ALV CRTRDGLTPLHC+ARSGHA+L   L+  GA+  +KTRNGLT LHMAAQG+ E+ AR+L+L+ A++ + T D LTPLHV AH GN +VARVLLD  CD NA ALNGFTPLHIACKK KI+++ELLL+YGA I  TTE+GL+PLHV+AFIG  E V +LLQ+GA++ Q TMR ETALHLA RN Q +  + L+  GA  +AKAR+ QTPLHVA   G   LI++ L   ++PN+  RD YTALH+AAKEGR + +  LL++GA + A TK+GFTPLH+AAK  +V VA  L+Q +    NA G+N LTPLH+ATHYN   V QLLLD  A   C+A NGYT LH+AAK+N+ D+A +LL  ++D    +N+ SR+GF+PL LA+QEGHTDVVSLLLQH AD NH++KNGL  +HL AQED V+VA+IL+ AGA+I+P T A Y+PLHTA HFGQ+NM +YL+ L +   INQ+TQ+GFTPLHLAAQQ H Q+V LLLE  AD NI+N QG T AHIARKQH++ IF++L+ VTT V+SWE E EE +   ++ +  + M EH  ++ +++G              +    + +N + SD+ D+K+   +     D  I   T NDDIW +LEYM S    RG  +  ++SQ  D    E  V ++  V+E V
Sbjct:   19 KVSGQLNETEQNFLRAARAGDLPKVVELLNTGVHINLSNSIGLTALHLASKEGYVHIVDELLRRGADFDAPTKKGNTALHIASLAGHFEVVKLLLDAGANLNRQSVIGFTPLYMAAQENHLDVVDLLLQRGANQALTTEDGFTPLAVALQQGHDRVVAHLLEKDSRSRGGMPALHIAARKDDANAVSLLLNNAEVNVNHQSQPGFTPLHIAAHYGNVTVARVLIERGADVNFQAKNNITPLHVAAKWGRGGMVQLLLNSNALVDCRTRDGLTPLHCAARSGHAELASLLMGAGANPSAKTRNGLTPLHMAAQGNNEEVARVLILRGASVADRTGDSLTPLHVAAHCGNAEVARVLLDNGCDVNACALNGFTPLHIACKKQKIRVIELLLQYGAQINMTTESGLSPLHVAAFIGGPEIVQLLLQRGAHVNQATMRCETALHLAVRNRQVDVAETLIYHGASVNAKARDEQTPLHVACLTGTPGLISVLLSCKANPNLPARDGYTALHIAAKEGRHDLLGQLLEAGADLNARTKKGFTPLHLAAKRGQVKVAKQLIQAQPKSVNAIGQNDLTPLHIATHYNRLPVVQLLLDYDAQVDCRAGNGYTALHMAAKQNHLDIATLLLAHESDQVQIANSSSRSGFTPLHLAAQEGHTDVVSLLLQHGADPNHQSKNGLAPLHLAAQEDHVSVAQILISAGAEISPLTRAGYSPLHTACHFGQVNMVRYLLDLPNAPDINQRTQMGFTPLHLAAQQCHSQVVRLLLEMGADSNIRNQQGLTPAHIARKQHFITIFDILKTVTTTVVSWEEEHEELDHQTLMLEHPDFMHEHPFAELDEDGAAPSPAISRKVSNKKIKTTEYENLHSSDTADQKSHSDQFNSAFDNTILAETENDDIWGQLEYMHSTLSPRGTLSDHITSQKGDENTSEFIVTQNSSVLETV 952          

HSP 2 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 356/721 (49.38%), Postives = 473/721 (65.60%), Query Frame = 1
Query: 3052 MKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERI---ESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNK--GMINDPNSGTS--------SLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTD------------------------------------KIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRN--NSSDEYSAYALLILWRSKRG-DLACGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDI 5058
            + +HI+  +G    S    F+   NS  L       + P+ I   E+  F   +  +  DWD E +N  +++KPV++GFLVSF+VDARGG +QA+R+ +LR ++PP+   GP R+VCRL+ P ++NSPP +NDGDG ACR++E+GP   +F SPIL+E+PH A L+++ REI+ILRS+NGETWKEHP++ATDQ++Q+++   F+   + EE+R   I RILT DLPQYFALI+RI+QE+ LIGPEG  ++S+VVP VQ  FP GAL K+ RVG+Q H +  E+VTR+LG RV+ SPI++IEPRRRKFHKPITLT+PLPKTV +  G  N+  S T         SLRLLCSITGG++PAVWEDI+GS+PLS H   VSFT+TVSARLWL+DCPN+  V E+A+ VY ES  VPY+GQFVVY RR   EEAQ R L LTDDS +KTLE QE FQ IA+GP +EVL + PHWIETAGNLVPV KT +QL + + A  ENR++ +VRVKD+ Q   GKLA + H R     AG+ +      KP T LE  LP+E    +D +      TG  +KTT   D                                     +AKSELDLR VA  +  DW  LA  LG+SD ED +NI +  N  +E  A+  L+LW+ + G DL  G +L +AL+ IGR+D++++CM NI  V   DE++ AL+ +
Sbjct:  924 LSDHITSQKGDENTS---EFIVTQNSSVLET-----VSPKSIHNTEAQMFGGAQP-DVGDWDLEIDNTTVIKKPVNTGFLVSFIVDARGGLIQARRYPDLRIFIPPNVVNGPLRIVCRLVHPDRLNSPPIMNDGDGLACRLLEIGPTGMRFASPILLEIPHCAFLKEKNREIVILRSDNGETWKEHPLDATDQSVQDNLNGHFDYAGSFEELRDKSIHRILTYDLPQYFALITRIKQELILIGPEGGTLTSTVVPDVQVHFPPGALQKRIRVGLQVHPVDNELVTRMLGPRVSVSPIVTIEPRRRKFHKPITLTIPLPKTVMRSSGGGNNTASMTKSRSTIDSPSLRLLCSITGGTSPAVWEDITGSSPLSAHDCSVSFTSTVSARLWLVDCPNITEVVELASRVYHESLAVPYIGQFVVYARRFHPEEAQLRCLCLTDDSAEKTLELQEGFQRIATGPCIEVLDDHPHWIETAGNLVPVAKTEEQLQLGMHAFRENRLNMIVRVKDLSQPAVGKLAFMRHPRAVLQSAGSPV------KPATVLEAKLPNEF---TDYM------TGAVLKTTDIDDIPSYIPEYDHQNGHQYTTNSESVPKTWEKQDQYEDEPLAKSELDLRQVAYHLKSDWRILAQCLGLSD-EDQYNITSLPNRPEEEYAFTSLLLWQERNGNDLTTGTQLAEALQAIGRKDILEHCMTNIFPVVTADERATALRSL 1619          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 446/792 (56.31%), Postives = 585/792 (73.86%), Query Frame = 1
Query:   73 TKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            ++   + S+SN S+LRAARAGNL K +D+L+TG DIN CN  GL+ALHLA+KEGH+ +V EL+K    +DA TKKGN+ALHIASLAG+ +VV+ LV NGANVN QS NGFTPLYMAAQENHLEVV FL+ +GA Q+I TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  +  LLL N    DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVAAK G   MV+LL+D GA +  +T+DGLTPLHC ARSGH Q+ E L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+V++D++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA ++A TE+GLTP+HV+AF+G +  V  L   GA+     +RGETALH+A R  Q + V+ LL+ GA  D KA+++QT LH+A+++G  E++ L LQ G+  + AT   YT LH+A +EG  E  SLLL+ GA + A TK+GFTPLH+AAKY ++  A +LLQK+A P+  GK GLTPLHVA HY++++VA LLLD+ A P   AKNGYTPLHIAAKKN  ++   LL   A++NA +R G SPL LA+QEG  D+VSLLL   A+VN   KNGLT +HL AQED+V VA +L++ GA++   T   YTPLH A H+G + M  +L  L +Q +IN KT+ G+TPLH AAQQGH  ++N+LL+ RA  N     G TA  IAR+  Y+++ + LR +T
Sbjct:   34 SREQKKKSDSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADV--ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFL--LENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLT 821          

HSP 2 Score: 445.277 bits (1144), Expect = 4.706e-127
Identity = 257/627 (40.99%), Postives = 368/627 (58.69%), Query Frame = 1
Query: 3181 SVNFATEEAYNKSDW--DFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIN----DPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPS---EIHPVSDTLRRKKMKTGEFI------KTTICTDKIA-------KSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLIL--WRSKRGDLACGNELEKALRDIGREDVV 4989
            SV+    E+  +  W  D    +   V  P+ SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL K  ++  PP + +G+G   R++E+GP    F  P+++E+PH+ S+R +ERE+I+LRS+NG+TWKEH  +   + +   +    E L +  E+   RI RI+T D PQYFA++SRI+QE   +GPEG V++S  VP V+A FP GAL KK RVG+QA  +P E+V  ++GNR + SPI+++EPRRRKFHKPIT+T+P+P    +   N    DP      LRLLCSITGG++PA WEDI+G+TPLSF  DCVSFTT VSAR WL DC  V     +AT +YRE   VPY+ +FVV+ +  D  EA+ R   +TDD VDKTLE QENF+ +A    +E+L  +P +++  GNL P +K+  QL  T  A  ENR+ F V+V+D+ QE  G+L+ L   +     +   L  SA    I  L   LP+   E+    D     K +   F       + +  TD  +       +++L +  VAD +G  W +LA  +  S  E +++IR  + +  +A + ++L  W S+ G  A  + L   L  + R D+V
Sbjct:  937 SVSREQNESLRRYSWTPDTMDHSHNTVSSPIHSGFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEHHYDCRGEDLLALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDP---APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQEACGRLSFLREPK-----SSKGLPHSA----ICNLNFTLPTHRKEMESDPDDENDNKDRRHTFASFALRKRYSYLTDPSSSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDE-INHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAGLTKVNRMDIV 1550          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 444/792 (56.06%), Postives = 582/792 (73.48%), Query Frame = 1
Query:   91 NSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            +S SN S+LRAARAGNL K +D+L+TG DIN CN  GL+ALHLA+KEGH+ +V EL+K    +DA TKKGN+ALHIASLAG+ +VV+ LV NGANVN QS NGFTPLYMAAQENHLEVV FL+ +GA Q+I TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  +  LLL +       S+V     + SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVAAK G   MV+LL+D GA +  +T+DGLTPLHC ARSGH Q+ E L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+V++D++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA ++A TE+GLTP+HV+AF+G +  V  L   GA+     +RGETALH+A R  Q + V+ LL+ GA  D KA+++QT LH+A+++G  E++ L LQ G+  + AT   YT LH+A +EG  E  SLLL+ GA + A TK+GFTPLH+AAKY ++  A +LLQK+A P+  GK GLTPLHVA HY++++VA LLLD+ A P   AKNGYTPLHIAAKKN  ++   LL   A++NA +R G SPL LA+QEG  D+VSLLL   A+VN   KNGLT +HL AQED+V VA +L++ GA++   T   YTPLH A H+G + M  +L  L +Q +IN KT+ G+TPLH AAQQGH  ++N+LL+ RA  N     G TA  IAR+  Y+++ + LR +T
Sbjct:    4 SSRSNASYLRAARAGNLEKALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFL--LENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLT 793          

HSP 2 Score: 445.662 bits (1145), Expect = 1.487e-126
Identity = 257/627 (40.99%), Postives = 368/627 (58.69%), Query Frame = 1
Query: 3181 SVNFATEEAYNKSDW--DFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIN----DPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPS---EIHPVSDTLRRKKMKTGEFI------KTTICTDKIA-------KSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLIL--WRSKRGDLACGNELEKALRDIGREDVV 4989
            SV+    E+  +  W  D    +   V  P+ SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL K  ++  PP + +G+G   R++E+GP    F  P+++E+PH+ S+R +ERE+I+LRS+NG+TWKEH  +   + +   +    E L +  E+   RI RI+T D PQYFA++SRI+QE   +GPEG V++S  VP V+A FP GAL KK RVG+QA  +P E+V  ++GNR + SPI+++EPRRRKFHKPIT+T+P+P    +   N    DP      LRLLCSITGG++PA WEDI+G+TPLSF  DCVSFTT VSAR WL DC  V     +AT +YRE   VPY+ +FVV+ +  D  EA+ R   +TDD VDKTLE QENF+ +A    +E+L  +P +++  GNL P +K+  QL  T  A  ENR+ F V+V+D+ QE  G+L+ L   +     +   L  SA    I  L   LP+   E+    D     K +   F       + +  TD  +       +++L +  VAD +G  W +LA  +  S  E +++IR  + +  +A + ++L  W S+ G  A  + L   L  + R D+V
Sbjct:  920 SVSREQNESLRRYSWTPDTMDHSHNTVSSPIHSGFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEHHYDCRGEDLLALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDP---APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQEACGRLSFLREPK-----SSKGLPHSA----ICNLNFTLPTHRKEMESDPDDENDNKDRRHTFASFALRKRYSYLTDPSSSPQSPCERTDLRMAIVADHLGLSWTELAREMNFSVDE-INHIRTENPNSLTAQSFMLLKKWVSRDGKNATTDALTAGLTKVNRMDIV 1533          

HSP 3 Score: 188.348 bits (477), Expect = 5.970e-47
Identity = 120/357 (33.61%), Postives = 184/357 (51.54%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNR----SKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVL 1140
            NT N     +   AARAG    V   L+ G  ++       +ALH+A++ G   IV+ L+++     A T  G + LH+A   G  E   +L+E+GA+++  +  GFTPL++AA+   +E    L+   A      + G TPL VA    ++R+  LLL++       +K     LHIA KKN +     LL     + N  +  G +PLH+AA  G+     LL+ + A+VN   KN +TPLH+AA+  R G+ ++L++ GA V   T+ G TPLH +   G+ ++   L++N A + SKT++G T LH AAQ        +LL  RA+ NE T +  T L +    G   V   L
Sbjct:  434 NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFG-AETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL 789          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 439/793 (55.36%), Postives = 588/793 (74.15%), Query Frame = 1
Query:   76 KSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNN-ITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARAL--NGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKV 2442
            K   + S+SN SFLRAARAGN+ KV+++L+ G DI T N  GL+ALHLAAKEGH+ +V+EL++R   +D+ TKKGN+ALHIASLAG+ EVVKILV+ GA++N QS NGFTPLYMA+QENHL+VV +L+ NG +Q+  TEDGFTPLA+ALQQGH ++V++LLEND + K RLPALHIA +K+D  +  LLL N    DV  QS SGFTPLHIAAHYGN   A LL+ + A V+F A+ N ITPLHVA+K G + MV+LL+D G+ +  +TRDGLTPLHC+ARSGH    E L++ GA ++++T+NGL+ LHMAAQGD  +  + LL  +A +++ T D+LT LHV AH G+ +V ++LLD+R +PNARAL  NGFTPLHIACKK+++K++ELL+KYGA I+A TE+GLTP+HV+AF+G    V +LLQ GA+ +   +RGETALH+A R  Q E V+ LL+ GA+ DA+ARE+QTPLH+A+++G  E++ L LQ  + P+ AT + YT LH++A+EG+ +  S+LL++GA     TK+GFTPLH+A+KY  + VA +LLQ++A P++ GKNGLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  ++A  LL  +A++N  ++ G +PL LASQEGH+D+ +LLLQ  A VN   K+GLT++HL AQED+V VA ILV  GA +   T   YTPL  A H+G   M  +L  L     +N KT+ G+TPLH AAQQG+  ++N+LL+  A PN     G TA  IAR+  Y+++ + LR V
Sbjct:   24 KRRPKKSDSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADV--QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFL--LKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTLRVV 812          

HSP 2 Score: 420.624 bits (1080), Expect = 3.130e-117
Identity = 245/560 (43.75%), Postives = 341/560 (60.89%), Query Frame = 1
Query: 3097 GDES----FLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEP-ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKM--------------------------------NSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPS 4665
            GD+S    +L+ MN    +      ++  R +  + A E    +  W  E  +N+ +   PV S FLVSFMVDARGG M+  R   LR  +PP     PTR+ CRL+K  ++                                 +PP LN+G+    RI+++GP  T+F  P+++E+PH+A+LR +ERE++ILRSE GE+WKEH  E T++ + N +    + L   EE+   RI RI+T D PQYFA++SRI+Q+  LIGPEG ++SS+VVPQVQAVFPEGAL K+ RVG+QA  + +++V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+PK+    ++N     T +LRLLCSIT G+ PA WEDI+G+TPL+F  DCVSFTT VSA  WLIDC   Q     AT VYRE   VPYM +FVV+ + HD  EA+ R   +TDD +DKTLE QENF  +A    VEVL  +P + +  GNLVP+TK+G     +  A  ENR++  ++++D  QEP G+L+ +   R+    A NA         I  L I LP+
Sbjct:  866 GDDSLPGQYLDGMNYLRFS------LEGGRSDVSSLANERDSYRLSWGTENLDNIALSSSPVHS-FLVSFMVDARGGAMRGCRHNGLRIIIPPRKCGAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLKLHLPTAPPPLNEGESLVSRILQLGPPGTKF-LPVIVEIPHFAALRGKERELVILRSETGESWKEHHCEYTEEEL-NQILNGMDELDPPEELERKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQSVNMDVVRKILGNKATFSPIVTLEPRRRKFHKPITMTIPIPKSSTDPVLNGFGGDTPTLRLLCSIT-GTTPAQWEDITGTTPLTFINDCVSFTTNVSA-FWLIDCRQAQESVNFATQVYREIICVPYMAKFVVFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFFAFKENRLALFIKIRDNTQEPCGRLSFMKEPRSYRSLAHNA---------ICNLNITLPT 1405          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ank3a (ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1])

HSP 1 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 431/774 (55.68%), Postives = 567/774 (73.26%), Query Frame = 1
Query:  145 KVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNS-------SEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            K +D+L+TG DIN CN  GL+ALHLA+KEGH+ +V EL+K    +DA TKKGN+ALHIASLAG+ +VV+ LV NGANVN QS NGFTPLYMAAQENHLEVV FL+ +GA Q+I TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  +  LLL +       S+V     + SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVAAK G   MV+LL+D GA +  +T+DGLTPLHC ARSGH Q+ E L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+V++D++ +PNA+ALNGFTPLHIACKK+++K++ELLLK+GA ++A TE+GLTP+HV+AF+G +  V  L   GA+     +RGETALH+A R  Q + V+ LL+ GA  D KA+++QT LH+A+++G  E++ L LQ G+  + AT   YT LH+A +EG  E  SLLL+ GA + A TK+GFTPLH+AAKY ++  A +LLQK+A P+  GK GLTPLHVA HY++++VA LLLD+ A P   AKNGYTPLHIAAKKN  ++   LL   A++NA +R G SPL LA+QEG  D+VSLLL   A+VN   KNGLT +HL AQED+V VA +L++ GA++   T   YTPLH A H+G + M  +L  L +Q +IN KT+ G+TPLH AAQQGH  ++N+LL+ RA  N     G TA  IAR+  Y+++ + LR +T
Sbjct:    2 KALDYLKTGVDINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHIASLAGQTDVVRELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLEHGASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVESKVHTYTHTHSGFTPLHIAAHYGNINVATLLLNRGAAVDFMARNDITPLHVAAKRGNGNMVKLLLDRGAKIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRVKVMELLLKHGASLQAVTESGLTPIHVAAFMGHENIVKQLTHHGASPNTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFGAETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFL--LENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTLRGLT 773          

HSP 2 Score: 421.009 bits (1081), Expect = 2.569e-117
Identity = 213/437 (48.74%), Postives = 291/437 (66.59%), Query Frame = 1
Query: 3271 SGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIN----DPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            S FLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL K  ++  PP + +G+G   R++E+GP    F  P+++E+PH+ S+R +ERE+I+LRS+NG+TWKEH  +   + +   +    E L +  E+   RI RI+T D PQYFA++SRI+QE   +GPEG V++S  VP V+A FP GAL KK RVG+QA  +P E+V  ++GNR + SPI+++EPRRRKFHKPIT+T+P+P    +   N    DP      LRLLCSITGG++PA WEDI+G+TPLSF  DCVSFTT VSAR WL DC  V     +AT +YRE   VPY+ +FVV+ +  D  EA+ R   +TDD VDKTLE QENF+ +A    +E+L  +P +++  GNL P +K+  QL  T  A  ENR+ F V+V+D+ QE  G+L+ L
Sbjct:  927 SRFLVSFMVDARGGSMRGSRHDGMRIIIPPRKCPAPTRITCRLAKRHRLAYPPPMVEGEGLVSRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIVLRSDNGDTWKEHHYDCRGEDLLALLNGMDEELDSPIELEKKRICRIVTKDFPQYFAVVSRIKQESDHMGPEGGVLTSEAVPMVRAAFPPGALTKKIRVGLQAQPVPEEVVRNVIGNRASFSPIVTVEPRRRKFHKPITMTIPVPPRAKEAAANGRKGDP---APCLRLLCSITGGTSPAQWEDITGTTPLSFVTDCVSFTTNVSARFWLADCQQVSETVALATPLYRELICVPYLAKFVVFAKPTDPMEARLRCFCMTDDKVDKTLEQQENFEEVARSKDIEILEGKPIYVDCYGNLAPFSKSSQQLIFTFYAFKENRLPFNVKVRDVGQEACGRLSFL 1360          

HSP 3 Score: 189.889 bits (481), Expect = 3.334e-47
Identity = 129/408 (31.62%), Postives = 202/408 (49.51%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNR----SKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALN--GFTPLHIACKKHKIKIVELLLKYGALIEATTETGLT 1287
            NT N     +   AARAG    V   L+ G  ++       +ALH+A++ G   IV+ L+++     A T  G + LH+A   G  E   +L+E+GA+++  +  GFTPL++AA+   +E    L+   A      + G TPL VA    ++R+  LLL++       +K     LHIA KKN +     LL     + N  +  G +PLH+AA  G+     LL+ + A+VN   KN +TPLH+AA+  R G+ ++L++ GA V   T+ G TPLH +   G+ ++   L++N A + SKT++G T LH AAQ        +LL  RA+ NE T +  T L +    G   V   L         R L     T      +KHK+ + E + ++  + +   E  +T
Sbjct:  414 NTTNVRGETALHMAARAGQADVVRYLLQNGAKVDIKAKDDQTALHIASRLGKAEIVQLLLQKGAWASAATTSGYTPLHLAVREGHQETASLLLEHGASLSAATKKGFTPLHVAAKYGQIEAAKLLLQKRAAPDTAGKTGLTPLHVAAHYDNQRVALLLLDHGASPHAAAKNGYTPLHIAAKKNQLEIGTTLLEFG-AETNAVTRQGISPLHLAAQEGSVDLVSLLLTKNANVNMGNKNGLTPLHLAAQEDRVGVAEVLLNHGAEVDAHTKTGYTPLHVACHYGNMKMVSFLLENQAKINSKTKSGYTPLHQAAQQGHTHIINMLLQHRASANELTLNGNTALSIARRLGYISVVDTL---------RGLTDENLTATPPVSEKHKLNVPETMNEFLDMSDDEGEDAMT 811          
BLAST of Ankyrin vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 860.522 bits (2222), Expect = 0.000e+0
Identity = 434/767 (56.58%), Postives = 572/767 (74.58%), Query Frame = 1
Query:  139 LSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            L K +D+L++G DIN CN  GL+ALHLA+KEGH+ +V +LIK    +DA TKKGN+ALHIASLAG+ +VVK LV NGANVN QS NGFTPLYMAAQENHL+VV +L++NG+ Q+I TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N    DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F+A+N+ITPLHVA+K G S MV+LL++ GA +  +T+DGLTPLHC ARSGH Q+ E L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA+V++D++ +PNA+ALNGFTPLHIACKK++IK++ELLLK+GA I+A TE+GLTP+HV+AF+G +  V  L+  GA+     +RGETALH+A R  QTE VK L++ GA  DAK++++QTPLH+++++G  E+I   LQ G+ P+  T   YT LH+AA+EG  +  S+LLD GA +   TK+GFTPLH+AAKY K+ VA++LLQK+A P+A+GK+GLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  ++A  LL   AD+NA +R G SPL LASQEG+ D+V+LL+   A +N   K+GLT +HL AQED+V VA +LV+ GA + P T   YTPLH A H+G + M  +L  L +Q ++N KT++       AAQQGH  ++NLLL+  A PN     G TA  IAR+  Y+++ + LR
Sbjct:    1 LEKALDYLKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADV--ESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFL--LKNQAKVNAKTKV------TAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTLR 757          

HSP 2 Score: 468.003 bits (1203), Expect = 2.074e-134
Identity = 265/596 (44.46%), Postives = 361/596 (60.57%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMIND-PNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPS--------EIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRA--VADQIGGDWEKLAAALGISDSEDLH-NIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            +NV +V  P+ SGFLVSFMVDARGG M+  R   +R  +PP     PTR+ CRL+K  K+ SPP + +G+G A R++E+GP    F  P+++E+PH+ S+R +ERE+IILRSENGETWKEH  +   +A+   +    E L + EE+   RI RI+T D PQYFA++SRI+QE   +GPEG V+SS  VP VQA FPEGAL KK RVG+QA  +P E V ++LGNR   SPI+++EPRRRKFHKPIT+T+P+P    +G+ N      T  LRLLCSITGG++PA WEDI+G+TPL+F  DCVSFTT VSAR WL DC  +     +AT +YRE   VPYM +FVV+ + +D  E+  R   +TDD VDKTLE QENF+ +A    +EVL  +P +++  GNL P+TK G QL +   A  ENR+ F V+++D  QEP G+L+ L   +               Q  +  L I LP+          H  +    RK+     ++     + +      DLR   VAD +G  W +LA  +  S  E  H  + N +S    ++ LL  W ++ G  A  + L  AL  I R D+V
Sbjct:  891 DNVNLVSSPIHSGFLVSFMVDARGGSMRGSRHNGMRIIIPPRKCTAPTRITCRLVKRHKLASPPPMVEGEGLASRLVEVGPAGAHFLGPVIVEIPHFGSMRGKERELIILRSENGETWKEHQYDCRTEALNELLNGMDEELESLEELEKKRICRIITKDFPQYFAVVSRIKQESNQMGPEGGVLSSMTVPHVQASFPEGALTKKIRVGLQAQPVPDETVKKILGNRATFSPIVTVEPRRRKFHKPITMTIPVPPLSGEGVTNGYKGDSTPCLRLLCSITGGTSPAQWEDITGTTPLTFVNDCVSFTTNVSARFWLADCHQIPDTVGLATQLYRELICVPYMAKFVVFAKMNDPVESNLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLTPLTKAGQQLLLNFYAFKENRLPFCVKIRDNSQEPCGRLSFLRELKTS---------KGIPQTAVCNLNITLPALKKTEKPERRHTFASLALRKRYS---YLTEPGMSPQSPCERTDLRMAIVADHLGLSWTELAREMDFSVDEINHIRVENPNSLTTQSFMLLKKWVNRDGKNATTDVLTAALTKINRMDIV 1474          

HSP 3 Score: 314.309 bits (804), Expect = 1.505e-85
Identity = 197/577 (34.14%), Postives = 308/577 (53.38%), Query Frame = 1
Query:  121 AARAGNLSKVIDFLETG--TDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLEN----DNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNE---------------------------------KSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASIL 1734
            AA  GN++     L  G   D    NDI  + LH+A+K G+  +VK L++R  RIDA TK G + LH  + +G  +VV++L++ GA +  ++ NG +PL+MA Q +HL  V  L+++       T D  T L VA   GH ++  ++++     + ++      LHIA KKN +  + LLL      +   + SG TP+H+AA  G+E                                 +  + L++  A V+ ++K++ TPLH++++ G+  ++Q L+  GA     T  G TPLH +AR GH  +   L+D GA +   T+ G T LH+AA+    + A +LL KRA  + +    LTPLHV AHY N+KVA +LLD+   P+A A NG+TPLHIA KK++++I   LL+YGA   A T  G++PLH+++  G+ + V +L+ + A I      G T LHLA + +Q    ++L+  GA  D + +   TPLHVA   GN++++   L++ +  N  T+        AA++G +  I+LLL  GA     T  G T L IA +   + V   L
Sbjct:  189 AAHYGNINVATLLLNRGAAVDFKARNDI--TPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHG-ASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKV------TAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          

HSP 4 Score: 164.081 bits (414), Expect = 1.512e-39
Identity = 114/386 (29.53%), Postives = 185/386 (47.93%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELL 1239
            NT N     +   AARAG    V   ++ G  ++  +    + LH++++ G   I+++L++     D+TT  G + LH+A+  G  +V  IL++ GA++ + +  GFTPL++AA+   +EV   L+   A    + + G TPL VA    ++++  LLL+          + H A K                       +G+TPLHIAA     + A  L+E  AD N   +  I+PLH+A++ G   MV LL+   A ++   + GLTPLH +A+     + E L+++GA V  +T+ G T LH+A           LL  +A +N  T          A  G+  +  +LL     PN   +NG T L IA +   I +V+ L
Sbjct:  407 NTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQG-------ASPHAAAK-----------------------NGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKV------TAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 876.7 bits (2264), Expect = 0.000e+0
Identity = 446/793 (56.24%), Postives = 587/793 (74.02%), Query Frame = 1
Query:   88 ENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLN-------SSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            + S++  SFLRAAR GNL +++D L+ G DINTCN  GL+ALHLA+KEGH+ +V EL+KRE  ID  TK GN+ALHIA+LAG+ ++V++LVE GAN+N QS NGFTPLYMAAQENHLE+V FL++NGA+Q++ TEDGFTPLAVALQQGHE++V LLLE+D + K RLPALHIA +K+D NA  LLL        +S++ +N  + SGFTPLHIAAHYGN   A LL+   A V+F A+N ITPLHVAAK G + MV+LL+D GA +  +TRDGLTPLHC+ARSGH ++ E L++  A +++KT+NGL+ LHMA QG+     ++LL ++A +++ T D+LTPLHV AH G+ +VA++LLDR  +PNARALNGFTPLHIACKK++IK++ELLLK+GA I  TTE+GLTP+HV++F+G    V +LLQ GA+     +RGET LH+A+R  Q E VK LL++GA    KARE+QTPLH+A+++G  E++ L LQ GSDPN  T    T L+ A++EG  +  SLLL++GA I   TK+GFTPLHIA+KY ++ VA++LL+K A+ +  GKNGLTPLHVATHY+H+KVA LLLD  A P   AKNGYTPLHIAAKKN  ++  +LL   A++N  ++ G +PL LA+QEGH D+V+LLL   A ++   K GLT+MHL AQEDKV VA IL    AD+  TT   YTPLH A+H+G I M  +L  L ++  +N KT+ G+TPLH AAQQGH  +VN LL+  A PN     G TA  IAR+  Y+++ + L  +T
Sbjct:    6 DKSDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFL--LRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILT 796          

HSP 2 Score: 168.318 bits (425), Expect = 3.496e-42
Identity = 121/391 (30.95%), Postives = 193/391 (49.36%), Query Frame = 1
Query:   79 SNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLEND----NRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELL 1239
            SN  N         A+RAG L  V   L++G  +        + LH+A++ G   IV+ L++R    +A T  G++ L+ AS  G  +V  +L+ENGA+++  +  GFTPL++A++   LEV T L+   A      ++G TPL VA    H+++  LLL+      + +K     LHIA KKN +    +LL     + N  +  G  PLH+AA  G+     LL+ + A ++   K  +T +H+AA+  +  + ++L    A V+  T+   TPLH ++  G+ ++   L+ N A V +KTRNG T LH AAQ         LL   A+ NE T +  T L +    G   V   L     +P        T ++   +KHK+ + E +
Sbjct:  436 SNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELG-AETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILTEEP-------VTGVNTVIEKHKLNVPETM 818          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 871.692 bits (2251), Expect = 0.000e+0
Identity = 446/786 (56.74%), Postives = 583/786 (74.17%), Query Frame = 1
Query:   94 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQK--KANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            S++  SFLRAAR GNL +++D L+ G DINTCN  GL+ALHLA+KEGH+ +V EL+KRE  ID  TK GN+ALHIA+LAG+ ++V++LVE GAN+N QS NGFTPLYMAAQENHLE+V FL++NGA+Q++ TEDGFTPLAVALQQGHE++V LLLE+D + K RLPALHIA +K+D NA  LLL   E + +  S SGFTPLHIAAHYGN   A LL+   A V+F A+N ITPLHVAAK G + MV+LL+D GA +  +TRDGLTPLHC+ARSGH ++ E L++  A +++KT+NGL+ LHMA QG+     ++LL ++A +++ T D+LTPLHV AH G+ +VA++LLDR  +PNARALNGFTPLHIACKK++IK++ELLLK+GA I  TTE+GLTP+HV++F+G    V +LLQ GA+     +RGET LH+A+R  Q E VK LL++GA    KARE+QTPLH+A+++G  E++ L LQ GSDPN  T    T L+ A++EG  +  SLLL++GA I   TK+GFTPLHIA+KY ++ VA++LL+K   A+P   G+NGLTPLHVATHY+H+KVA LLLD  A P   AKNGYTPLHIAAKKN  ++  +LL   A++N  ++ G +PL LA+QEGH D+V+LLL   A ++   K GLT+MHL AQEDKV VA IL    AD+  TT   YTPLH A+H+G I M  +L  L ++  +N KT+ G+TPLH AAQQGH  +VN LL+  A PN     G TA  IAR+  Y+++ + L  +T
Sbjct:    9 SDAATSFLRAARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLL-QHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFL--LRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILT 791          

HSP 2 Score: 169.088 bits (427), Expect = 1.683e-42
Identity = 122/393 (31.04%), Postives = 195/393 (49.62%), Query Frame = 1
Query:   79 SNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINN--GADQTITTEDGFTPLAVALQQGHERIVALLLEND----NRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELL 1239
            SN  N         A+RAG L  V   L++G  +        + LH+A++ G   IV+ L++R    +A T  G++ L+ AS  G  +V  +L+ENGA+++  +  GFTPL++A++   LEV T L+     AD  +  ++G TPL VA    H+++  LLL+      + +K     LHIA KKN +    +LL     + N  +  G  PLH+AA  G+     LL+ + A ++   K  +T +H+AA+  +  + ++L    A V+  T+   TPLH ++  G+ ++   L+ N A V +KTRNG T LH AAQ         LL   A+ NE T +  T L +    G   V   L     +P        T ++   +KHK+ + E +
Sbjct:  429 SNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELG-AETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTLSILTEEP-------VTGVNTVIEKHKLNVPETM 813          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 569.696 bits (1467), Expect = 3.021e-172
Identity = 292/523 (55.83%), Postives = 381/523 (72.85%), Query Frame = 1
Query:  877 RDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            +DGLTPLHC+ARSGH Q+ E L++ GA +++KT+NGL+ LHMA QGD  +  ++L+  RA +++ T D+LT LHV AH G+ + A+VLLD+  +PN RALNGFTPLHIACKK++I+++ELLLKYGA IEA TE+GLTP+HVSAF+G+   V +LLQ GA+     +RGETALH+A R  QTE V+ LL+ GA  DAKARE QTPLH+A ++G LE++ L LQ  + P+ AT + YT LHVAA+EG  +  ++LL+ GA +   TK+GFTPLH+A+KY K+ VAS+LLQ+ A+P+A GKNGLTPLHVA+HY+++KVA LLLD  A P   AKNGYTPLHIAAKK+  ++A  LL   A++NA +R G +PL L +QEGH DV SLLL   ADVNH  K+GL+ +HL AQEDKV VA ILV  GA +  TT   YTPL  A H+G I M  +L  L     +N KT+ G+TPLH AAQQGH  +VNLLL+  A PN     G TA  IAR+  Y+++ + L+ VT
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFL--LQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVT 524          

HSP 2 Score: 322.013 bits (824), Expect = 9.220e-90
Identity = 192/538 (35.69%), Postives = 295/538 (54.83%), Query Frame = 1
Query:  121 AARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASIL 1734
            AAR+G+   V   LE G  I      GLS LH+A +  H+  V+ L++    +D  T    +ALH+A+  G +   K+L++ GAN N+++ NGFTPL++A ++N + V+  L+  GA     TE G TP+ V+   G+  IV +LL+                     NA N+               G T LH+AA  G  +  + L+   A V+ +A+   TPLH+AA+ G+  +VQLL+   A     T +G TPLH +AR GH  +   L+++GA +   T+ G T LH+A++    + A +LL + A+ +    + LTPLHV +HY N+KVA +LLD+   P+A A NG+TPLHIA KK +++I   LL+YGA   A T  G+ PLH+ A  G  +  ++LL + A++   T  G + LHLA + ++    ++L+K GA  +A  +   TPL VA   GN++++   LQ G+D N  T++ YT LH AA++G +  ++LLL  GA+    T  G T L IA +   + V   L
Sbjct:   13 AARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASP----------------NATNV--------------RGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 3 Score: 309.686 bits (792), Expect = 7.781e-86
Identity = 199/561 (35.47%), Postives = 306/561 (54.55%), Query Frame = 1
Query:  490 EDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARIL-VHAGADITPTTTA 2169
            +DG TPL  A + GHE++V +LLE      Q  P L  A  KN                      G +PLH+A    + +  Q+L++ +A V+    + +T LHVAA  G     ++L+D GA  + R  +G TPLH + +    ++ E L+  GA + + T +GLT +H++A     +   ILL   A+ N T     T LH+ A  G  +V R LL      +A+A    TPLHIA +  K++IV+LLL++ A  +A T  G TPLHV+A  G ++   +LL+ GA++   T +G T LH+A++  + E   LLL+  A PDA  +   TPLHVA+   N ++  L L  G+ P+   ++ YT LH+AAK+ + E  + LL+ GA+  A T++G  PLH+ A+     VAS+LL + A+ N   K+GL+PLH+A   +   VA++L+ + A      K GYTPL +A    N  +   LL   AD N++++NG++PL  A+Q+GHT +V+LLL+  A  N    NG T++ +  +   ++V   L V     IT TT +
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLE------QGAPIL--AKTKN----------------------GLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVS 534          

HSP 4 Score: 254.603 bits (649), Expect = 2.442e-68
Identity = 160/441 (36.28%), Postives = 244/441 (55.33%), Query Frame = 1
Query:  121 AARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLK 1443
            +A  GNL+ V+  L+ G   N  N  G +ALH+AA+ G   +V+ L++   ++DA  ++  + LHIA+  GK E+V++L+++ A+ +  ++NG+TPL++AA+E H +V   L+ +GA   +TT+ GFTPL VA + G   + +LLL       QR  +   A K                       +G TPLH+A+HY N+K A LL++Q A  +  AKN  TPLH+AAK  +  +   L++ GA  +  TR G+ PLH  A+ GHA +   L+   ADV   T++GL+ LH+AAQ D  + A IL+   A++N TT    TPL V  HYGN K+   LL    D N++  NG+TPLH A ++    IV LLLK GA     T  G T L ++  +G    V+ L      + + T+   T  + ++R N  ET+  +L+
Sbjct:  145 SAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL-------QRFASPDAAGK-----------------------NGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL----KVVTEETITSTTVSNPSSRVNVPETMTEVLE 551          

HSP 5 Score: 194.897 bits (494), Expect = 7.506e-50
Identity = 88/171 (51.46%), Postives = 115/171 (67.25%), Query Frame = 1
Query: 4057 LCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            L ++TGG+APA WEDI+G+TPL+F K CVSFTT VSAR WLIDC          T +YRE   VPYM +FVV+ + HD  EA+ R   +TDD VDKTLE QENF  +A    VEVL  +P ++E  GNLVP+TK G Q +++  A  ENR+ F+V+++D  QE  G+L  +
Sbjct:  959 LMTLTGGTAPAQWEDITGTTPLTFTKQCVSFTTNVSARFWLIDCRQTHEAVNFTTQMYRELVCVPYMAKFVVFAKTHDPVEARLRCFCMTDDKVDKTLEQQENFSEMARSRDVEVLEGKPIYVECFGNLVPLTKAGQQHALSFYAFRENRLPFMVKIRDSNQEACGRLCFM 1129          

HSP 6 Score: 179.104 bits (453), Expect = 5.362e-45
Identity = 116/357 (32.49%), Postives = 182/357 (50.98%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNR----SKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVL 1140
            N  N     +   AARAG    V   L  G  ++       + LH+AA+ G + IV+ L++     DA T  G + LH+A+  G  +V  IL+E+GA++ + +  GFTPL++A++   +EV + L+   A      ++G TPL VA    ++++  LLL+        +K     LHIA KK+ +     LL     + N  +  G  PLH+ A  G+   A LL+ + ADVN   K+ ++PLH+AA+  +  + ++L+  GA V+  T+ G TPL  +   G+ ++   L+ +GADV SKT+NG T LH AAQ        +LL   A  N+ T +  T L +    G   V   L
Sbjct:  165 NATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYG-AETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 7 Score: 119.783 bits (299), Expect = 7.458e-27
Identity = 66/163 (40.49%), Postives = 95/163 (58.28%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKM---------------------------------NSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAI 3627
            +NV +   P+ SGFLVSFMVDARGG M+  R   LR  +PP   + PTR+ CRL+K  ++                                 N+PP LNDG+    RI+++GP  T F  P+++E+PH+ASLR +ERE+++LRSENGETW+EH  E +++ +
Sbjct:  669 DNVALSSSPIHSGFLVSFMVDARGGSMRGCRHHGLRIVIPPRKCMAPTRVTCRLVKRHRLAALPPVLEGEGLASRVVEVGPSGGQFLGKLHLPNTPPPLNDGESLVSRILQLGPPGTTFLGPVIVEIPHFASLRGKERELVVLRSENGETWREHQSECSEEEL 831          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 469.159 bits (1206), Expect = 4.378e-141
Identity = 247/436 (56.65%), Postives = 315/436 (72.25%), Query Frame = 1
Query: 1138 LLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            LLD+  +PN RALNGFTPLHIACKK++I+++ELLLKYGA IEA TE+GLTP+HVSAF+G+   V +LLQ GA+     +RGETALH+A R  QTE V+ LL+ GA  DAKARE QTPLH+A ++G LE++ L LQ  + P+ AT + YT LHVAA+EG  +  ++LL+ GA +   TK+GFTPLH+A+KY K+ VAS+LLQ+ A+P+A GKNGLTPLHVA+HY+++KVA LLLD  A P   AKNGYTPLHIAAKK+  ++A  LL   A++NA +R G +PL L +QEGH DV SLLL   ADVNH  K+GL+ +HL AQEDKV VA ILV  GA +  TT   YTPL  A H+G I M  +L  L     +N KT+ G+TPLH AAQQGH  +VNLLL+  A PN     G TA  IAR+  Y+++ + L+ VT
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFL--LQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVT 434          

HSP 2 Score: 293.893 bits (751), Expect = 3.855e-82
Identity = 167/430 (38.84%), Postives = 246/430 (57.21%), Query Frame = 1
Query:  742 LIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLL 2031
            L+++ A+ N +A N  TPLH+A K  R  +++LL+  GA +   T  GLTP+H SA  G+  +   L+  GA   +    G T+LHMAA+    +  R LL   A ++    +  TPLH+ A  G  ++ ++LL     P+A   NG+TPLH+A ++    +  +LL++GA +  TT+ G TPLHV++  G  E  ++LLQ+ A+ +     G T LH+A+  +  +   LLL  GA P A A+   TPLH+A K   LE+ T  L+ G++ N  TR     LH+ A+EG ++  SLLL   A +   TK G +PLH+AA+ DKV VA IL++  A+ NAT K G TPL VA HY + K+   LL + AD   K KNGYTPLH AA++ +  +  +LL   A  N  + NG + L +A + G+  VV  L
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 3 Score: 282.337 bits (721), Expect = 2.775e-78
Identity = 166/460 (36.09%), Postives = 255/460 (55.43%), Query Frame = 1
Query:  355 LVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASIL 1734
            L++ GAN N+++ NGFTPL++A ++N + V+  L+  GA     TE G TP+ V+   G+  IV +LL+                     NA N+               G T LH+AA  G  +  + L+   A V+ +A+   TPLH+AA+ G+  +VQLL+   A     T +G TPLH +AR GH  +   L+++GA +   T+ G T LH+A++    + A +LL + A+ +    + LTPLHV +HY N+KVA +LLD+   P+A A NG+TPLHIA KK +++I   LL+YGA   A T  G+ PLH+ A  G  +  ++LL + A++   T  G + LHLA + ++    ++L+K GA  +A  +   TPL VA   GN++++   LQ G+D N  T++ YT LH AA++G +  ++LLL  GA+    T  G T L IA +   + V   L
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASP----------------NATNV--------------RGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 4 Score: 269.626 bits (688), Expect = 3.421e-74
Identity = 164/444 (36.94%), Postives = 253/444 (56.98%), Query Frame = 1
Query:  841 LIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARIL-VHAGADITPTTTA 2169
            L+D GA  + R  +G TPLH + +    ++ E L+  GA + + T +GLT +H++A     +   ILL   A+ N T     T LH+ A  G  +V R LL      +A+A    TPLHIA +  K++IV+LLL++ A  +A T  G TPLHV+A  G ++   +LL+ GA++   T +G T LH+A++  + E   LLL+  A PDA  +   TPLHVA+   N ++  L L  G+ P+   ++ YT LH+AAK+ + E  + LL+ GA+  A T++G  PLH+ A+     VAS+LL + A+ N   K+GL+PLH+A   +   VA++L+ + A      K GYTPL +A    N  +   LL   AD N++++NG++PL  A+Q+GHT +V+LLL+  A  N    NG T++ +  +   ++V   L V     IT TT +
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVS 444          

HSP 5 Score: 253.062 bits (645), Expect = 8.506e-69
Identity = 153/406 (37.68%), Postives = 228/406 (56.16%), Query Frame = 1
Query:  121 AARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNML 1338
            +A  GNL+ V+  L+ G   N  N  G +ALH+AA+ G   +V+ L++   ++DA  ++  + LHIA+  GK E+V++L+++ A+ +  ++NG+TPL++AA+E H +V   L+ +GA   +TT+ GFTPL VA + G   + +LLL       QR  +   A K                       +G TPLH+A+HY N+K A LL++Q A  +  AKN  TPLH+AAK  +  +   L++ GA  +  TR G+ PLH  A+ GHA +   L+   ADV   T++GL+ LH+AAQ D  + A IL+   A++N TT    TPL V  HYGN K+   LL    D N++  NG+TPLH A ++    IV LLLK GA     T  G T L ++  +G    V+ L
Sbjct:   55 SAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLL-------QRFASPDAAGK-----------------------NGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 6 Score: 245.743 bits (626), Expect = 2.535e-66
Identity = 153/442 (34.62%), Postives = 235/442 (53.17%), Query Frame = 1
Query:  667 NHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIML-------LVSDADSNAESRN 1971
            N ++ +GFTPLHIA      +  +LL++  A +    ++ +TP+HV+A  G   +V +L+  GA  +     G T LH +AR+G  ++   L+ NGA V +K R   T LH+AA+    +  ++LL   A+ +  T++  TPLHV A  G+E V  +LL+           GFTPLH+A K  K+++  LLL+  A  +A  + GLTPLHV++   +++   +LL +GA+       G T LH+A + +Q E    LL+ GA  +A  R+   PLH+  + G+ ++ +L L   +D N AT+   + LH+AA+E +     +L+  GA + A TK G+TPL +A  Y  + + + LLQ  A+ N+  KNG TPLH A    H  +  LLL   A P     NG T L IA +     +   L       + S   SN  SRN
Sbjct:    9 NVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTLKVVTEETITSTTVSNPSSRN 450          

HSP 7 Score: 194.897 bits (494), Expect = 3.631e-50
Identity = 88/171 (51.46%), Postives = 115/171 (67.25%), Query Frame = 1
Query: 4057 LCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            L ++TGG+APA WEDI+G+TPL+F K CVSFTT VSAR WLIDC          T +YRE   VPYM +FVV+ + HD  EA+ R   +TDD VDKTLE QENF  +A    VEVL  +P ++E  GNLVP+TK G Q +++  A  ENR+ F+V+++D  QE  G+L  +
Sbjct:  835 LMTLTGGTAPAQWEDITGTTPLTFTKQCVSFTTNVSARFWLIDCRQTHEAVNFTTQMYRELVCVPYMAKFVVFAKTHDPVEARLRCFCMTDDKVDKTLEQQENFSEMARSRDVEVLEGKPIYVECFGNLVPLTKAGQQHALSFYAFRENRLPFMVKIRDSNQEACGRLCFM 1005          

HSP 8 Score: 177.948 bits (450), Expect = 5.769e-45
Identity = 116/357 (32.49%), Postives = 182/357 (50.98%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNR----SKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVL 1140
            N  N     +   AARAG    V   L  G  ++       + LH+AA+ G + IV+ L++     DA T  G + LH+A+  G  +V  IL+E+GA++ + +  GFTPL++A++   +EV + L+   A      ++G TPL VA    ++++  LLL+        +K     LHIA KK+ +     LL     + N  +  G  PLH+ A  G+   A LL+ + ADVN   K+ ++PLH+AA+  +  + ++L+  GA V+  T+ G TPL  +   G+ ++   L+ +GADV SKT+NG T LH AAQ        +LL   A  N+ T +  T L +    G   V   L
Sbjct:   75 NATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYG-AETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLLKCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 9 Score: 127.102 bits (318), Expect = 3.610e-29
Identity = 63/130 (48.46%), Postives = 94/130 (72.31%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAI 3627
            +NV +   P+ SGFLVSFMVDARGG M+  R   LR  +PP   + PTR+ CRL+K  ++ + P + +G+G A R++E+GP   QF  P+++E+PH+ASLR +ERE+++LRSENGETW+EH  E +++ +
Sbjct:  578 DNVALSSSPIHSGFLVSFMVDARGGSMRGCRHHGLRIVIPPRKCMAPTRVTCRLVKRHRLAALPPVLEGEGLASRVVEVGPSGGQFLGPVIVEIPHFASLRGKERELVVLRSENGETWREHQSECSEEEL 707          
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006531.1 (pep scaffold:Pmarinus_7.0:GL477280:1359:33855:1 gene:ENSPMAG00000005898.1 transcript:ENSPMAT00000006531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 330.487 bits (846), Expect = 1.344e-90
Identity = 185/395 (46.84%), Postives = 266/395 (67.34%), Query Frame = 1
Query: 3418 NSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVN-----------KGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL 4569
            ++PP LN+G+    R++++GP  T F  P+L+E+PH+ASLR RERE+++LRS +G+TWKEH  +  +  + + +    E L + EE+   RI RI+T D PQYFA++SR+RQE  ++GPEG V+S +VVP V+A FP+GAL K+ +VG+QAH +P ++V ++LGN+ A SPI+++EPRRRKFHKPIT+T+P+P++ +            G           LRLLCSITGG +PA WEDI+G+TPL+     VSFTT VSAR WL+ C        +A  +Y+E+T VPY+  FVV+ +  +  E++ R   +TDD VDKTLE QENF  +A    VEV+  +P ++E  GNLVP+TK+G Q S    A  ENR+ F V+V+D+ QEP G+L  +
Sbjct:    6 STPPPLNEGESLVSRLLQLGPEGTSFIGPVLVEIPHFASLRGRERELVVLRSGDGKTWKEHQNDCKNDDLNDVLNGMDEELDSLEELERKRICRIVTRDFPQYFAVVSRVRQESEVVGPEGGVLSCTVVPDVRASFPQGALTKRIKVGLQAHPVPEDMVRKVLGNKAAFSPIVTVEPRRRKFHKPITMTIPVPQSTSAITAASADTRVNGFSETVPDTPPPLRLLCSITGGISPAHWEDITGTTPLTITTSTVSFTTNVSARFWLLYCRQPPEAVNLANRLYQEATCVPYLATFVVFSKAVEAVESRLRCFCMTDDRVDKTLEQQENFTEVARSRDVEVMEGKPIYVECFGNLVPLTKSGQQHSFNFYAFKENRLPFYVKVRDVTQEPCGRLCFM 400          
BLAST of Ankyrin vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 78.1814 bits (191), Expect = 1.733e-14
Identity = 44/105 (41.90%), Postives = 65/105 (61.90%), Query Frame = 1
Query:  199 GLSALHLAAKEGHIVIVKELIKREPR-IDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGF--TPLYMAAQENHLEVVTFLINNGADQTITTEDGFT 504
            G + L +A  +G   +VK++I+     I+     GN+ALH A+L G  E+V++L+ENGA+VN++S   F  TPL  A+   HL+VV +L+ NGAD TI    G T
Sbjct:  330 GRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLT 434          

HSP 2 Score: 55.8398 bits (133), Expect = 1.026e-7
Identity = 39/100 (39.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query: 1168 RALNGFTPLHIACKKHKIKIVELLLKYGAL-IEATTETGLTPLHVSAFIGSKEAVNMLLQKGA--NIEQGTMRGETALHLATRNNQTETVKLLLKAGAIP 1458
            R   G T L IAC K K  +V+ +++ G   I      G T LH +A  G  E V +L++ GA  NI+   M G+T L  A+ N   + VK LLK GA P
Sbjct:  326 RDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADP 425          

HSP 3 Score: 51.2174 bits (121), Expect = 3.337e-6
Identity = 82/320 (25.62%), Postives = 132/320 (41.25%), Query Frame = 1
Query: 1279 GLTPLHVSAFIGSKEAVNMLLQKGA-NIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARE--NQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLL-----LDNKADPK------CKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTA-QEDKVTVARILVHAGADITPTTTAEYTPLHTA 2193
            G T L ++   G  + V  ++++G  +I      G TALH A      E V+LL++ GA  + K+ E    TPL  A+  G+L+++   L++G+DP +      TA      E   +      +   KI  E K+    L IAAK      A I   K  N N        P    T   +EK A        +D KA  +        ++ G   L  A+K+ +  L  +    +     + R+ F  ++     GH D+ S+ L     VN  +++  TS  + A     +   ++L+ AGAD T       T L+ A
Sbjct:  330 GRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTAF-----ESVDDESEFDDEEDQKILREIKKR---LSIAAK-KWTNRAGIHNDKSKNGNNAHTIDQPPFDNTTKAKNEKAADSPSMASNIDEKAPEEEFYWTDVTSRAGKEKLFKASKEGH--LPYVGTYVENGGKIDLRSFFESVKC----GHEDITSIFLAFGFPVNQTSRDNKTSALMVAVGRGHLGTVKLLLEAGADPTKRDKKGRTALYYA 634          
BLAST of Ankyrin vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 75.8702 bits (185), Expect = 7.654e-14
Identity = 71/239 (29.71%), Postives = 111/239 (46.44%), Query Frame = 1
Query:  115 LRAARAGNLSKVIDFLETGTDINTCNDIG-----LSALHLAAKEGHIVIVKELIK---REPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTN-GFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLEN---------DNRS-KQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQ 774
            L+A R+GN        E+G +    ND       L+  H A + G +  VKE+I     E   D  + +  + LH AS+  +  VV  LV  GA+VN ++     TPL+ AA+  ++ +V FL+ +GAD T+T + GF  L +++   +  +V  +L N         D R  K R   L  A + + +    LL   + + +    + GFTPLH     G     + LI+  AD  FQ
Sbjct:   46 LKAIRSGNEE------ESGNEQVNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKI--ADTEGFTPLHWGTVKGQPHVLKYLIQDGADF-FQ 275          

HSP 2 Score: 73.559 bits (179), Expect = 3.749e-13
Identity = 73/265 (27.55%), Postives = 114/265 (43.02%), Query Frame = 1
Query:  664 VNHQSSSGFTPL----HIAAHYGNEKSAQLLIEQKA-DVN--FQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRD-GLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRC-DPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVK 1431
            VNH   +   PL    H A   G+  + + +I  K  +VN    +  +IT LH A+   R  +V  L+  GA V+ R      TPLH +AR G+  + + L+ +GAD       G   LH++      +++ I+L+     N                    V++ LLD  C DP  R     + L  A +   + + ELL K+GA I+     G TPLH     G    +  L+Q GA+  Q T  G+    +A   N   +++
Sbjct:   62 VNHNDEAEEDPLLTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSV-----NSSNIMLVLYVLFN-------------------VVSKGLLDIDCRDPKGRT----SLLWAAYQGDSLTVAELL-KFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMNTVYSLR 297          

HSP 3 Score: 66.2402 bits (160), Expect = 6.487e-11
Identity = 60/209 (28.71%), Postives = 90/209 (43.06%), Query Frame = 1
Query: 1657 EAETKRGFTPLHIAAKYDKVGVASILLQKKANPNA-TGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTA-QEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLG 2277
            + ++    T LH A+  +++ V   L+ + A+ NA  G    TPLH A  Y +  +   LL + ADP      G+  LH++   +N  L + +L                          +VVS   +   D++ +   G TS+   A Q D +TVA +L   GA I    T  +TPLH     GQ ++ KYLI   D     QKT  G
Sbjct:  103 DGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLF-------------------------NVVS---KGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELL-KFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQ--DGADFFQKTDTG 280          

HSP 4 Score: 64.6994 bits (156), Expect = 1.858e-10
Identity = 62/202 (30.69%), Postives = 91/202 (45.05%), Query Frame = 1
Query:  985 LTSLHMAAQ-GDFEDTARILLLKRANINET--TTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARA--LNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTM-------RGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSD 1554
            LT  H A Q GD      ++  K   +N    +T+ +T LH  +      V   L+ +  D NARA  L+  TPLH A +   + IV+ LLK+GA    T + G   LH+S  + S   + +L      + +G +       +G T+L  A     + TV  LLK GA       E  TPLH  T  G   ++   +Q G+D
Sbjct:   74 LTRYHTACQRGDLATVKEMIHGKLLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHA-TPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLS--VNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGAD 272          

HSP 5 Score: 63.1586 bits (152), Expect = 5.273e-10
Identity = 53/182 (29.12%), Postives = 83/182 (45.60%), Query Frame = 1
Query: 1384 TALHLATRNNQTETVKLLLKAGAIPDAKARE-NQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSE-AISLLLDSGAK----IEAETKRGFTPLHIAA-KYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKN 1908
            T LH A+ NN+   V  L+  GA  +A+A   + TPLH A + G + ++   L+ G+DP +     +  LH++         + +L +  +K    I+    +G T L  AA + D + VA  LL+  A+       G TPLH  T      V + L+ + AD   K   G     IA + N
Sbjct:  111 TGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAE-LLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIAQEMN 291          

HSP 6 Score: 60.8474 bits (146), Expect = 2.974e-9
Identity = 43/138 (31.16%), Postives = 68/138 (49.28%), Query Frame = 1
Query:  121 AARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELI-----KREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVA 519
            AAR G +  V   L+ G D    +D G + LHL+    +I++V  ++     K    ID    KG ++L  A+  G    V  L++ GA++ +  T GFTPL+    +    V+ +LI +GAD    T+ G    A+A
Sbjct:  150 AARYGYVYIVDFLLKHGADPTMTDDQGFNLLHLSVNSSNIMLVLYVLFNVVSKGLLDIDCRDPKGRTSLLWAAYQGDSLTVAELLKFGASIKIADTEGFTPLHWGTVKGQPHVLKYLIQDGADFFQKTDTGKDCFAIA 287          
BLAST of Ankyrin vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 70.4774 bits (171), Expect = 2.063e-13
Identity = 53/174 (30.46%), Postives = 83/174 (47.70%), Query Frame = 1
Query: 1177 NGFTPLHIACKKHKIKIVELLLKYGA---LIEATTETGLTPLHVSAFIGSKEAVNMLLQK--GANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSG-SDPNVATRDNYTALHVAAKEGRSEAISLLLDS-GAKIEAETKRG 1677
            +G  PLH +      +I   LL       L +   ++G TP H++  +G+ E V  L  +    ++ + T +G T LHLA      E  + L++ GA    K + NQ PLH A  +G+L+LI L    G S  N   +  +T L  A  EG  +A  LL++  GA+ +    +G
Sbjct:   35 DGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKG 208          

HSP 2 Score: 70.0922 bits (170), Expect = 3.065e-13
Identity = 53/161 (32.92%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  190 NDIGLSALHLAAKEGHIVIVKELIKR--EPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTED--GFTPLAVALQQGHERIVALLLEN--------DNR-SKQRLPALHIAVKKNDVNAV 633
            +D G +  H+A   G++ +VK L  R  +P ++  T +G + LH+A     FEV + L+ENGA+V ++      PL+ AA    L+++  L   G    +  +D  G+TPL  AL +GH     LL+E         DN+ +K    AL+  VKK  +N V
Sbjct:   69 DDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGK-SAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLNNV 228          

HSP 3 Score: 67.0106 bits (162), Expect = 3.133e-12
Identity = 59/221 (26.70%), Postives = 87/221 (39.37%), Query Frame = 1
Query: 1189 PLHIACKKHKI-KIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDP--NVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQ-KKANPNATGKNGLTPLHVATHYNHEKVAQLLLD 1839
            PLH AC +++  K+ ELL    +L+    + G  PLH S    + E  + LL K  N+                               + D       TP H+A  +GNLE++         P  N  T    T LH+A  +   E    L+++GA +  + K    PLH AA    + +  +L    K+  N   K G TPL  A    H   A LL++
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVN------------------------------LDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 4 Score: 62.7734 bits (151), Expect = 8.117e-11
Identity = 62/223 (27.80%), Postives = 104/223 (46.64%), Query Frame = 1
Query: 1783 PLHVATHYN-HEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESR---NGFSPLQLASQEGHTDVVSLLLQH--KADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESR-ADPNIKNNQGWTAAHIAR----KQHYLN 2418
            PLH A   N   KV +LL    +    K ++G  PLH +      ++   LL    + N +     +G++P  +A   G+ +VV  L     K D+N     G+T +HL   +    V++ L+  GA +         PLH AA  G + + + L  L  ++ +N + + G+TPL  A  +GH     LL+E   A+ ++ +N+G  A  +A     K+ +LN
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGL-GKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVALNEQVKKFFLN 226          

HSP 5 Score: 61.2326 bits (147), Expect = 2.815e-10
Identity = 47/162 (29.01%), Postives = 71/162 (43.83%), Query Frame = 1
Query: 1570 RDNYTALHVAAKEGRSEAISLLLDSGAKI---EAETKRGFTPLHIAAKYDKVGVASILLQKKANP--NATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLL-VSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQ 2037
            +D    LH +      E  S LL     +   +     G+TP HIA     + V   L  +   P  N     G+T LH+A      +V+Q L++N A  + K K    PLH AA   +  L  +L  +  +  N + + G++PL  A  EGH D   LL++
Sbjct:   34 QDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVE 195          

HSP 6 Score: 59.6918 bits (143), Expect = 8.550e-10
Identity = 54/183 (29.51%), Postives = 84/183 (45.90%), Query Frame = 1
Query:  406 PLYMAAQENHLEVVTFLINNGADQTITT-EDGFTPLAVALQ-QGHERIVALLLENDNRSKQRLP------ALHIAVKKNDVNAVNLLLNSS-EVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSG-ALVSCRTRDGLTPLHCSARSGHA 924
            PL+ A  EN    V  L+++     +   +DG  PL  ++  Q HE    LL + +N +    P        HIA    ++  V  L +   + D+N  ++ G T LH+A      + +Q LIE  A V  + K N  PLH AA  G   +++LL   G + V+ + + G TPL  +   GH 
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHG 187          

HSP 7 Score: 59.3066 bits (142), Expect = 1.363e-9
Identity = 46/173 (26.59%), Postives = 77/173 (44.51%), Query Frame = 1
Query:  961 VMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDF-----LTPLHVTAHYGNEKVARVLLDRRCDPNARAL--NGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGAN-IEQGTMRGETALHLATRNNQTETVKLLL-KAGA 1452
            ++ K ++G   LH +      +    LL K  N+N    D+      TP H+    GN +V + L DR   P+   +   G T LH+A  K   ++ + L++ GA +    +    PLH +A +GS + + +L   G + +     +G T L  A      +   LL+ K GA
Sbjct:   29 LLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVN--LDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGA 199          

HSP 8 Score: 57.3806 bits (137), Expect = 5.987e-9
Identity = 58/178 (32.58%), Postives = 89/178 (50.00%), Query Frame = 1
Query:  547 ALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVN---HQSSSGFTPLHIAAHYGNEKSAQLLIEQ--KADVNFQAKNNITPLHVAA--KWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNG-ADVMSKTRNGLTSL-HMAAQGDFEDTARILLLKR 1053
            +LLL+ D     R+P LH +V        + LL+  E +VN   +   SG+TP HIA   GN +  + L ++  K D+N      +T LH+A   KW    + Q LI++GA V  + +    PLH +A  G  +L E L   G + V  + + G T L H  A+G     A +LL+++
Sbjct:   27 SLLLQKDQDG--RIP-LHWSVSFQAHEITSFLLSKME-NVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFE--VSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEG--HGDAAVLLVEK 196          

HSP 9 Score: 49.6766 bits (117), Expect = 1.952e-6
Identity = 46/175 (26.29%), Postives = 75/175 (42.86%), Query Frame = 1
Query:   61 LSTMTKSNTENSESNHS---FLRAARAGNLSKVIDFLE--TGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGAN-VNLQSTNGFTPLYMAAQENHLEVVTFLINN-GADQTITTEDGFTPLAVALQQGHERIVALLLEN 564
            LS M   N ++   +     F  A   GNL  V    +     D+N   + G++ LHLA  +    + + LI+    +    K     LH A+  G  +++++L   G + VN Q   G+TPL+ A  E H +    L+   GA+  +    G     VAL   +E++    L N
Sbjct:   56 LSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEYDLVDNKGAKAEDVAL---NEQVKKFFLNN 227          
BLAST of Ankyrin vs. Ensembl Yeast
Match: PHO81 (Cyclin-dependent kinase (CDK) inhibitor; regulates Pho80p-Pho85p and Pcl7p-Pho85p cyclin-CDK complexes in response to phosphate levels; inhibitory activity for Pho80p-Pho85p requires myo-D-inositol heptakisphosphate (IP7) generated by Vip1p; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003465])

HSP 1 Score: 70.4774 bits (171), Expect = 4.349e-12
Identity = 75/284 (26.41%), Postives = 120/284 (42.25%), Query Frame = 1
Query: 1396 LATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSG--SDPNVATRDNYTALHVAAKEGRSEAISLLL---------------DSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNA-TGKN----------------GLTPLHVATHYNHE-KVAQLLLDNKADP-KCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADV---------NHKAKNGLTSMHLTAQEDKV 2112
            L T     ETV+ LL A  I       ++ PLH A ++G LE +   L +    D +    D+ T L +A      + +  LL               D    + + TK  F PL++A K++    A +LL+ ++  NA   KN                GL  LH+      + ++ QLL+   ADP +    N +TP+  A +  + ++   LL  +A  + E  NG SPL  A  E H DV++ LLQ   ++         +  +   L ++ LT  +DK 
Sbjct:  403 LTTSKLSKETVQKLLNAQDI------HSRVPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEINSQSSTQRLNTIDLTPNDDKF 680          

HSP 2 Score: 59.3066 bits (142), Expect = 1.151e-8
Identity = 63/245 (25.71%), Postives = 104/245 (42.45%), Query Frame = 1
Query: 1087 TPLHVTAHYGNEKVARVLLDRRC--DPNARALNGFTPLHIACKKHKIKIVELLLKYGAL---------------IEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKI-GNLELITLFLQSGSDPN-VATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKAN-PNA 1761
             PLH  A  G  +    LL      D +    +  TPL +A   + I +V  LL  G                 + ++T+    PL+V+    + +A  +LL+  +       + +++ HL          + L K       K       LH+  KI G+ +LI L ++ G+DPN +   + +T +  A + G SE I+ LL   A+++ E   G +PL  A     V V + LLQ+  N P+A
Sbjct:  426 VPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLC---------QPLFK-------KNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSA 654          

HSP 3 Score: 54.6842 bits (130), Expect = 2.602e-7
Identity = 53/231 (22.94%), Postives = 98/231 (42.42%), Query Frame = 1
Query:  790 TPLHVAAKWGRSGMVQLLIDSGAL--VSCRTRDGLTPLHCSARSGHAQLCEKLI---------------DNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANIN-----------------ETTTDFLTPLHVTAHYGNE-KVARVLLDRRCDPNA-RALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTM 1374
             PLH AA+ G+   V  L+ +  L  V     D  TPL  +  + H  +   L+               D   +V+S T+     L++A + +  D A++LL  R+  N                 +  +  L  LH+ A  G + ++ ++L+    DPN     N +TP+  A +    +++  LLK+ A ++   + G +PL  + +    + +N LLQ+  N+    +
Sbjct:  426 VPLHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLEIRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPL 656          

HSP 4 Score: 53.9138 bits (128), Expect = 4.773e-7
Identity = 67/247 (27.13%), Postives = 104/247 (42.11%), Query Frame = 1
Query:  310 LHIASLAGKFEVV-KILVENG-ANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGA------DQTI---------TTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKS-AQLLIEQKADVN-FQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTS 993
            LH A+  GK E V  +L+ N   +V+   ++  TPL +A   NH++VV  L+  G       ++ I         +T+  F PL VA +  +     LLLE             I  K+N  NA N         +  ++S+G   LHI A  G +    QLLI   AD N     N  TP+  A + G S ++  L+   A +     +G +PL  +    H  +   L+    ++ S   N + S
Sbjct:  428 LHYAAELGKLEFVHSLLITNLLEDVDPIDSDSKTPLVLAITNNHIDVVRDLLTIGGANASPIEKPILDYSKNVISSTKVQFDPLNVACKFNNHDAAKLLLE-------------IRSKQNADNAKNKSSQHLCQPLFKKNSTGLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEINS 661          

HSP 5 Score: 53.1434 bits (126), Expect = 7.459e-7
Identity = 37/131 (28.24%), Postives = 68/131 (51.91%), Query Frame = 1
Query:  298 GNSALHI-ASLAGKFEVVKILVENGANVN-LQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLEND-NRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSS 681
            G   LHI A + G  +++++L+  GA+ N +   N +TP++ A +  H EV+T L+ + A   I  ++G +PL  AL + H  ++  LL+   N     L  ++       +N ++L  N  + D++ Q S
Sbjct:  557 GLCTLHIVAKIGGDPQLIQLLIRYGADPNEIDGFNKWTPIFYAVRSGHSEVITELLKHNARLDIEDDNGHSPLFYALWESHVDVLNALLQRPLNLPSAPLNEINSQSSTQRLNTIDLTPNDDKFDLDIQDS 687          
BLAST of Ankyrin vs. Ensembl Yeast
Match: AKR2 (Ankyrin repeat-containing protein; member of a family of putative palmitoyltransferases containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain; possibly involved in constitutive endocytosis of Ste3p; AKR2 has a paralog, AKR1, that arose from the whole genome duplication [Source:SGD;Acc:S000005560])

HSP 1 Score: 67.781 bits (164), Expect = 2.004e-11
Identity = 58/195 (29.74%), Postives = 93/195 (47.69%), Query Frame = 1
Query: 1597 AAKEGRSEAISLLLDSGA-KIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPN-ATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLV------SDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMH--LTAQEDKVTVARILVHAGADI 2151
            AAK+G  + +  +++SGA  I  +     + LH A   ++  VA  LL + ANPN A G  G T LH A  Y +  +  LLL + ADP  K + G   +H +   +N  L + +L        + D +++  N  +PL  A+ +G    V LLL+  + V      G  ++H  L   + +V    IL  +GA+ 
Sbjct:   57 AAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLIL--SGANF 249          

HSP 2 Score: 58.9214 bits (141), Expect = 1.025e-8
Identity = 60/225 (26.67%), Postives = 101/225 (44.89%), Query Frame = 1
Query:  220 AAKEGHIVIVKELIKR------EPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQS-TNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-----NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGA 858
            AAK+G + +VK++++         RID       S LH A +  +F V K L+  GAN N  +   G T L+ AA+  ++ +V  L+ +GAD T+  E G                             L  +H +V  +++  V  +L     N+  VD++ + ++  TPL  AA+ G+  + +LL++  + V +        LH A   G   ++  LI SGA
Sbjct:   57 AAKDGDLKVVKDVVESGAVDINNDRIDEL-----SGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQG-----------------------------LNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGA 247          

HSP 3 Score: 58.151 bits (139), Expect = 2.037e-8
Identity = 57/221 (25.79%), Postives = 97/221 (43.89%), Query Frame = 1
Query:  904 SARSGHAQLCEKLIDNGA-DVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETT-TDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKY------GALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQ 1542
            +A+ G  ++ + ++++GA D+ +   + L+ LH A   +    A+ LLL+ AN N+       T LH  A YGN  +  +LL    DP  +   G   +H +     I +V  +L +         I++      TPL  +A+ G    V +LL+ G+ +     RG  ALH A        +  L+ +GA    +  + Q    +A  +G   L    LQ
Sbjct:   57 AAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLAEGMGTKSLFEQALQ 277          

HSP 4 Score: 55.8398 bits (133), Expect = 1.064e-7
Identity = 54/174 (31.03%), Postives = 77/174 (44.25%), Query Frame = 1
Query: 1201 ACKKHKIKIVELLLKYGAL-IEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRG-ETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPN----VATRD--NYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIA 1698
            A K   +K+V+ +++ GA+ I       L+ LH +           LL +GAN  Q    G  TALH A R      V LLLK GA P  K  +    +H +    N+ L+   L    + N    + ++D  N T L  AA +G    + LLL  G+ +     RGF  LH A
Sbjct:   57 AAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCA 230          

HSP 5 Score: 52.7582 bits (125), Expect = 9.313e-7
Identity = 56/191 (29.32%), Postives = 86/191 (45.03%), Query Frame = 1
Query: 1114 GNEKVAR-VLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGA-LIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKA------GAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDN--YTALHVAAKEGRSEAISLLLDSGAKI 1656
            G+ KV + V+     D N   ++  + LH AC  ++  + + LL  GA   +A    G T LH +A  G+   V++LL+ GA+      +G   +H +  ++    V  +L            D+K   N+TPL  A   G+   + L L+ GS   VA  DN  + ALH A   G    I  L+ SGA  
Sbjct:   61 GDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPNQAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGS--TVAWTDNRGFNALHCALVGGDQRVICDLILSGANF 249          

HSP 6 Score: 51.9878 bits (123), Expect = 1.447e-6
Identity = 56/211 (26.54%), Postives = 82/211 (38.86%), Query Frame = 1
Query:  112 FLRAARAGNLSKVIDFLETG-TDINTCNDIGLSALHLAAKEGHIVIVKELIKR--EPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGF---------------------------------------TPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVA-LLLENDN---RSKQRLPALHIA 606
            F+ AA+ G+L  V D +E+G  DIN      LS LH A       + K L+ R   P   A    G +ALH A+  G   +V +L+++GA+  L+   G                                        TPL  AA +     V  L+  G+    T   GF  L  AL  G +R++  L+L   N   R+ Q+     +A
Sbjct:   54 FIEAAKDGDLKVVKDVVESGAVDINNDRIDELSGLHWACINNRFSVAKFLLLRGANPN-QAAGPGGATALHWAARYGNIYIVDLLLKHGADPTLKDEQGLNIMHFSVYSSNILLVVYVLYFVVNNNDNVDIDSKDNNNRTPLLWAAYQGDFLTVELLLKFGSTVAWTDNRGFNALHCALVGGDQRVICDLILSGANFYERNNQKQDCFDLA 263          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO45487 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW5])

HSP 1 Score: 244.588 bits (623), Expect = 1.423e-70
Identity = 170/444 (38.29%), Postives = 257/444 (57.88%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGE-TWKEHPIEATDQAIQNSVGLSFERLMTNEE------VRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSI----TGGSA--PAV-WEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGR-RHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVR 4524
            +NVP+   PV+ GFLVSF+VDAR G M++ + T ++  +PP S   PTR+ CRL++ ++    P L +G+  ACR++++GP  T+F  P+ +EVP++A+LRD ERE++++++++G   W E  +E   +   +++ L  ER+   +E        + R  +I T  LP+ FA++SR+++E+  +G  G  + S+V+P VQ   PEGA+   T++ +Q    PV+     L   V  SP++++EP    F KP+T+T+P P  V  G  N P+    SLRLLC        GSA  PA  W+DI+G+TPL+      SFT    AR WLI+  N   V   A  +YR+   VPY+ +FVV+ +   D  EA+ R+  +TDD +DKTLE Q  F  IA    VEV   RP  I   GNL PV +  D L +   +  ENR+S  VR
Sbjct:    4 DNVPLYEPPVTGGFLVSFLVDARSGKMESTQ-TGIKIVLPPRSCQMPTRITCRLLRINRPTLLPPLREGEALACRVLDIGPSGTRFLQPVYLEVPYFAALRDGERELVVMKTDDGGWNWDEVSVEDM-KGKCHAICLKIERVKGYKEDSPDAIFPSRRYAKISTQALPERFAVVSRVKKEIFSVGSRGESIRSAVLPSVQVNVPEGAVASGTKMSLQVQ--PVDENFNNLEEWVTVSPVVTLEPADIIFKKPVTVTIPCP--VYSGQSN-PDI-QPSLRLLCCFPKEAKAGSAQTPAYQWQDITGNTPLTVIGANASFTIDRPARYWLIETRNPDNVTADARLIYRKLAAVPYLAKFVVFAKLSADGTEARLRVFCITDDKMDKTLEGQTGFVEIARSRDVEVHDGRPIHIRCLGNLAPVQR--DPLHLNFFSFRENRLSVTVR 437          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO45486 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSW2])

HSP 1 Score: 160.999 bits (406), Expect = 2.061e-43
Identity = 113/289 (39.10%), Postives = 157/289 (54.33%), Query Frame = 1
Query: 3682 ANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSI----TGGSA--PAV-WEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGR-RHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVR 4524
            + R  +I T  LP+ FA++SR+++E+  +G  G  + S+V+P VQ   PEGA+   T++ +Q    PV+     L   V  SP++++EP    F KP+T+T+P P  V  G  N       SLRLLC        GSA  PA  W+DI+G+TPL+      SFT    AR WLI+  N   V   A  +YR+   VPY+ +FVV+ +   D  EA+ R+  +TDD +DKTLE Q  F  IA    VEV   RP  I   GNL PV +  D L +   +  ENR+S  VR
Sbjct:    9 SRRYAKISTQALPERFAVVSRVKKEIFSVGSRGESIRSAVLPSVQVNVPEGAVASGTKMSLQVQ--PVDENFNNLEEWVTVSPVVTLEPADIIFKKPVTVTIPCP--VYSGQSNP--DIQPSLRLLCCFPKEAKAGSAQTPAYQWQDITGNTPLTVIGANASFTIDRPARYWLIETRNPDNVTADARLIYRKLAAVPYLAKFVVFAKLSADGTEARLRVFCITDDKMDKTLEGQTGFVEIARSRDVEVHDGRPIHIRCLGNLAPVQR--DPLHLNFFSFRENRLSVTVR 289          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 111.694 bits (278), Expect = 1.618e-26
Identity = 74/235 (31.49%), Postives = 121/235 (51.49%), Query Frame = 1
Query:  112 FLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKW 816
            FL A  +G++ +V   L  G DIN  N  GL+ALH A  + +  +VK L+ +   +D    +G ++LH A+  G  E+ K L+ENGA+V   +  G  PL +A +E+  +++T  I N   Q I  +D        +    +  +     N+++ K    ALH+A  K  +  + LLL    V++N + +  +TPLH AAH+G + + +LL E  AD  F A+N +  +     W
Sbjct:   53 FLSAVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIEN---QGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLG-VEINAKDADNWTPLHAAAHWGQKDACELLSENGAD--FNARNKMVGIDHQQNW 281          

HSP 2 Score: 97.4413 bits (241), Expect = 1.391e-21
Identity = 71/233 (30.47%), Postives = 111/233 (47.64%), Query Frame = 1
Query:  673 QSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKV----ARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANI 1359
            Q +SG   L  A   G+    + L+ + AD+N+Q  + +T LH A       +V++L+D GA +  R  +G T LH +A  G  ++ + LI+NGADV +    G   L +A + D ED    LL           D        A    EK+    A+  L++ C   ++     + LH+A  K  +K++ LLL+ G  I A      TPLH +A  G K+A  +L + GA+ 
Sbjct:   46 QFNSGIVFLS-AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMED----LLTDEIENQGIDVD-------DARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADF 266          

HSP 3 Score: 90.1225 bits (222), Expect = 3.908e-19
Identity = 68/255 (26.67%), Postives = 117/255 (45.88%), Query Frame = 1
Query:  220 AAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVN--LLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTR 978
            A   G +  VK+L+ +   I+     G +ALH A +   F++VK+LV+ GA+++++   G+T L+ AA    +E+  +LI NGAD      +G  PL +A ++  E ++   +EN              +  +D  AV   ++LN ++  +N                         I +  D     K   + LHVA+  G   ++ LL+  G  ++ +  D  TPLH +A  G    CE L +NGAD  ++ +
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQ------------GIDVDDARAVEEKIMLNDAQSWLNKNC----------------------INESKD-----KTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 4 Score: 77.0258 bits (188), Expect = 1.157e-14
Identity = 57/212 (26.89%), Postives = 95/212 (44.81%), Query Frame = 1
Query: 1312 GSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAIS--------------------LLLDSGAKI------EAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAK 1869
            G  + V  LL KGA+I    + G TALH A  +   + VK+L+  GA  D +  E  T LH A   G++E+    +++G+D      +    L +A +E   + ++                    +L D+ + +      E++ K   + LH+A+    + V  +LLQ     NA   +  TPLH A H+  +   +LL +N AD   + K
Sbjct:   60 GDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 5 Score: 72.7886 bits (177), Expect = 2.517e-13
Identity = 56/216 (25.93%), Postives = 92/216 (42.59%), Query Frame = 1
Query: 1498 ATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKV--------------------------AQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAK 2067
            A   G+++ +   L  G+D N    D  TALH A  +   + + +L+D GA ++     G+T LH AA    V +A  L++  A+  A    G  PL +A   + E +                          AQ  L+     + K K   + LH+A+ K    +  +LL    + NA+  + ++PL  A+  G  D   LL ++ AD N + K
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 6 Score: 70.8626 bits (172), Expect = 1.263e-12
Identity = 60/215 (27.91%), Postives = 92/215 (42.79%), Query Frame = 1
Query:  604 AVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDN-GADV-------------------------MSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNAR 1170
            AV   DV+ V  LL +   D+N+Q+  G T LH A    N    ++L+++ A ++ +     T LH AA  G   + + LI++GA V+    +G  PL  +       L    I+N G DV                          SK +   ++LH+A+   +     +LL     IN    D  TPLH  AH+G +    +L +   D NAR
Sbjct:   56 AVSSGDVDEVKKLL-AKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNAR 269          

HSP 7 Score: 68.9366 bits (167), Expect = 5.972e-12
Identity = 55/212 (25.94%), Postives = 95/212 (44.81%), Query Frame = 1
Query: 1597 AAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNH-KAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYL 2229
            A   G  + +  LL  GA I  +   G T LH A   +   +  +L+ K A+ +     G T LH A      ++A+ L++N AD       G  PL +A +++ +DL    + +      ++R     + L       D  S L  +K  +N  K K   +++H+ + +  + V  +L+  G +I       +TPLH AAH+GQ +  + L
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIML------NDAQSWL--NKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELL 259          

HSP 8 Score: 59.6918 bits (143), Expect = 5.499e-9
Identity = 54/213 (25.35%), Postives = 94/213 (44.13%), Query Frame = 1
Query:  913 SGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKK------------------------HKIKI--VELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKAR 1473
            SG     +KL+  GAD+  +  +GLT+LH A   +  D  ++L+ K A+++    +  T LH  A  G+ ++A+ L++   D  A    G  PL +A ++                         KI +   +  L    + E+  +T  + LHV++  G  + + +LLQ G  I        T LH A    Q +  +LL + GA  +A+ +
Sbjct:   59 SGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSENGADFNARNK 271          

HSP 9 Score: 56.6102 bits (135), Expect = 5.927e-8
Identity = 28/80 (35.00%), Postives = 43/80 (53.75%), Query Frame = 1
Query: 1993 ASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLI 2232
            A   G  D V  LL   AD+N++  +GLT++H    ++   + ++LV  GA +       +T LH AA  G + +AKYLI
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLI 135          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO38702 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SC57])

HSP 1 Score: 115.931 bits (289), Expect = 1.854e-26
Identity = 126/481 (26.20%), Postives = 199/481 (41.37%), Query Frame = 1
Query:  688 FTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIK------------IVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKI--------GNLELI-------TLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSG-AKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKA--DPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQH 2040
             TPLH+A  +G    A+ L+E  AD+    +  +TPLH A   G  G+ +LL  +  L                R G + + + + D       + R   T+LH+A +G   D A++ L K AN+N          H T          +++ R C      ++    L   CK  KIK            I+  ++++ A IE   +   TPL ++A     + V  LLQ GA+I    +    ++  A      ET++            A E+Q P+              G+ +LI        L L +G+  +    ++ T +H AAK GR   +  LL    A I  E     TPLH+AA +    V   LL +    +A      TPL  A      +VA +LLD  A  DP  KAK   TPLH+A+++ + ++  +LL   A+       G + L +A +  H +V   ++ H
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAEL----------------RGGWSTVSKMVTD-------QDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKT----------IVVARECIFVMIKVSKLKYLSF-CKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLE-----------AALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKT--TPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDH 438          

HSP 2 Score: 95.5153 bits (236), Expect = 6.983e-20
Identity = 111/409 (27.14%), Postives = 155/409 (37.90%), Query Frame = 1
Query: 1183 FTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGT-----------MRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSE---------AISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATH----------YNHEK---------------------------VAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSD-ADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLIS 2235
             TPLH+AC    I + + L++ GA + +  E  +TPLH +   G+   V  LL   A +  G               +TALHLA      +  KL L+ GA  +A         H    +   E I + ++        ++  Y +   + K  R            I  ++   A IE   K   TPL IAA+ + V     LLQ  A+  A   N    +  A              H+K                            +QLLLDN A    K     TP+H AAK         LL  D A  N E     +PL LA+  GH  VV  LL     ++ +     T +   A    V VA IL+   A + PT  A+ TPLH A+  G + M K L+S
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNL-GVAKLLFVAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVAR-ECIFVMIK-------VSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLS 404          

HSP 3 Score: 90.5077 bits (223), Expect = 2.838e-18
Identity = 103/404 (25.50%), Postives = 157/404 (38.86%), Query Frame = 1
Query:  400 FTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLL----------------ENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLL-IEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTS-LHMAAQGDFED------------------------------------TARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDP---NARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLL 1440
             TPL++A     + V   L+  GAD     E+  TPL  A  +G+  +  LL                  + +R +Q   ALH+AV+    +   L L     +VN    S     H       E    ++ + +   ++F     I    +   +    ++  +I   A + CR +D  TPL  +A   H      L+ +GAD+ +K  N   S    AA+G  E                                     ++++LL   A I+    + +TP+H  A +G  +    LL R  DP   N       TPLH+A       +V+ LL  G  I+A   T  TPL  +A  G  E  N+LL + A ++       T LHLA+R    E VKLLL
Sbjct:    5 MTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLFVAAELRGGWSTVSKMVTDQDREEQ--TALHLAVEGGHGDLAKLCLEKG-ANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKR--DPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLL 403          

HSP 4 Score: 79.337 bits (194), Expect = 1.042e-14
Identity = 85/367 (23.16%), Postives = 158/367 (43.05%), Query Frame = 1
Query:  205 SALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGK-------------------------------FEVVKIL---VENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTI------------TTEDGFTPLAVALQQGHERIVALLLEND------NRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKS-AQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLD 1146
            +ALHLA + GH  + K  +++   ++A  +  N   H   +  +                               F+VV I+   +   A +  +  +  TPL +AA++NH++ V  L+ +GAD                 E     L  AL+  H++ V  + ++         S + +  L I+ +        LLL++    ++ ++    TP+H AA +G  ++   LL    A +N +   + TPLH+AA  G + +V+ L+  G  +  R     TPL C+A  G  ++   L+D  A V    +   T LH+A++    +  ++LL ++ANI  T +     L +     +++VA  ++D
Sbjct:   82 TALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALE--HQKPVWTICDDVCLNGLVGGSNKLILVLRISSQ--------LLLDNGAC-IDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIID 437          

HSP 5 Score: 72.4034 bits (176), Expect = 1.671e-12
Identity = 47/135 (34.81%), Postives = 74/135 (54.81%), Query Frame = 1
Query:  157 FLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPR-IDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLL 558
             L+ G  I++ ND  ++ +H AAK G +  V  L+KR+P  I+      N+ LH+A+L G   VVK L+  G  ++ ++   +TPL  AA    +EV   L++  A    T +   TPL +A ++GH  +V LLL
Sbjct:  269 LLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLL 403          

HSP 6 Score: 71.2478 bits (173), Expect = 3.686e-12
Identity = 53/170 (31.18%), Postives = 86/170 (50.59%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDI-NTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERI-VALLLENDNRSKQR 585
            +++N E       AA+ G +  V   L+    I N  +    + LHLAA  GH  +VKEL+ R   IDA      + L  A+  G  EV  IL++  A V+       TPL++A++E H+E+V  L++  A+ T+T   G   L +A++  H+ + VA++   D +   R
Sbjct:  277 DSKNDEDITPIHYAAKFGRVRTVCALLKRDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANILLDEDAPVDPTDKAKTTPLHLASREGHVEMVKLLLSRKANITLTDSAGRNCLDIAIESSHKEVAVAIIDHVDWKQAMR 446          

HSP 7 Score: 62.003 bits (149), Expect = 2.993e-9
Identity = 89/374 (23.80%), Postives = 143/374 (38.24%), Query Frame = 1
Query: 1471 RENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGF---------------TPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVS-DADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQE--------------------DKVTV-----------------ARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            +   TPLHVA   G + +    +++G+D      +  T LH A  EG      LL      + AE + G+               T LH+A +     +A + L+K AN NA  ++     H       E +  ++  +K       K+      I     +  + I  ++   A      ++  +PL +A+++ H D V  LLQH AD+  K  N   S+   A E                    D V +                 +++L+  GA I      + TP+H AA FG++     L+   D   IN +     TPLHLAA  GH  +V  LL      + +N   WT    A  +  + +  +L
Sbjct:    2 KTQMTPLHVACSHGCIPVAKCLVEAGADLRSLDEEQMTPLHFACMEGNLGVAKLLF-----VAAELRGGWSTVSKMVTDQDREEQTALHLAVEGGHGDLAKLCLEKGANVNAVKESKNKTFHKTIVVARECIFVMIKVSKLKYLSFCKSEKIKREILLYFFDVVIIICYIIRFRACIECRDKDKDTPLMIAAEKNHVDTVRTLLQHGADIAAKDINDRNSVFRAAAEGCMETLEAALEHQKPVWTICDDVCLNGLVGGSNKLILVLRISSQLLLDNGACIDSKNDEDITPIHYAAKFGRVRTVCALLK-RDPAIINDEDGASNTPLHLAALHGHAAVVKELLYRGGAIDARNATLWTPLDCAAARGMVEVANIL 369          
BLAST of Ankyrin vs. Ensembl Nematostella
Match: EDO37520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFL9])

HSP 1 Score: 111.309 bits (277), Expect = 5.123e-24
Identity = 105/389 (26.99%), Postives = 166/389 (42.67%), Query Frame = 1
Query:  784 NITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMA-AQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIE-----------------------QGTMRGETALHLATRNNQTETVKLLLKAGAIP-DAKARENQTPLHVATKIGNLELITLFLQSGSDP-------------------NVATR-----DNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILL-QKKANPNATGKNGLTPLHVAT 1800
            N+T LH AA    +G++ LL +  + V C  R+  TP   +A +G   +   L   GA++   T N L+  H   A+   +D  R++               + LH  A  G+ +  + LL+ +   +A +  G TP+ IA +  ++ ++E+L K+GA  +        PL  +A  G   AV  L Q G + E                       +   R ETALH+A+   Q + V  +L++              PLH A    +++ +  FL+ G  P                   N+A         Y ALH+AA+ GR   I+ LL+ GAK       G   +H+AA YD+VGV S+L+ + K + N+    G TP H A 
Sbjct:  803 NMTALHFAASTSNTGVIGLLANHFSTVDCLDRNSRTPAFIAASTGQKNILAILFQKGANLFHVT-NSLSKKHQQRAKNPVKDCKRLMC------------GYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGRVSVMEVLHKHGAPCDPR------PLRSAAAGGHLPAVRFLHQAGVSDECVPCKYSISPSYMKQRVGKLVDDEYLWRCETALHIASAMEQPDIVSYILRSNDTALTCYDYLGMRPLHKAVVYNSIKSLKAFLEYGVSPLSRCAPAEVLSTYPEDKYKNIADYFEPCICRYNALHLAARHGRVNMIATLLEYGAKTGVFDACGSQAVHVAACYDQVGVLSLLVAEYKVDVNSRDLIGKTPFHYAV 1172          

HSP 2 Score: 78.5666 bits (192), Expect = 5.001e-14
Identity = 92/363 (25.34%), Postives = 144/363 (39.67%), Query Frame = 1
Query:  199 GLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNG-ADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLL-DRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETG 1281
            G S LH AA+ GH+  VK L+  +   DA +  GN+ + IA+  G+  V+++L ++GA  + +      PL  AA   HL  V FL   G +D+ +  +   +P  +  + G        L +D    +   ALHIA      + V+ +L S++  +      G  PLH A  Y + KS +  +E          +   P  V + +       +  D      CR       LH +AR G   +   L++ GA                  G F+                       +HV A Y    V  +L+ + + D N+R L G TP H A K      ++ L K GA I A  + G
Sbjct:  890 GYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGRVSVMEVLHKHGAPCDPR------PLRSAAAGGHLPAVRFLHQAGVSDECVPCKYSISPSYMKQRVGK-------LVDDEYLWRCETALHIASAMEQPDIVSYILRSNDTALTCYDYLGMRPLHKAVVYNSIKSLKAFLEYGV----SPLSRCAPAEVLSTYPEDKYKNI-ADYFEPCICR----YNALHLAARHGRVNMIATLLEYGAKT----------------GVFDACGS-----------------QAVHVAACYDQVGVLSLLVAEYKVDVNSRDLIGKTPFHYAVKCKAAGALKRLFKLGANIHAEDDEG 1197          

HSP 3 Score: 64.6994 bits (156), Expect = 7.778e-10
Identity = 95/421 (22.57%), Postives = 161/421 (38.24%), Query Frame = 1
Query: 1384 TALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRD---------------------NYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANP------NATGKNGLTP----LH--------------VATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVS-DADSNAESRNGFSPLQLA--------------------SQEGHTDVVSLLLQHK----ADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            TALH A   + T  + LL    +  D   R ++TP  +A   G   ++ +  Q G++    T                        Y+ LH AA+ G  E +  LL+     +AE+  G TP+ IAA+Y +V V  +L  K   P       +    G  P    LH              ++  Y  ++V +L+ D++   +C+     T LHIA+     D+   +L S D         G  PL  A                    S+    +V+S   + K    AD          ++HL A+  +V +   L+  GA            +H AA + Q+ +   L++    + +N +  +G TP H A +      +  L +  A+ + ++++G        K HY  +FE L+
Sbjct:  805 TALHFAASTSNTGVIGLLANHFSTVDCLDRNSRTPAFIAASTGQKNILAILFQKGANLFHVTNSLSKKHQQRAKNPVKDCKRLMCGYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGRVSVMEVL-HKHGAPCDPRPLRSAAAGGHLPAVRFLHQAGVSDECVPCKYSISPSYMKQRVGKLV-DDEYLWRCE-----TALHIASAMEQPDIVSYILRSNDTALTCYDYLGMRPLHKAVVYNSIKSLKAFLEYGVSPLSRCAPAEVLSTYPEDKYKNIADYFEPCICRYNALHLAARHGRVNMIATLLEYGAKTGVFDACGSQAVHVAACYDQVGVLSLLVAEYKVD-VNSRDLIGKTPFHYAVKCKAAGALKRLFKLGANIHAEDDEG-------NKAHY--VFEDLQ 1208          

HSP 4 Score: 56.6102 bits (135), Expect = 2.273e-7
Identity = 47/172 (27.33%), Postives = 76/172 (44.19%), Query Frame = 1
Query: 1777 LTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDAD----SNAESRN-----------------GFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYL 2229
            +T LH A   ++  V  LL ++ +   C  +N  TP  IAA    +++  +L    A+    +N+ S+                  G+S L  A+Q GH + V  LL HK   + ++  G T M + AQ  +V+V  +L   GA   P       PL +AA  G +   ++L
Sbjct:  804 MTALHFAASTSNTGVIGLLANHFSTVDCLDRNSRTPAFIAASTGQKNILAILFQKGANLFHVTNSLSKKHQQRAKNPVKDCKRLMCGYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGRVSVMEVLHKHGAPCDP------RPLRSAAAGGHLPAVRFL 969          

HSP 5 Score: 51.2174 bits (121), Expect = 9.624e-6
Identity = 49/181 (27.07%), Postives = 79/181 (43.65%), Query Frame = 1
Query: 1576 NYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKAN----PNATGKN-----------------GLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVN 2055
            N TALH AA    +  I LL +  + ++   +   TP  IAA   +  + +IL QK AN     N+  K                  G + LH A    H +  + LL++K     ++  G TP+ IAA+     +++M ++    +  + R    PL+ A+  GH   V  L  H+A V+
Sbjct:  803 NMTALHFAASTSNTGVIGLLANHFSTVDCLDRNSRTPAFIAASTGQKNILAILFQKGANLFHVTNSLSKKHQQRAKNPVKDCKRLMCGYSLLHAAAQGGHVETVKFLLNHKLSKDAESGAGNTPMQIAAQYGR--VSVMEVLHKHGAPCDPR----PLRSAAAGGHLPAVRFL--HQAGVS 975          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 435/782 (55.63%), Postives = 586/782 (74.94%), Query Frame = 1
Query:   94 SESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            S+SN SFLRAARAGN+ KV+++L+ G DI+TCN  GL+ALHLAAKEGH+ +V+EL+ R   +D++TKKGN+ALHI+SLAG+ EVVK LV+ GA++N QS NGFTPLYMAAQENHL+VV +L+ NG +Q+  TEDGFTPLA+ALQQGH ++V++LLEND + K RLPALHIA +K+D  +  LLL N    DV  QS SGFTPLHIAAHYGN   A LL+ + A V+F A+N ITPLHVA+K G + MV+LL+D G+ +  +TRDGLTPLHC+ARSGH    E L++ GA ++++T+NGL+ LHMAAQGD  +  + LL  +A +++ T D+LT LHV AH G+ +V ++LLD+R +PNARALNGFTPLHIACKK+++K++ELL+KYGA I+A TE+GLTP+HV+AF+G    V +LLQ GA+ +   +RGET+LH+A R  Q E V+ LL+ GA+ DA+ARE+QTPLH+A+++G  E++ L LQ  + P+ AT + YT LH++A+EG+ E  S+LL++GA     TK+GFTPLH+ +KY  + VA +LLQ++A P++ GKNGLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A +LL   A++NA ++ G +PL LASQEGH D+ +LL+   A +N   K+GLT++HL AQED+V VA ILV  GA++   T   YTPL  A H+G   M  +L  L +   +N KT+ G+TPLH AAQQG+  ++N+LL+  A PN     G TA  IAR+  Y+++ + LR
Sbjct:   45 SDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADV--QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFL--LQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLR 822          

HSP 2 Score: 476.863 bits (1226), Expect = 1.995e-136
Identity = 288/683 (42.17%), Postives = 401/683 (58.71%), Query Frame = 1
Query: 3061 HISGSQGRSEASGDESFLENMNSRDLNCHK--LTEIQPERIESVNFATEEAYNKSDWDFEP-ENVPIVRKPVSSG-----------FLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEY--SAYALLILWRSKRGDLACGNE-LEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDI 5058
            H S   GR++ S + SF    +      H+  L ++  +++ S+    E    +  W  +  +NV +   PV SG           FLVSFMVDARGG M+  R   LR  +PP     PTR+ CRL+K  ++ + P + +G+G A R++E+GP   QF  P+++E+PH+ASLR RERE++ILRSE GE+WKEH  E T + +   +    E L T EE+   RI RI+T D PQYFA +SRI+Q+  LIGPEG ++SS+VVPQVQAVFPEGAL K+ RVG+QA  + V +V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P + +  ++N     T +LRLLCSITGG+ PA WEDI+G+TPL+F  DCVSFTT VSAR WLIDC  VQ     +T VYRE   VPYM +FV++ + HD  EA+ R   +TDD +DKTLE QENF  +A    VEVL  +P + +  GNLVP+TK+G     +  A  ENR++  ++++D  QEP G+L+ +   RN           +  Q  I  L I LPS    VS TL +   +           ++  K E  L  +AD +G  W +LA  LG S+ E ++ IRN + +     ++ALL  W  +    A     L K L  I R D+V      ++  T ED  S    +I
Sbjct:  895 HFSLEGGRTD-SAERSFTPTHHGYYSPRHEGVLEDVLSQQLSSLARDNERDSYRLSWCADNLDNVALSSSPVHSGRCSPCHGDHSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCSAPTRITCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFASLRGRERELVILRSETGESWKEHHCEHTQEELNQILNGMDEDLDTPEELERKRICRIITRDFPQYFAAVSRIKQDSHLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQPVSVNVVRKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPGSNSDPVLNGFGGYTPTLRLLCSITGGTTPAQWEDITGTTPLTFINDCVSFTTNVSARFWLIDCRQVQESINFSTQVYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFYAFKENRLALFIKIRDNTQEPCGRLSFMKEPRNY---------RALTQNAICNLNITLPS-YSKVSRTLEKLDPQ-----------EEAEKREQRLAVIADHLGFSWTELARDLGFSE-EKINTIRNENPNSLLDQSHALLNQWAQREAQHATAEATLVKQLTKINRMDIVHLIETGLNRSTQEDTSSHTYAEI 1554          

HSP 3 Score: 167.162 bits (422), Expect = 1.825e-40
Identity = 116/391 (29.67%), Postives = 197/391 (50.38%), Query Frame = 1
Query: 1453 IPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTP-----------------------------LHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXV---------------------------------NLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRK 2439
            +P     ++ T    A + GN++ +  +L+ G D +   ++   ALH+AAKEG  + +  LLD GA +++ TK+G T LHI++   +  V   L+++ A+ NA  +NG TPL++A   NH  V + LL+N  +     ++G+TP                             LHIAA+K++   A +LL +D +++ +S++GF+PL +A+  G+ +V +LLL   A V+  A+NG+T +H+ ++     + R+L+  G+ I   T    TPLH AA  G  + A   + L     +  +T+ G +PLH+AAQ  H++ V                                  LLL+ RA+PN +   G+T  HIA K++ + + E+L K
Sbjct:   39 VPAEMLSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSG--HEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVK 427          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 874.389 bits (2258), Expect = 0.000e+0
Identity = 435/784 (55.48%), Postives = 587/784 (74.87%), Query Frame = 1
Query:   88 ENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLR 2436
            + S+SN SFLRAARAGN+ KV+++L+ G DI+TCN  GL+ALHLAAKEGH+ +V+EL+ R   +D++TKKGN+ALHI+SLAG+ EVVK LV+ GA++N QS NGFTPLYMAAQENHL+VV +L+ NG +Q+  TEDGFTPLA+ALQQGH ++V++LLEND + K RLPALHIA +K+D  +  LLL N    DV  QS SGFTPLHIAAHYGN   A LL+ + A V+F A+N ITPLHVA+K G + MV+LL+D G+ +  +TRDGLTPLHC+ARSGH    E L++ GA ++++T+NGL+ LHMAAQGD  +  + LL  +A +++ T D+LT LHV AH G+ +V ++LLD+R +PNARALNGFTPLHIACKK+++K++ELL+KYGA I+A TE+GLTP+HV+AF+G    V +LLQ GA+ +   +RGET+LH+A R  Q E V+ LL+ GA+ DA+ARE+QTPLH+A+++G  E++ L LQ  + P+ AT + YT LH++A+EG+ E  S+LL++GA     TK+GFTPLH+ +KY  + VA +LLQ++A P++ GKNGLTPLHVA HY+++KVA LLLD  A P   AKNGYTPLHIAAKKN  D+A +LL   A++NA ++ G +PL LASQEGH D+ +LL+   A +N   K+GLT++HL AQED+V VA ILV  GA++   T   YTPL  A H+G   M  +L  L +   +N KT+ G+TPLH AAQQG+  ++N+LL+  A PN     G TA  IAR+  Y+++ + LR
Sbjct:   28 KKSDSNTSFLRAARAGNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADV--QSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFL--LQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTLR 807          

HSP 2 Score: 476.863 bits (1226), Expect = 1.797e-136
Identity = 288/683 (42.17%), Postives = 401/683 (58.71%), Query Frame = 1
Query: 3061 HISGSQGRSEASGDESFLENMNSRDLNCHK--LTEIQPERIESVNFATEEAYNKSDWDFEP-ENVPIVRKPVSSG-----------FLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEY--SAYALLILWRSKRGDLACGNE-LEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDI 5058
            H S   GR++ S + SF    +      H+  L ++  +++ S+    E    +  W  +  +NV +   PV SG           FLVSFMVDARGG M+  R   LR  +PP     PTR+ CRL+K  ++ + P + +G+G A R++E+GP   QF  P+++E+PH+ASLR RERE++ILRSE GE+WKEH  E T + +   +    E L T EE+   RI RI+T D PQYFA +SRI+Q+  LIGPEG ++SS+VVPQVQAVFPEGAL K+ RVG+QA  + V +V ++LGN+   SPI+++EPRRRKFHKPIT+T+P+P + +  ++N     T +LRLLCSITGG+ PA WEDI+G+TPL+F  DCVSFTT VSAR WLIDC  VQ     +T VYRE   VPYM +FV++ + HD  EA+ R   +TDD +DKTLE QENF  +A    VEVL  +P + +  GNLVP+TK+G     +  A  ENR++  ++++D  QEP G+L+ +   RN           +  Q  I  L I LPS    VS TL +   +           ++  K E  L  +AD +G  W +LA  LG S+ E ++ IRN + +     ++ALL  W  +    A     L K L  I R D+V      ++  T ED  S    +I
Sbjct:  880 HFSLEGGRTD-SAERSFTPTHHGYYSPRHEGVLEDVLSQQLSSLARDNERDSYRLSWCADNLDNVALSSSPVHSGRCSPCHGDHSSFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCSAPTRITCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLGPVIVEIPHFASLRGRERELVILRSETGESWKEHHCEHTQEELNQILNGMDEDLDTPEELERKRICRIITRDFPQYFAAVSRIKQDSHLIGPEGGILSSTVVPQVQAVFPEGALTKRIRVGLQAQPVSVNVVRKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPGSNSDPVLNGFGGYTPTLRLLCSITGGTTPAQWEDITGTTPLTFINDCVSFTTNVSARFWLIDCRQVQESINFSTQVYREIICVPYMAKFVIFAKTHDPIEARLRCFCMTDDKIDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFYAFKENRLALFIKIRDNTQEPCGRLSFMKEPRNY---------RALTQNAICNLNITLPS-YSKVSRTLEKLDPQ-----------EEAEKREQRLAVIADHLGFSWTELARDLGFSE-EKINTIRNENPNSLLDQSHALLNQWAQREAQHATAEATLVKQLTKINRMDIVHLIETGLNRSTQEDTSSHTYAEI 1539          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ank1b (ankyrin-1 [Source:NCBI gene;Acc:101157380])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 414/780 (53.08%), Postives = 551/780 (70.64%), Query Frame = 1
Query:  109 SFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVT 2445
            SFLRAAR+GNL K +D ++ G +IN  N  GL+ LHLA+KEGH+ +V EL+     ++ATTKKGN+ALHIA+LAG+ +VV  LV  GANVN QS  GF+PLYMAAQENHLEVV FL+ NGA+Q++ TEDGFTPLAVALQQGHE +VALL+    + K RLPALHIA + +D     +LL N    DV   S +GFTPLHIAAHY N   AQLL+ + A+VNF  KN ITPLH+A++ G   MV+LL+D GA +  +T+D LTPLHC+AR+GH ++ E L+++GA + +KT+NGL+ +HMAAQGD  D  R LL   A I++ T D LTPLHV AH G+ ++A+VLLD+    NARALNGFTPLHIACKK+ ++ ++LLLK+ A +EA TE+GLTPLHV+AF+G    V  LLQ+GA+     ++ ET LH+A+R    E  + LL+  A  DA+A+++QTPLH A ++G+ EL+ L L   ++P+ AT   +T LH+AA+EG    I +LLD+GA+    TK+GFTPLH+A+KY KV VA +LL++ ANPNA GKNGLTPLHVA H+N+  V +LL+         A+NGYTPLHIAAK+N  ++A +LL + A  N ES  G +PL LASQEG  D+V++L+  +A+VN   KNGLT +HL AQE  V +A  LV  GA +   +   YTPLH A H+G I M K+L  L  Q  +N KT++G+TPLH AAQQGH  +V LLL+  A PN   + G +   IA++  Y+++ +VL+ VT
Sbjct:   13 SFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDV--LSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFLLQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRILLDAGAQQVKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSAHSTARNGYTPLHIAAKQNQIEVASVLLQNGASPNCESLQGITPLHLASQEGRPDMVAMLISKQANVNLGNKNGLTPLHLVAQEGHVGIADTLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFL--LQQQAHVNAKTRMGYTPLHQAAQQGHTDIVTLLLKHGALPNEITSNGTSPLGIAKRLGYISVIDVLKLVT 788          

HSP 2 Score: 419.468 bits (1077), Expect = 1.238e-118
Identity = 236/587 (40.20%), Postives = 343/587 (58.43%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQ-LSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIR--NNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            +NV  V  P+ +GFLVSFMVDARGG M+  R   LR  +PP +   PTR+ CRL+KP K+ +PP L +G+G A RI+ +GP + QF  P+++E+PH+ASL   +RE+++LRSENG  WKEH     D+ ++  +    E L + EE+   RI+RI+++D P YFA++SRI+QE  LIGPEG  ++S +VP V+A+FPE A+ K+ R+G+QA  IP E++TR LGN+   SP+++IEPRRRKFH+PI L +PLP +  +   +     T+SLRLLCS+ GG+APA WEDI+G+T L +  +C SFTT VSAR WL DCP        A  +Y+E   +PYM +FV++ + ++  E + R   +TDD +DKTLE  ENF  +A    +E++   P  +E +GNLVP+ K   Q  S + +A  +NR+   V+V+D  +E  G L+ L                   Q  +  L I +P  +       RR+ +                 + L LR     +     +LA  L     +D++ IR  N +S    +  LL LW S+ G  A    L  ALR+I R D+V
Sbjct:  884 DNVSPVASPIHTGFLVSFMVDARGGSMRGSRHHGLRVIIPPRTCAAPTRITCRLVKPQKLTTPPPLVEGEGLASRIISLGPSSMQFLGPVIVEIPHFASLGRGDRELVVLRSENGSVWKEHRNRYGDEVLETILNGMDEDLESQEELEKKRIRRIISTDFPLYFAVVSRIQQESDLIGPEGGRLTSKLVPHVEAIFPESAVTKRVRLGLQAQPIPDELLTRQLGNQATFSPVVTIEPRRRKFHRPIGLRIPLPPSWRESPRDAGEGDTTSLRLLCSVIGGTAPAQWEDITGTTKLMYAHNCASFTTNVSARFWLADCPRTAEAVTFANLLYKELMAIPYMAKFVIFAKMNEAREGRLRCYCMTDDKMDKTLELHENFSEVARSRDIELMEGMPLHLECSGNLVPIRKATQQPRSFSFQAFRDNRLPVSVKVRDSNKEATGFLSFLR----------KCTKYEDAQHVLCNLNITMPPCVKVAGSEERRRTL-----------------TPLALRERYSALNDPAAELARELQFG-VDDINRIRVENPNSLLDQSSTLLNLWASREGKKAKMESLYTALRNIDRADIV 1442          

HSP 3 Score: 265.774 bits (678), Expect = 1.335e-70
Identity = 176/518 (33.98%), Postives = 281/518 (54.25%), Query Frame = 1
Query:  880 DGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            D  T    +ARSG+       I NG ++    +NGL  LH+A++         LL     +  TT    T LH+ A  G EKV   L++   + NA++  GF+PL++A +++ +++V+ LL+ GA     TE G TPL V+   G +  V +L+  G    +G +R   ALH+A RN+ T T  +LL+    PD  ++   TPLH+A    N+ +  L L  G++ N   ++  T LH+A++ G    + LLLD GA+I+A+TK   TPLH AA+   V +  ILL+  A   A  KNGL+P+H+A   +H    + LL   A+      +  TPLH+AA   +  +A +LL   A +NA + NGF+PL +A ++ H   + LLL+H A +    ++GLT +H+ A    + + + L+  GA    +     TPLH A+  G   +A++L  L +  Q++ + +   TPLH AA+ GH +LV LLL+ +A+P+     G T  HIA ++ +++   +L
Sbjct:    9 DAATSFLRAARSGNLDKALDHIKNGININIANQNGLNGLHLASKEGHVKMVLELLHSGIELEATTKKGNTALHIAALAGQEKVVAELVNYGANVNAQSHKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGT---KGKVR-LPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENMSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVMMVRLLLDRGAQIDAQTKDELTPLHCAARNGHVRIIEILLEHGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKNLLQRGASPNASNVKVETPLHMASRAGHCEVAQFL--LQNAAQVDARAKDDQTPLHCAARMGHKELVKLLLDHKANPDSATTAGHTPLHIAAREGHIHTIRIL 520          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 538.88 bits (1387), Expect = 5.806e-172
Identity = 261/426 (61.27%), Postives = 337/426 (79.11%), Query Frame = 1
Query:   82 NTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLL-NSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGAN 1356
            ++  S+SN S+LRAARAGNL KV+D+L++G +IN CN  GL+ALHLA+KEGH+ +V EL+K    +DA TKKGN+ALHI+SLAG+ EVV  LV NGANVN QS NGFTPLYMAAQENHLEVV FL+ N A Q+I TEDGFTPLAVALQQGH+++V+LLLEND + K RLPALHIA +K+D  A  LLL N    DV  +S SGFTPLHIAAHYGN   A LL+ + A V+F A+N+ITPLHVAAK G S MV+LL+D GA +  +T+DGLTPLHC ARSGH Q+ E L+D GA ++SKT+NGL+ LHMA QGD  +  ++LL     +++ T D+LT LHV AH G+ KVA++++D++ +PNA+ALNGFTPLHIACKK++++++ELLLK+GA I+A TE+GLTP+HV+AF+G +  V+ L+  GA+
Sbjct:   11 SSRTSDSNASYLRAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADV--ESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGAS 434          

HSP 2 Score: 237.654 bits (605), Expect = 1.825e-67
Identity = 143/418 (34.21%), Postives = 227/418 (54.31%), Query Frame = 1
Query:  811 KWGRSGMVQLLID---SGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVN 2055
            +  R+G ++ ++D   SG  ++   ++GL  LH +++ GH ++  +L+  GA V + T+ G T+LH+++     +    L+   AN+N  + +  TPL++ A   + +V R LL+     +    +GFTPL +A ++   ++V LLL+     +   +  L  LH++A     +A  +LLQ   N +  +  G T LH+A          LLL   A  D  AR + TPLHVA K GN  ++ L L  G+     T+D  T LH  A+ G  + + +LLD GA I ++TK G +PLH+A + D +    +LLQ     +    + LT LHVA H  H KVA+L++D KA+P  KA NG+TPLHIA KKN   +  +LL   A   A + +G +P+ +A+  GH ++VS L+ H A  N
Sbjct:   23 RAARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPN 436          

HSP 3 Score: 235.343 bits (599), Expect = 1.218e-66
Identity = 156/449 (34.74%), Postives = 235/449 (52.34%), Query Frame = 1
Query:  418 AAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNAT 1764
            AA+  +LE V   + +G +  I  ++G   L +A ++GH  +VA LL+                           L +S   V+  +  G T LHI++  G  +    L+   A+VN Q++N  TPL++AA+     +V+ L+++ A  S  T DG TPL  + + GH Q+   L++N  D   K R  L +LH+AA+ D    A +LL    N +  +    TPLH+ AHYGN  VA +LL+R    +  A N  TPLH+A K+    +V+LLL  GA IEA T+ GLTPLH  A  G ++ V +LL +GA I   T  G + LH+AT+ +    V+LLL+     D    +  T LHVA   G+ ++  L +   ++PN    + +T LH+A K+ R   + LLL  GA I+A T+ G TP+H+AA      + S L+   A+PN T
Sbjct:   24 AARAGNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLK---------------------------LGAS---VDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLEN--DTKGKVR--LPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINHGASPNTT 438          

HSP 4 Score: 218.009 bits (554), Expect = 1.042e-60
Identity = 138/398 (34.67%), Postives = 218/398 (54.77%), Query Frame = 1
Query: 1240 LKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            LK G  I    + GL  LH+++  G  E V  LL+ GA+++  T +G TALH+++   Q E V  L+  GA  +A+++   TPL++A +  +LE++   L++ +  ++AT D +T L VA ++G  + +SLLL++  K     K     LHIAA+ D    A++LLQ   N +   K+G TPLH+A HY +  VA LLL+  A     A+N  TPLH+AAK+ N ++  +LL   A   A++++G +PL   ++ GH  VV +LL   A +  K KNGL+ +H+  Q D +   ++L+     +   T    T LH AAH G   +AK ++    +   N K   GFTPLH+A ++  ++++ LLL+  A        G T  H+A    + NI   L
Sbjct:   37 LKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTK----GKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVD--KKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSAL 428          

HSP 5 Score: 208.379 bits (529), Expect = 2.014e-57
Identity = 130/386 (33.68%), Postives = 203/386 (52.59%), Query Frame = 1
Query: 1177 NGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQ--------------------KKANPN-------------ATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLIS 2235
            NG   LH+A K+  +++V  LLK GA ++A T+ G T LH+S+  G  E V  L+  GAN+   +  G T L++A + N  E V+ LL+  A       +  TPL VA + G+ ++++L L++ +   V       ALH+AA++  ++A +LLL +    + E+K GFTPLHIAA Y  + VA++LL                     K+ N N             A  K+GLTPLH      HE+V ++LLD  A    K KNG +PLH+A + ++ +   +LL  D   +  + +  + L +A+  GH  V  L++  KA+ N KA NG T +H+  ++++V V  +L+  GA I   T +  TP+H AA  G  N+   LI+
Sbjct:   49 NGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKV----RLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALIN 430          
BLAST of Ankyrin vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 577.4 bits (1487), Expect = 2.019e-170
Identity = 322/741 (43.45%), Postives = 445/741 (60.05%), Query Frame = 1
Query:   91 NSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQ--KADVN---------FQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGF 2280
            ++++ +SFLRAAR+GNL K ++ ++ G DINT N  GL+                                 ALH+AS  G  ++V  L+ NG  +   +  G T L++AA     +VVT L+N G +    ++ GFTPL +A Q+ H  +V  LLEN   + Q +P                            +  GFTPL +A   G+E    LLI    K  V          F +    TPLH+AA +    + QLL++ GA       D LTPLHC+AR+GH ++ E L+DNGA + +KT+NGL+ +HMAAQGD  D  + LL   A I++ T D LTPLHV AH G+ ++A+VLLD+   PN+RALNGFTPLHIACKK+ +++++LLLK+ A IEA TE+GLTPLHV++F+G    V +LLQKGA+     ++ ET LH+A+R+   E  + LL+  A  DAKA+++QTPLH A ++G+ EL+ L L+  ++PN  T   ++ LH+AA+EG  + + LLLD  A+    TK+GFTPLH+A+KY KV VA +LL++ ANPNA GKNGLTPLHVA H+N+  V  LL+     P   A+NGYT LHIAAK+N  ++A  LL   A +NAES  G +PL LASQEG  D+VSLL+  +A+VN   K+GLT +HL AQE  V +A ILV  GA +   T   YTPLH A H+G I M K+L  L  Q  +N KT++ +
Sbjct:    4 SADAGNSFLRAARSGNLDKALEHIKNGIDINTANQNGLN---------------------------------ALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENG--ANQSIP----------------------------TEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGA------NDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFL--LQQQANVNSKTRVEY 673          

HSP 2 Score: 437.187 bits (1123), Expect = 2.543e-124
Identity = 241/595 (40.50%), Postives = 352/595 (59.16%), Query Frame = 1
Query: 3238 ENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQ-LSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIK--------TTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIR--NNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVV 4989
            +NV  V  P+ +GFLVSFMVDARGG M+  R   LR  +PP +   PTR+ CRL+KP K+ SPP L +G+G A RI+ +GP   QF  P+++E+PH+A+L   +RE+++LRSENG  WKEH     D+ ++  +    E L + EE+   RI+RI+++D P YFA++SR++QE  LIGPEG  ++S +VP VQA FPE A+ K+ R+G+QA  +P E+V +LLGN+   SP++++EPRRRKFH+PI L +PLP +      +     T+SLRLLCS+ GG+A A WEDI+G+T L +  DC SFTT VSAR WL DCP        A  +YRE + VPYM +FVV+ + ++  E + R   +TDD +DKTLE  ENF  +A    +EV+   P  +E +GNL+PV K   Q    + +A  +NR+   V+V+D  +EP G L+ L            +      Q  +  L I +P  I       RR+ +      +               + ++EL +  +A+Q+G  W +LA  L +S  +D++ IR  N +S    + ALL LW ++ G  A    L  AL+ I R D++
Sbjct:  806 DNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPTRITCRLVKPQKLTSPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFAALGRGDRELVVLRSENGSVWKEHRNRYGDEVLETILNGMDEELESQEELGKKRIRRIISTDFPLYFAVVSRVQQESDLIGPEGGSLTSKLVPMVQATFPETAVTKRVRLGLQAQPVPDELVAKLLGNQANFSPVVTVEPRRRKFHRPIGLRIPLPPSWRDSPRDSGEGDTTSLRLLCSVIGGTASAQWEDITGTTKLIYANDCASFTTNVSARFWLADCPRTAEAVSFANLLYRELSAVPYMAKFVVFAKMNELREGRLRCYCMTDDKMDKTLEQHENFAEVARSRDIEVMEGMPLHLECSGNLLPVRKATQQPRCFSFQAFRDNRLPVTVKVRDSSKEPTGFLSFLR----------KSTKYEDSQHVLCNLNITMPPCITMRGSEDRRRTLTPLALRERYNALNEPAMASMSAMERTELKMAVIAEQLGLSWAELARELQLS-VDDINKIRVENPNSLLEQSSALLNLWATREGKRAKMESLYTALKSIDRMDII 1389          

HSP 3 Score: 333.954 bits (855), Expect = 1.133e-91
Identity = 223/625 (35.68%), Postives = 335/625 (53.60%), Query Frame = 1
Query:  586 LPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTR-------------NGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNI 2421
            L ALH+A K+  V  V  LL++  V +   +  G T LHIAA  G E+    L+    +VN Q++   TPL++AA+     +V+ L+++GA  S  T DG TPL  + + GH  +   LI  G     K R              G T LH+AA  +  + A++LL + AN      D LTPLH  A  G+ ++  +LLD      A+  NG +P+H+A +   +  V+ LL+Y A I+  T   LTPLHV+A  G      +LL KGA      + G T LH+A + N    + LLLK  A  +A      TPLHVA+ +G+L ++ + LQ G+ P+ +     T LH+A++ G  E    LL + A ++A+ K   TPLH AA+     +  +LL+ KANPN+T   G +PLH+A    H +  +LLLD +A      K G+TPLH+A+K    D+A +LL   A+ NA  +NG +PL +A    + DVV+LL+      +  A+NG T++H+ A++++V VA  L+  GA     +    TPLH A+  G+ ++   LIS   Q  +N   + G TPLHL AQ+GH+ + ++L++  A        G+T  H+A   HY NI
Sbjct:   41 LNALHLASKEGHVKMVLELLHNGIV-LETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTK--GKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGAN------DELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLIS--KQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVA--CHYGNI 652          

HSP 4 Score: 305.834 bits (782), Expect = 6.652e-83
Identity = 202/587 (34.41%), Postives = 311/587 (52.98%), Query Frame = 1
Query:  706 AAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNAR-----------ALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVL 2433
            AA  GN   A   I+   D+N   +N +  LH+A+K G   MV  L+ +G ++   T+ G T LH +A +G  Q+  +L++ G +V ++++ G T L+MAAQ +  +  + LL   AN +  T D  TPL V    G+E V  +L+        R           ++ GFTPLHIA     + + +LLL  GA  E      LTPLH +A  G    + +LL  GA I+  T  G + +H+A + +  + VK LL+  A  D    ++ TPLHVA   G+  +  + L  G+ PN    + +T LH+A K+     + LLL   A IEA T+ G TPLH+A+    + +  ILLQK A+P+A+     TPLH+A+   H +VA+ LL N A    KAK+  TPLH AA+  +++L  +LL   A+ N+ +  G SPL +A++EGH   V LLL  +A      K G T +H+ ++  KV VA +L+  GA+         TPLH A H   +++   L+S       +   + G+T LH+AA+Q  +++ N LL+  A  N ++ QG T  H+A ++   +I  +L
Sbjct:   14 AARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDE------LTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVS--KGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLL 592          

HSP 5 Score: 160.229 bits (404), Expect = 2.240e-38
Identity = 101/328 (30.79%), Postives = 165/328 (50.30%), Query Frame = 1
Query: 1489 LHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCK-----------AKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRK 2439
            LH+A+K G+++++   L +G      T+   TALH+AA  G+ + ++ L++ G  + A++++GFTPL++AA+ + + V   LL+  AN +   ++G TPL VA    HE V  LL+      K +           +  G+TPLHIAA   N ++A +LL      N  + +  +PL  A++ GH  ++ +LL + A +  K KNGL+ +H+ AQ D +   + L+   A+I   T    TPLH AAH G   MAK                                   +LL+  A PN +   G+T  HIA K+++L + ++L K
Sbjct:   44 LHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLL------NRGANDELTPLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAK-----------------------------------VLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLK 330          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 3638.97 bits (9435), Expect = 0.000e+0
Identity = 1846/1852 (99.68%), Postives = 1848/1852 (99.78%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQEXXXXXXXXXXXXEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDVVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTLNDDHIQCDFEKKSNENESLPLDFSE 5625
            MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDL CGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPD+VSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPT NDDHIQCDFEKKSNENESLPL  +E
Sbjct:    1 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLVCGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDLVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTPNDDHIQCDFEKKSNENESLPLGINE 1852          

HSP 2 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 494/498 (99.20%), Postives = 496/498 (99.60%), Query Frame = 1
Query: 5623 ESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSMPTALSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY-DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKSRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDXXXXXXXXXXXXXXXXXXXCHXXXXXXXXXXXXXXLVRVSQPFDDLTSLSEQFSTGCMSSG 7113
            ESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSS+PT+LSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADK RKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG
Sbjct: 2078 ESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSLPTSLSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINYNDFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKFRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG 2575          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 3638.97 bits (9435), Expect = 0.000e+0
Identity = 1846/1852 (99.68%), Postives = 1848/1852 (99.78%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQEXXXXXXXXXXXXEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDVVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTLNDDHIQCDFEKKSNENESLPLDFSE 5625
            MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDL CGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPD+VSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPT NDDHIQCDFEKKSNENESLPL  +E
Sbjct:    1 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLVCGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDLVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTPNDDHIQCDFEKKSNENESLPLGINE 1852          

HSP 2 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 501/515 (97.28%), Postives = 505/515 (98.06%), Query Frame = 1
Query: 5572 DFEKKSNENESLPLDFSESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSMPTALSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY-DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKSRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDXXXXXXXXXXXXXXXXXXXCHXXXXXXXXXXXXXXLVRVSQPFDDLTSLSEQFSTGCMSSG 7113
            DF K  +  +   LDFSESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSS+PT+LSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADK RKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG
Sbjct: 2064 DFVKNFSNVQICNLDFSESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSLPTSLSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINYNDFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKFRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG 2578          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 3634.34 bits (9423), Expect = 0.000e+0
Identity = 1846/1853 (99.62%), Postives = 1848/1853 (99.73%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQEXXXXXXXXXXXXEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHE-DNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDVVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTLNDDHIQCDFEKKSNENESLPLDFSE 5625
            MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDL CGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHE DNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPD+VSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPT NDDHIQCDFEKKSNENESLPL  +E
Sbjct:    1 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLVCGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEVDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDLVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTPNDDHIQCDFEKKSNENESLPLGINE 1853          

HSP 2 Score: 937.562 bits (2422), Expect = 0.000e+0
Identity = 501/515 (97.28%), Postives = 505/515 (98.06%), Query Frame = 1
Query: 5572 DFEKKSNENESLPLDFSESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSMPTALSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY-DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKSRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDXXXXXXXXXXXXXXXXXXXCHXXXXXXXXXXXXXXLVRVSQPFDDLTSLSEQFSTGCMSSG 7113
            DF K  +  +   LDFSESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSS+PT+LSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADK RKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG
Sbjct: 2065 DFVKNFSNVQICNLDFSESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSLPTSLSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINYNDFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKFRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG 2579          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 3634.34 bits (9423), Expect = 0.000e+0
Identity = 1846/1853 (99.62%), Postives = 1848/1853 (99.73%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQEXXXXXXXXXXXXEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHE-DNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDVVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTLNDDHIQCDFEKKSNENESLPLDFSE 5625
            MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDL CGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHE DNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPD+VSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPT NDDHIQCDFEKKSNENESLPL  +E
Sbjct:    1 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLVCGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEVDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDLVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTPNDDHIQCDFEKKSNENESLPLGINE 1853          

HSP 2 Score: 927.932 bits (2397), Expect = 0.000e+0
Identity = 494/498 (99.20%), Postives = 496/498 (99.60%), Query Frame = 1
Query: 5623 ESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSMPTALSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY-DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKSRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDXXXXXXXXXXXXXXXXXXXCHXXXXXXXXXXXXXXLVRVSQPFDDLTSLSEQFSTGCMSSG 7113
            ESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSS+PT+LSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADK RKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG
Sbjct: 2079 ESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSLPTSLSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINYNDFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKFRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG 2576          
BLAST of Ankyrin vs. Planmine SMEST
Match: SMESG000000606.1 (SMESG000000606.1)

HSP 1 Score: 3632.42 bits (9418), Expect = 0.000e+0
Identity = 1846/1866 (98.93%), Postives = 1848/1866 (99.04%), Query Frame = 1
Query:   70 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPXXXXXXXXXXXXVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTXXXXXXXXXXXXXXXXXXXXXXNMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRS--------------ELSIAPIEVSQEXXXXXXXXXXXXEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYAXXXXXXXXXXXXXXXNGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGXXXXXXXXXXXXXXFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDVVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTLNDDHIQCDFEKKSNENESLPLDFSE 5625
            MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRS              ELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDL CGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPD+VSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPT NDDHIQCDFEKKSNENESLPL  +E
Sbjct:    1 MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHLAAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENGANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVALQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVNHQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWGRSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMSKTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGNEKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEATTETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQTETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVATRDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVGVASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAKNGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDVVSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTAEYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQLVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEIEEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDRKNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRDVEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMIGDSEFRSDTSITSNMFRNFVEELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHISGSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKSDWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSALGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEVPHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTNEEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQAVFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHKPITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTPLSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFVVYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPHWIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAILLHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGEFIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNNSSDEYSAYALLILWRSKRGDLVCGNELEKALRDIGREDVVKNCMINISFVTDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDIQASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDEILPKPEIIQETYDESSVEESDIIPDLVSKPDIVVLDKSSLPDLLDHSPEEENITSHRMRDTYAEFKPDQPNSPPPTPNDDHIQCDFEKKSNENESLPLGINE 1866          

HSP 2 Score: 938.332 bits (2424), Expect = 0.000e+0
Identity = 501/515 (97.28%), Postives = 505/515 (98.06%), Query Frame = 1
Query: 5572 DFEKKSNENESLPLDFSESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSMPTALSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY-DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKSRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDXXXXXXXXXXXXXXXXXXXCHXXXXXXXXXXXXXXLVRVSQPFDDLTSLSEQFSTGCMSSG 7113
            DF K  +  +   LDFSESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSS+PT+LSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINY DFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADK RKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG
Sbjct: 2078 DFVKNFSNVQICNLDFSESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYAHEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEMLTEFPVKIPGILPLLNNSRHNSSLPTSLSCEILESPDHEEVNHAHKDSLCLQDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESIIESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEPESPLIDDCDYFINYNDFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLDVAPLSPIIECTESFDKSPEILSDLKLDSENADKFRKKQKFCHFDDSNSSSSLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAHSMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSSSIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSG 2592          
The following BLAST results are available for this feature:
BLAST of Ankyrin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK34.761e-13057.05ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK31.175e-13756.73ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK31.051e-13756.74ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK21.063e-12656.63ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK21.082e-12655.51ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
back to top
BLAST of Ankyrin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-441.876e-13259.21AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.876e-13259.21AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.781e-13357.59AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-442.781e-13357.59AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-441.193e-13457.59AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of Ankyrin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank23.094e-13556.99gene:FBgn0261788 transcript:FBtr0344224[more]
Ank22.343e-13556.99gene:FBgn0261788 transcript:FBtr0303125[more]
Ank21.377e-13656.99gene:FBgn0261788 transcript:FBtr0303113[more]
Ank22.201e-13656.99gene:FBgn0261788 transcript:FBtr0303123[more]
Ank21.469e-13656.99gene:FBgn0261788 transcript:FBtr0303114[more]
back to top
BLAST of Ankyrin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3a3.813e-11756.09ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a3.711e-12756.44ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a3.711e-12756.44ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank2b3.619e-12355.80ankyrin 2b, neuronal [Source:ZFIN;Acc:ZDB-GENE-041... [more]
BX469921.12.553e-9555.40ankyrin 3a [Source:NCBI gene;Acc:103909035][more]
back to top
BLAST of Ankyrin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm43.225e-12956.87tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.491e-12456.38tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm43.744e-13256.78tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm42.987e-12956.38tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
tpm45.863e-13556.73tropomyosin 4 [Source:Xenbase;Acc:XB-GENE-6077097][more]
back to top
BLAST of Ankyrin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank32.134e-13656.58ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.721e-13656.58ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank35.527e-13056.35ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.721e-13656.58ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank33.015e-13656.58ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of Ankyrin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12955|ANK3_HUMAN2.286e-12957.05Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=... [more]
sp|O70511|ANK3_RAT1.539e-12956.35Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE... [more]
sp|G5E8K5|ANK3_MOUSE2.603e-13556.58Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV... [more]
sp|Q01484|ANK2_HUMAN3.168e-12255.51Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
sp|Q8C8R3|ANK2_MOUSE1.419e-12555.39Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
back to top
BLAST of Ankyrin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H5D20.000e+049.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A158R8M62.544e-649.29Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0B7BMH01.520e-2950.58Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A0B7BKD91.289e-2950.36Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
A0A4Z2D3U00.000e+058.14Ankyrin-3 isoform 2 (Fragment) OS=Schistosoma japo... [more]
back to top
BLAST of Ankyrin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3a4.706e-12756.31ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3a1.487e-12656.06ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ENSAMXT00000017800.23.130e-11755.36pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank3a2.569e-11755.68ankyrin 3a [Source:ZFIN;Acc:ZDB-GENE-060621-1][more]
ank3b2.074e-13456.58ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
back to top
BLAST of Ankyrin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.13.496e-4256.24pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.11.683e-4256.74pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000007446.13.021e-17255.83pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.14.378e-14156.65pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
ENSPMAT00000006531.11.344e-9046.84pep scaffold:Pmarinus_7.0:GL477280:1359:33855:1 ge... [more]
back to top
BLAST of Ankyrin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HOS41.733e-1441.90Subunit of the Set3 complex; complex is a meiotic-... [more]
AKR17.654e-1429.71Palmitoyl transferase involved in protein palmitoy... [more]
NAS62.063e-1330.46Evolutionarily conserved 19S regulatory particle a... [more]
PHO814.349e-1226.41Cyclin-dependent kinase (CDK) inhibitor; regulates... [more]
AKR22.004e-1129.74Ankyrin repeat-containing protein; member of a fam... [more]
back to top
BLAST of Ankyrin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO454871.423e-7038.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454862.061e-4339.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436901.618e-2631.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387021.854e-2626.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375205.123e-2426.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ankyrin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000031565.11.995e-13655.63ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000039458.11.797e-13655.48ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1b1.238e-11853.08ankyrin-1 [Source:NCBI gene;Acc:101157380][more]
ENSORLT00000039903.15.806e-17261.27pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
ank1a2.019e-17043.45ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
back to top
BLAST of Ankyrin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000606.10.000e+099.68SMESG000000606.1[more]
SMESG000000606.10.000e+099.68SMESG000000606.1[more]
SMESG000000606.10.000e+099.62SMESG000000606.1[more]
SMESG000000606.10.000e+099.62SMESG000000606.1[more]
SMESG000000606.10.000e+098.93SMESG000000606.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026337 ID=SMED30026337|Name=Ankyrin|organism=Schmidtea mediterranea sexual|type=transcript|length=9304bp
TTAACCTTATTTTAGTTTTAATTTATCAGTTAGATATTTACAATCATTTG
AAGATTTTAGCTATCAACAATGACAAAATCCAACACAGAGAATAGCGAGT
CAAATCATAGCTTTTTACGAGCAGCTAGAGCAGGAAATTTATCAAAAGTT
ATTGATTTTCTTGAAACCGGAACTGATATAAACACTTGTAACGATATTGG
CTTAAGCGCTTTGCATCTGGCAGCGAAAGAAGGTCATATTGTCATTGTCA
AAGAACTCATTAAACGAGAACCTAGAATCGATGCTACGACTAAAAAAGGA
AATTCTGCCTTACACATTGCAAGTTTGGCTGGAAAGTTTGAAGTAGTCAA
AATTCTCGTAGAAAATGGAGCAAATGTAAACTTACAATCAACAAATGGAT
TTACTCCTCTGTATATGGCAGCTCAAGAAAATCATCTTGAAGTAGTGACA
TTTCTTATCAACAATGGAGCCGATCAGACAATTACAACTGAAGATGGTTT
CACTCCTCTAGCCGTTGCTTTGCAACAGGGTCACGAAAGAATTGTAGCTC
TTCTTTTAGAAAATGACAACCGCAGTAAACAGAGGCTACCTGCTTTGCAT
ATTGCAGTTAAGAAAAACGACGTAAACGCTGTGAATTTACTTTTGAATAG
CAGTGAAGTTGATGTTAATCACCAATCATCAAGTGGATTTACACCGCTTC
ATATCGCTGCACATTATGGGAACGAAAAGTCCGCACAGTTATTGATTGAA
CAAAAAGCAGACGTCAATTTCCAGGCTAAAAACAATATCACTCCATTGCA
TGTTGCTGCAAAATGGGGCAGATCGGGAATGGTACAATTGCTTATAGATT
CAGGAGCTTTAGTGTCATGTCGCACACGGGACGGGCTAACACCACTTCAT
TGTTCTGCTAGGTCAGGCCATGCACAATTGTGTGAAAAGTTGATCGATAA
TGGTGCAGATGTCATGTCTAAGACTAGGAATGGCCTCACTTCGTTACATA
TGGCTGCCCAAGGTGATTTTGAAGACACAGCTAGAATATTACTGTTGAAA
CGAGCAAATATTAACGAAACAACAACGGATTTTCTCACTCCATTGCACGT
GACTGCACATTACGGTAATGAAAAGGTAGCTCGGGTCCTGCTGGACAGAC
GATGTGACCCGAATGCCAGAGCTCTGAATGGATTTACACCGCTCCATATT
GCATGCAAGAAACACAAAATAAAGATCGTTGAATTACTATTGAAATACGG
TGCTTTGATCGAAGCGACTACTGAGACCGGTTTGACTCCTCTCCATGTTT
CGGCATTTATTGGATCAAAAGAAGCTGTGAATATGCTATTGCAAAAGGGA
GCTAATATAGAGCAAGGTACAATGCGAGGGGAAACAGCTTTACATTTAGC
GACAAGGAATAATCAAACTGAGACCGTTAAGTTGTTGTTGAAAGCTGGAG
CTATTCCTGATGCTAAAGCAAGAGAAAACCAAACTCCATTGCATGTCGCA
ACTAAAATAGGAAATTTGGAATTAATTACGTTGTTTCTACAAAGTGGTTC
TGATCCGAATGTCGCTACTCGTGACAATTACACCGCCCTCCATGTTGCTG
CCAAAGAAGGCCGAAGTGAAGCAATCAGTTTACTGTTGGACAGTGGTGCT
AAAATTGAAGCAGAAACAAAAAGAGGATTTACTCCTTTGCATATTGCAGC
TAAATATGACAAAGTTGGCGTTGCCAGTATATTATTACAAAAGAAAGCTA
ATCCGAATGCTACTGGCAAAAATGGTCTCACTCCTCTTCATGTTGCAACT
CATTATAACCATGAAAAAGTTGCACAATTATTATTGGATAATAAGGCAGA
TCCGAAATGCAAGGCTAAAAATGGATATACACCGCTACATATTGCAGCAA
AGAAAAACAATCAGGATTTAGCAATTATGCTTTTGGTATCTGATGCGGAT
AGTAATGCTGAATCCCGCAACGGATTCTCTCCTTTACAATTAGCCAGCCA
AGAAGGTCATACAGACGTAGTTTCATTATTGTTGCAACACAAAGCAGATG
TTAATCACAAGGCTAAGAATGGACTTACTTCAATGCATTTGACAGCCCAA
GAAGATAAGGTAACCGTTGCTAGAATTTTAGTGCACGCTGGAGCTGATAT
AACACCAACGACCACAGCCGAGTATACTCCTCTTCATACAGCAGCACATT
TCGGACAAATCAATATGGCAAAGTACTTAATTAGTTTGATGGATCAGAAC
CAAATCAACCAGAAAACCCAATTGGGATTTACTCCATTGCATTTGGCAGC
CCAACAGGGTCACTTGCAGCTCGTTAATCTTTTACTGGAAAGCAGAGCCG
ATCCTAATATTAAAAACAATCAAGGATGGACCGCTGCTCACATTGCTCGT
AAACAACACTATTTGAATATTTTTGAAGTTTTGAGAAAAGTAACAACTGA
AGTCATCAGTTGGGAAATCGAGGAAGAGGAAACTGAAGAAATCATAATTT
TAGAGAAACCAGAAAATATGGGAGAACATGCCGTTTCCGATAGTGAGGAT
GAAGGAGAGACGGGCAGGACATCTAAAATAGACATTGATAATGCTTATGA
GAGTGATTCGTTGGATCGAAAGAATAAACACCTTAAATTGCCGGAAAATG
TGGATTATAGAATCTCAACGTCTAATGATGATATATGGAAAGAATTGGAA
TACATGAAATCTGTTCAAGGCAAGCGTGGCGCCGCAACAGTGTCATCTCA
ATCAGTGGATTCCAGAGACGTTGAAGTTTATGAATCTATGGATGTTGTTG
AGGTTGTGGAGGATTTGGATAGATCGATTAGTCCACCTTCGAGAAAGGAT
AAGTCATCAGTTGAAATAAGAGGTGTTCCGACACGCATTTCGAGTTTGGA
TTTTGATTCCACTATGATCGGTGACTCTGAGTTCAGATCAGAACTATCCA
TTGCACCTATTGAAGTGTCTCAAGAATTGATTTCCAGTGATATTCGACTG
TCCTTATCGAGTGAAGTAGATTTTACAGCAATGCCACCATCTCCCTGTGT
AATGAAAAATCATATTTCCGGAAGTCAGGGTCGCAGTGAAGCTTCTGGAG
ATGAAAGCTTTCTCGAAAACATGAATTCAAGGGATTTGAATTGTCACAAG
CTAACTGAAATTCAGCCTGAAAGGATTGAATCTGTTAATTTCGCGACTGA
AGAAGCTTATAATAAATCTGACTGGGACTTTGAACCTGAGAACGTACCAA
TTGTTCGTAAACCAGTTTCGTCAGGATTCTTGGTATCTTTTATGGTTGAT
GCTCGAGGAGGATGCATGCAAGCTCAAAGATTTACAAATTTGCGATTCTA
TGTGCCACCAAGTTCAGCTTTAGGTCCAACTCGTTTGGTATGTAGACTGA
TTAAACCAAGTAAAATGAATTCACCACCTGCTTTGAATGATGGGGATGGA
TTTGCTTGCAGAATTATGGAAATGGGACCATGCAATACTCAATTTAATTC
TCCAATTCTAATTGAAGTTCCTCACTACGCTTCATTGCGAGATCGCGAAA
GAGAAATCATCATCCTGAGAAGCGAGAATGGTGAAACATGGAAAGAGCAC
CCAATTGAAGCTACTGACCAAGCAATACAAAATTCTGTCGGGTTATCGTT
TGAAAGATTAATGACTAATGAGGAAGTAAGAGCAAATAGAATTCAAAGAA
TTCTGACATCCGATTTACCACAATATTTTGCATTAATATCAAGAATTCGG
CAAGAAGTCGCTCTAATTGGGCCCGAAGGTGTTGTCATGAGTTCTTCTGT
AGTACCTCAAGTACAAGCAGTTTTCCCCGAAGGAGCTCTCATGAAAAAAA
CTCGAGTTGGTATTCAAGCTCATGAAATTCCAGTAGAAATAGTTACTCGA
CTTCTTGGAAATCGTGTTGCGTGTAGTCCTATTATCAGCATTGAACCTCG
TAGACGAAAATTCCATAAACCAATTACTCTTACTGTCCCATTGCCAAAAA
CAGTAAATAAAGGAATGATAAATGATCCAAATAGTGGAACTTCAAGTTTG
AGATTGCTGTGTAGCATTACTGGTGGCAGTGCTCCTGCAGTGTGGGAAGA
TATCTCGGGATCAACACCATTGTCGTTTCATAAAGATTGTGTTTCCTTTA
CCACTACAGTTTCTGCAAGATTATGGCTAATTGATTGCCCGAATGTTCAA
GGAGTGGCTGAAATGGCAACCAACGTTTACCGTGAATCTACTGTTGTGCC
TTACATGGGGCAGTTTGTTGTATACGGTCGAAGACATGATAGAGAAGAAG
CGCAATTCCGTATTCTTGGACTAACCGATGATTCTGTTGATAAAACACTG
GAATGTCAAGAAAATTTCCAACTCATTGCAAGCGGTCCACTCGTCGAAGT
TTTACATAATCGTCCTCACTGGATAGAAACAGCAGGAAATTTGGTACCTG
TTACAAAAACTGGAGATCAGTTGAGTATGACAATCGAAGCATTGAATGAA
AACAGAATAAGTTTTCTGGTTCGGGTTAAAGACATTCAACAAGAGCCTAA
AGGAAAATTAGCCATTCTTCTTCATCAAAGAAACCAAGGAATGGGTGCTG
GAAATGCACTTGGTACCTCGGCAGTTCAAAAACCCATCACAACACTGGAG
ATTTGTTTGCCAAGTGAAATTCATCCGGTCTCTGATACTTTGAGAAGGAA
AAAAATGAAAACTGGAGAATTTATTAAAACTACCATTTGTACTGACAAAA
TAGCAAAATCTGAACTTGATTTACGAGCGGTGGCGGATCAAATTGGAGGC
GATTGGGAGAAACTCGCAGCAGCTCTAGGAATTTCCGATTCGGAGGATTT
ACACAATATCAGAAATAATTCATCAGATGAATACTCGGCATATGCTCTTC
TTATTTTATGGAGATCTAAGCGAGGCGACTTGGCTTGTGGTAATGAATTA
GAAAAGGCTTTACGGGACATTGGACGTGAAGATGTTGTGAAAAACTGTAT
GATAAATATATCTTTTGTTACCGATGAAGATGAGAAAAGTCAAGCATTAA
AAGATATTGCAAAACACGAAGATAACAATTATTTGAATACAGACAAAACC
GGATCTGTTGATGAGTCGATGGTAGTTGAGGTCGGGGATGATTCAGCTTC
ACAGAGGGAAAATGATATTCAGGCTTCAGATTACACAGAAGATGGAGATG
ATTCTTTAATTGTACCAACTATAAAACCTGGAACAGTAATAAGAACTGAT
GAAGATAAAGAAGGTTTTTCGCAGAAAAAATTGGAGGCCTTTGTTAATTT
AATCAATCAATTTGACGAAATACTACCGAAACCTGAAATAATACAGGAGA
CATATGATGAAAGTTCGGTCGAAGAAAGCGATATAATTCCAGATGTAGTC
AGTAAGCCAGACATTGTTGTCCTTGACAAGTCTTCTCTACCGGATTTATT
GGATCATTCTCCAGAAGAAGAGAATATTACAAGTCATAGAATGAGAGATA
CCTACGCAGAATTCAAACCGGATCAACCTAACTCGCCTCCACCTACTCTG
AACGATGATCATATTCAATGCGATTTCGAGAAAAAGTCTAATGAAAATGA
AAGCTTGCCATTAGATTTTTCAGAGTCTTTTAATCAAAATCCGTGTTGTT
ACACTGTAACCTCCTCAGCTTTAGAGATCGATCCTGACGACTTGTTTTCT
AGCAAACGACAAAACGTTGATGAATCAGTTACTTCTTTTAAAACGCTATT
ATTAAATGAACAGTATGCGCACGAAAAATTAGATTCACCTTCTAATCCAA
CATGTGAGATTCTGTATGAAGCCCTTGGTAGTGATCATGCTTCAGCTCCA
AATGATAGTGATCAGGAGTTAGAGGAAGATTATTCACATCAAATTGAATG
TCTGAAAGAAGAAATGCTTACAGAGTTTCCTGTAAAAATTCCAGGAATTT
TACCGCTATTGAACAATAGTAGACATAATTCTAGCATGCCTACGGCATTG
AGCTGTGAAATACTTGAATCCCCTGACCACGAGGAGGTGAATCATGCTCA
TAAAGATTCCTTGTGTTTGCAAGATAATGTTGAAAGTGGAAAAGTTGAAA
ATACTTCTAATGGCAGATTGGAAGAATCTAATATTGATAAATTAGTTTCA
GAATTAATTGACGGAGTAATGAAATATGCGAATATTGAAGTCAAATCCGA
TATTATGGTGGAATCTATTATTGAATCAGCTAAATATACGGAAATCATTG
TGATTGTTGCCGAAGATTTGGTGGAGAATGTTATCAACGGTTCGGTGAAT
TATATTACTGAACAGAATAAATACAATCATGATACCTTTGATGATGACTT
AAGCCCAGTTTTAGAGCCAGAGTCACCACTGATTGATGATTGTGATTATT
TTATAAATTATGACTTTGGCACTCGAATTACTAAAGAACCACCTACGTTA
TCATTATCTATCCAAGCTGAAGATCCTAATGTTGGTTTAATTCTAACGAC
TAACGGGGATGATTTAGATGTCGCACCTCTTTCCCCTATTATTGAATGCA
CAGAATCATTTGATAAATCTCCCGAAATATTATCCGATTTAAAGTTAGAT
TCGGAAAACGCTGATAAATCTCGCAAAAAACAAAAGTTTTGCCATTTTGA
TGATTCGAATTCATCTTCATCACTGAAGGAGTTTGAAAGGATTGAAGATG
ATTTGCTTGATGAAAAATCACAGTTCACATTTCTTGCAAAATCTCCAAGT
ACTGATGAAATAAGTCCCGTTAAAGAAACGGCATTAATAGATGAATTACC
GGATTTTAGCGAAGCTCATTCCATGACTAGTAATGCATCTAGTCAACAGT
GTTCAGTTGTCTACGCATCTCAACGGGCTGAATCTCTGCAACAAATAGAC
TCCGACTCCGCTGCTGGACTTGCTATTGATCTGTTGACGTCTTCATCCCG
AACGACGTCAATGAGCTCATCAATAATGCTGATGAGCTGTCATTCTACAG
ATTCGACGACGTTGACAACCACTACCGGTAGCACTTTAGTTAGAGTTTCT
CAACCGTTCGATGATTTAACTTCTCTTTCTGAGCAATTTTCTACGGGATG
CATGTCGTCAGGTTCCGATGATCAATGAATAACTGAAACTTTTCGTGCAC
ATATTATTCCATTTGCGATTGACTGAATTTATTATTGTTATTATTTTGAC
TCTACGTTATCTGAAAGCGATTTGTAACTTAACATCATCATATTCTATGT
AATCTTTATCAAAAAGGCATTCTAACCCATTTTGGTCACTTTGTTAATGT
GAAGCTTTATTTCGTTGAATCTATTTGTATTTTTGTTTCAAAACATATAT
CTGTGATTAAATATCCCAATTGATCATTTGGTAGCTATAGATTAATCTTT
CACCGACTTAATAGATTCGTGTATTCTTTTTCCCCAGTTTGAGAATCGTG
GTTATTATTGAAACTTTAAATGGAAATTTTTGCAGAAATTAAAGCAACAT
TTCGATTTTCCTAAGTGTTCTTCATCAATTGTTGTTCAGTTTAACCTTTT
AGTTGATGAGATCTACAACACAATGGAAGCAACGTTTTGATTTCAGTTTG
CTTTAATTTTTATTATTAAAACCGGTTATGGCTTTATTATTATTATTAAC
TTCTTTATTATACTACTGAATGGAAGCACTGAGTATTTTTATTTTGGTTG
ATGTTTATTAAAGATTATTTGTATAATGCAAACATCATATTGTAAGTTTA
GTTACAGCCATGTTGTTGTTGTTATCATTATTATCGAGATCATAATTCAT
ATCGTCATCATGAGCATCATTCAATGATCATATATGATGCAGGCCAACAT
GAAGCTCAATACGGAACTGCAAACTGTCAAGCACATTTCACCTTCGAAAT
CTCCCAGCAAACGCTCGTCCTTGAATGAGACTCCGGTGGCGATTCGGTAT
CGGGCTAAATCGACAATTGAGTCTACTGTGAAGTCCGAGTCCAGTCATTC
CAGTAATTCAATGAACACTGAATATCAAAATGGCAAATTGAGGCCAGACT
CAAAGGATCTCGAATCAACTCGGCTAGTGCAAATACTGACTATGGAAAAC
CGAAATCTAGTAGAGAGAATCGCCCATTTGGAAACCGTGGGATTCTATCA
GCGCCAGAAGCTCGAGGCAGCAAACTGCTTGAGCCTAGCTGCCGAAATGG
AGCAGCTCAATGTGGAAGAGTTGAAAAAGGCTCTCACCGTGGAAAGGGAA
ACTGTGAGAAATTTGCAAACCTATATGGAATCGCTGACGACAAAATTGCT
CACTGCCGGTCATATCGATGTGTTTCAGTTGTCCTAGCTTGGGTGCTGAG
ATGCCTGCAGTCATTTAGTGTGTTGACATATCTGTTCACCCCCTCCCGCT
ACCACCGCCACTACCGCCGCCGCCACCGCCGCCGCCAAGACCACTCATTA
TCATACATACACACACACATCATCAATGCAATCAGCCTATCTAAATTCAA
TAATCAAACCGATTCAATCAATATTTTGTATTTGTAAAAATATCATTAAT
TTTATTTCAATATTTCCGATTTTTATCTTCATTTCTCATTATTTATCACA
GGGGAGGCAGATTTTTCACCGCAGACTCCTTTTTGATTGGCCCCATTTTA
GGATCGATTATTCTTTGATCAGGAGGAATATTTCTAGAAATATATAAATT
CATTGGATCAGTGAGAATGAATGAATAATTATATGCCGGGCCAGCAAGCG
GGAGATCCCGGATGTCATTGTCACTGTCCTGGCTGTCCCAATTGGGCACA
TCCATGTCCATCTAGCACCAAGGATATTCAATGGAATTGGATTGCTGGAG
CTCTGGGATTATCCTATGTCCATTGCATGGCATCCACTGACATGAGTCGG
TGCAAATATCGACAGATGGACAGCCAGATATTTATTGGTTCCGCATAATT
CTCGATTGACCAATGGCAGCTTGCCTATGACTCTGGGCTTCTCGGGCTAT
TTTATGTTTTATGTGCAAAATATTTATCCTCGGACAGATCTTGGGTAAAA
CTAGGTAACGGATCTTTACAAGTTGATAAAATGCGCCAAGACGTTGTTAG
CTGTGAATAGCATTTCTTCTTCGATTTTAAACGTTCTGGTGTTTGTGTTT
CGTTTATGAAATCAAATGACCATTTTTCAAATCAGTTTGCATTGGTAGCT
CTTCTGCTTTCTAGCTTTTCGTGTGTATGAATGAGTTTTCCTTCTATAAT
TAACGGCTCACTGATAAGGGCCCCTTATTCTCCTCGCTCCTATCACTCCC
TCCC
back to top

protein sequence of SMED30026337-orf-1

>SMED30026337-orf-1 ID=SMED30026337-orf-1|Name=SMED30026337-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2353bp
MTKSNTENSESNHSFLRAARAGNLSKVIDFLETGTDINTCNDIGLSALHL
AAKEGHIVIVKELIKREPRIDATTKKGNSALHIASLAGKFEVVKILVENG
ANVNLQSTNGFTPLYMAAQENHLEVVTFLINNGADQTITTEDGFTPLAVA
LQQGHERIVALLLENDNRSKQRLPALHIAVKKNDVNAVNLLLNSSEVDVN
HQSSSGFTPLHIAAHYGNEKSAQLLIEQKADVNFQAKNNITPLHVAAKWG
RSGMVQLLIDSGALVSCRTRDGLTPLHCSARSGHAQLCEKLIDNGADVMS
KTRNGLTSLHMAAQGDFEDTARILLLKRANINETTTDFLTPLHVTAHYGN
EKVARVLLDRRCDPNARALNGFTPLHIACKKHKIKIVELLLKYGALIEAT
TETGLTPLHVSAFIGSKEAVNMLLQKGANIEQGTMRGETALHLATRNNQT
ETVKLLLKAGAIPDAKARENQTPLHVATKIGNLELITLFLQSGSDPNVAT
RDNYTALHVAAKEGRSEAISLLLDSGAKIEAETKRGFTPLHIAAKYDKVG
VASILLQKKANPNATGKNGLTPLHVATHYNHEKVAQLLLDNKADPKCKAK
NGYTPLHIAAKKNNQDLAIMLLVSDADSNAESRNGFSPLQLASQEGHTDV
VSLLLQHKADVNHKAKNGLTSMHLTAQEDKVTVARILVHAGADITPTTTA
EYTPLHTAAHFGQINMAKYLISLMDQNQINQKTQLGFTPLHLAAQQGHLQ
LVNLLLESRADPNIKNNQGWTAAHIARKQHYLNIFEVLRKVTTEVISWEI
EEEETEEIIILEKPENMGEHAVSDSEDEGETGRTSKIDIDNAYESDSLDR
KNKHLKLPENVDYRISTSNDDIWKELEYMKSVQGKRGAATVSSQSVDSRD
VEVYESMDVVEVVEDLDRSISPPSRKDKSSVEIRGVPTRISSLDFDSTMI
GDSEFRSELSIAPIEVSQELISSDIRLSLSSEVDFTAMPPSPCVMKNHIS
GSQGRSEASGDESFLENMNSRDLNCHKLTEIQPERIESVNFATEEAYNKS
DWDFEPENVPIVRKPVSSGFLVSFMVDARGGCMQAQRFTNLRFYVPPSSA
LGPTRLVCRLIKPSKMNSPPALNDGDGFACRIMEMGPCNTQFNSPILIEV
PHYASLRDREREIIILRSENGETWKEHPIEATDQAIQNSVGLSFERLMTN
EEVRANRIQRILTSDLPQYFALISRIRQEVALIGPEGVVMSSSVVPQVQA
VFPEGALMKKTRVGIQAHEIPVEIVTRLLGNRVACSPIISIEPRRRKFHK
PITLTVPLPKTVNKGMINDPNSGTSSLRLLCSITGGSAPAVWEDISGSTP
LSFHKDCVSFTTTVSARLWLIDCPNVQGVAEMATNVYRESTVVPYMGQFV
VYGRRHDREEAQFRILGLTDDSVDKTLECQENFQLIASGPLVEVLHNRPH
WIETAGNLVPVTKTGDQLSMTIEALNENRISFLVRVKDIQQEPKGKLAIL
LHQRNQGMGAGNALGTSAVQKPITTLEICLPSEIHPVSDTLRRKKMKTGE
FIKTTICTDKIAKSELDLRAVADQIGGDWEKLAAALGISDSEDLHNIRNN
SSDEYSAYALLILWRSKRGDLACGNELEKALRDIGREDVVKNCMINISFV
TDEDEKSQALKDIAKHEDNNYLNTDKTGSVDESMVVEVGDDSASQRENDI
QASDYTEDGDDSLIVPTIKPGTVIRTDEDKEGFSQKKLEAFVNLINQFDE
ILPKPEIIQETYDESSVEESDIIPDVVSKPDIVVLDKSSLPDLLDHSPEE
ENITSHRMRDTYAEFKPDQPNSPPPTLNDDHIQCDFEKKSNENESLPLDF
SESFNQNPCCYTVTSSALEIDPDDLFSSKRQNVDESVTSFKTLLLNEQYA
HEKLDSPSNPTCEILYEALGSDHASAPNDSDQELEEDYSHQIECLKEEML
TEFPVKIPGILPLLNNSRHNSSMPTALSCEILESPDHEEVNHAHKDSLCL
QDNVESGKVENTSNGRLEESNIDKLVSELIDGVMKYANIEVKSDIMVESI
IESAKYTEIIVIVAEDLVENVINGSVNYITEQNKYNHDTFDDDLSPVLEP
ESPLIDDCDYFINYDFGTRITKEPPTLSLSIQAEDPNVGLILTTNGDDLD
VAPLSPIIECTESFDKSPEILSDLKLDSENADKSRKKQKFCHFDDSNSSS
SLKEFERIEDDLLDEKSQFTFLAKSPSTDEISPVKETALIDELPDFSEAH
SMTSNASSQQCSVVYASQRAESLQQIDSDSAAGLAIDLLTSSSRTTSMSS
SIMLMSCHSTDSTTLTTTTGSTLVRVSQPFDDLTSLSEQFSTGCMSSGSD
DQ*
back to top

protein sequence of SMED30026337-orf-2

>SMED30026337-orf-2 ID=SMED30026337-orf-2|Name=SMED30026337-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=168bp
MMQANMKLNTELQTVKHISPSKSPSKRSSLNETPVAIRYRAKSTIESTVK
SESSHSSNSMNTEYQNGKLRPDSKDLESTRLVQILTMENRNLVERIAHLE
TVGFYQRQKLEAANCLSLAAEMEQLNVEELKKALTVERETVRNLQTYMES
LTTKLLTAGHIDVFQLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR040745Ankyrin_UPA
IPR003650Orange_dom
IPR002110Ankyrin_rpt
IPR000488Death_domain
IPR000906ZU5_dom
IPR020683Ankyrin_rpt-contain_dom
IPR011029DEATH-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 44..59
score: 39.5
coord: 92..106
score: 38.95
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 43..72
e-value: 8.8E-4
score: 28.6
coord: 436..465
e-value: 4.8E-5
score: 32.8
coord: 271..300
e-value: 2.0E-4
score: 30.7
coord: 568..597
e-value: 2.4E-5
score: 33.8
coord: 109..138
e-value: 3.7E-6
score: 36.5
coord: 768..798
e-value: 4000.0
score: 0.5
coord: 700..731
e-value: 0.11
score: 21.6
coord: 304..333
e-value: 0.0075
score: 25.5
coord: 10..39
e-value: 1000.0
score: 4.9
coord: 469..498
e-value: 8.3E-4
score: 28.6
coord: 735..764
e-value: 2.3E-6
score: 37.1
coord: 535..564
e-value: 3.9E-5
score: 33.1
coord: 142..170
e-value: 1.6
score: 17.8
coord: 76..105
e-value: 1.5E-5
score: 34.5
coord: 370..399
e-value: 1.1E-5
score: 34.9
coord: 403..432
e-value: 0.0011
score: 28.3
coord: 667..696
e-value: 3.2
score: 16.7
coord: 238..267
e-value: 0.001
score: 28.4
coord: 601..630
e-value: 0.0013
score: 28.0
coord: 171..201
e-value: 0.42
score: 19.7
coord: 337..366
e-value: 0.0017
score: 27.7
coord: 634..663
e-value: 1.6E-5
score: 34.3
coord: 502..531
e-value: 3.1E-4
score: 30.1
coord: 205..234
e-value: 3.7E-5
score: 33.2
IPR002110Ankyrin repeatPFAMPF00023Ankcoord: 437..465
e-value: 0.0015
score: 18.9
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 76..108
score: 14.559
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 109..141
score: 13.411
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 436..468
score: 12.663
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 535..567
score: 11.648
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 337..369
score: 9.511
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 568..600
score: 11.701
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 142..165
score: 9.003
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 205..237
score: 12.983
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 43..75
score: 10.499
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 304..336
score: 9.992
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 667..699
score: 10.446
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 370..402
score: 13.117
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 502..534
score: 12.796
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 634..666
score: 12.983
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 735..767
score: 15.013
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 271..303
score: 12.716
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 601..633
score: 12.396
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 403..435
score: 12.022
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 238..270
score: 11.701
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 469..501
score: 12.876
IPR000906ZU5 domainSMARTSM00218zu_1coord: 1068..1172
e-value: 1.3E-27
score: 107.8
IPR000906ZU5 domainPFAMPF00791ZU5coord: 1072..1169
e-value: 2.2E-20
score: 72.8
IPR000906ZU5 domainPROSITEPS51145ZU5coord: 1070..1225
score: 13.865
IPR000906ZU5 domainPROSITEPS51145ZU5coord: 1227..1373
score: 12.129
IPR000488Death domainPFAMPF00531Deathcoord: 1568..1643
e-value: 3.4E-9
score: 36.7
IPR000488Death domainPROSITEPS50017DEATH_DOMAINcoord: 1564..1641
score: 14.444
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 467..569
e-value: 2.8E-31
score: 110.3
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 289..466
e-value: 2.9E-51
score: 176.0
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 1..288
e-value: 4.4E-98
score: 330.4
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 570..680
e-value: 8.1E-35
score: 121.8
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 681..840
e-value: 3.3E-30
score: 107.2
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 405..801
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 45..423
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 1067..1224
e-value: 5.7E-59
score: 200.3
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 1559..1648
e-value: 6.5E-15
score: 57.0
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 1225..1390
e-value: 2.8E-75
score: 253.4
NoneNo IPR availableGENE3DG3DSA:2.60.40.2660coord: 1391..1558
e-value: 1.3E-47
score: 163.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 814..841
NoneNo IPR availablePANTHERPTHR24133:SF33ANKYRIN, ISOFORM Bcoord: 10..1654
NoneNo IPR availablePANTHERPTHR24133FAMILY NOT NAMEDcoord: 10..1654
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 481..565
e-value: 8.8E-14
score: 51.9
coord: 271..334
e-value: 2.3E-8
score: 34.5
coord: 573..664
e-value: 4.4E-16
score: 59.2
coord: 342..432
e-value: 1.4E-15
score: 57.6
coord: 17..106
e-value: 5.5E-15
score: 55.7
coord: 109..165
e-value: 1.1E-10
score: 41.9
coord: 672..766
e-value: 7.7E-16
score: 58.5
coord: 176..265
e-value: 1.3E-16
score: 61.0
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 1..788
score: 227.445
IPR040745Ankyrin, UPA domainPFAMPF17809UPA_2coord: 1393..1508
e-value: 1.7E-39
score: 134.6
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 1566..1643