Nucleolar protein isoform 2

Overview
NameNucleolar protein isoform 2
Smed IDSMED30026334
Length (bp)2266
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nucleolar protein isoform 2 (SMED30026334) t-SNE clustered cells

Violin plots show distribution of expression levels for Nucleolar protein isoform 2 (SMED30026334) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nucleolar protein isoform 2 (SMED30026334) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nucleolar protein isoform 2 (SMED30026334) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026334

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30026334SMESG000007822.1 dd_Smed_v4_7593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026334SMESG000007822.1 dd_Smed_v4_7593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026334SMESG000007822.1 dd_Smed_v4_7593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026334SMESG000007822.1 dd_Smed_v4_7593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026334SMESG000007822.1 dd_Smed_v4_7593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026334SMESG000007822.1 dd_Smed_v4_7593_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026334SMESG000007822.1 Contig35189uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026334SMESG000007822.1 Contig35189newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymaSMED30026334SMESG000007822.1 dd_7593dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4L (nucleolar protein 4 like [Source:HGNC Symbol;Acc:HGNC:16106])

HSP 1 Score: 69.3218 bits (168), Expect = 1.060e-11
Identity = 45/124 (36.29%), Postives = 62/124 (50.00%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDK 1604
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG    + TP H+ S  A  I   A      E E    AK  + +I Q    +P  +DK
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAAC-----ESETRKAAKRMRLEIYQSSQDEPIALDK 304          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4L (nucleolar protein 4 like [Source:HGNC Symbol;Acc:HGNC:16106])

HSP 1 Score: 68.9366 bits (167), Expect = 1.077e-11
Identity = 45/124 (36.29%), Postives = 62/124 (50.00%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDK 1604
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG    + TP H+ S  A  I   A      E E    AK  + +I Q    +P  +DK
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAAC-----ESETRKAAKRMRLEIYQSSQDEPIALDK 304          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4L (nucleolar protein 4 like [Source:HGNC Symbol;Acc:HGNC:16106])

HSP 1 Score: 68.5514 bits (166), Expect = 2.798e-11
Identity = 45/124 (36.29%), Postives = 62/124 (50.00%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDK 1604
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG    + TP H+ S  A  I   A      E E    AK  + +I Q    +P  +DK
Sbjct:  433 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAAC-----ESETRKAAKRMRLEIYQSSQDEPIALDK 548          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4 (nucleolar protein 4 [Source:HGNC Symbol;Acc:HGNC:7870])

HSP 1 Score: 61.2326 bits (147), Expect = 3.119e-9
Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR +   +QPK  I ++ + C   F  + + R R +IR YLK+CRR   K +G    +  PSH+ S  A +I
Sbjct:  125 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEY-QERARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESI 207          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Match: NOL4 (nucleolar protein 4 [Source:HGNC Symbol;Acc:HGNC:7870])

HSP 1 Score: 61.2326 bits (147), Expect = 4.823e-9
Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR +   +QPK  I ++ + C   F  + + R R +IR YLK+CRR   K +G    +  PSH+ S  A +I
Sbjct:  336 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEY-QERARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESI 418          

HSP 2 Score: 51.2174 bits (121), Expect = 5.657e-6
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 3
Query:  456 IRRIVVLEEFFDLIKSLHERPNKDG-----YNGQKKLFNMIKNRYACLPRDAVDKYI 611
            +RR+ V+E+FFD+I S+H     +G     + GQK+ +  I   YA LPR+AV +++
Sbjct:   25 LRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFL 81          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Fly
Match: CG46301 (gene:FBgn0283651 transcript:FBtr0445729)

HSP 1 Score: 73.559 bits (179), Expect = 3.463e-13
Identity = 39/88 (44.32%), Postives = 55/88 (62.50%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSF-DKSRHRIKIRGYLKACRRNSKKHNG-KVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR I   +QPK  I ++ + CA  F  F D+SR R  IR YLK+CRRN K  +G + + + TP+H+ S +A  I
Sbjct:  192 AFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEFSDRSRKR--IRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQI 277          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Fly
Match: CG46301 (gene:FBgn0283651 transcript:FBtr0445730)

HSP 1 Score: 73.9442 bits (180), Expect = 4.468e-13
Identity = 39/88 (44.32%), Postives = 55/88 (62.50%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSF-DKSRHRIKIRGYLKACRRNSKKHNG-KVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR I   +QPK  I ++ + CA  F  F D+SR R  IR YLK+CRRN K  +G + + + TP+H+ S +A  I
Sbjct:  793 AFNMFVRLFVDENLDRIIPISKQPKEKIQAIIDSCARQFPEFSDRSRKR--IRTYLKSCRRNKKTRDGWENTTRPTPAHLTSVQAEQI 878          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Zebrafish
Match: nol4lb (nucleolar protein 4-like b [Source:ZFIN;Acc:ZDB-GENE-070112-1702])

HSP 1 Score: 65.855 bits (159), Expect = 8.635e-11
Identity = 45/125 (36.00%), Postives = 65/125 (52.00%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDKS 1607
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG +  + TP H+ S  A  I   A      E E+   AK  + D+ Q    +P  +DK+
Sbjct:  212 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNG-METRPTPPHLTSAMAENILAAAC-----ESESRKAAKRMRMDVYQAH-EEPVSLDKA 326          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Zebrafish
Match: nol4la (nucleolar protein 4-like a [Source:ZFIN;Acc:ZDB-GENE-081105-118])

HSP 1 Score: 65.0846 bits (157), Expect = 2.374e-10
Identity = 43/113 (38.05%), Postives = 57/113 (50.44%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQ 1571
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR  K   G    + TP H+ S  A  I   A    E E  N   AK  + DI Q
Sbjct:  450 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERSRKRIRTYLKSCRRMKK---GGFESRPTPPHLTSAMAENILAAA---CESETRN--AAKRMRLDIYQ 553          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Match: nol4l (nucleolar protein 4-like [Source:NCBI gene;Acc:100494288])

HSP 1 Score: 67.0106 bits (162), Expect = 4.396e-11
Identity = 40/125 (32.00%), Postives = 62/125 (49.60%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDKS 1607
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG    + TP H+ S  A  I   A +   ++    +  +  ++  +   L KP    +S
Sbjct:  177 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNGMEMARPTPPHLTSAMAENILAAACESESRKAAKRMRLEVYQASQDDISLEKPTGTTQS 298          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Match: nol4l (nucleolar protein 4-like [Source:NCBI gene;Acc:100494288])

HSP 1 Score: 67.0106 bits (162), Expect = 4.976e-11
Identity = 40/125 (32.00%), Postives = 62/125 (49.60%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDKS 1607
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG    + TP H+ S  A  I   A +   ++    +  +  ++  +   L KP    +S
Sbjct:  181 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNGMEMARPTPPHLTSAMAENILAAACESESRKAAKRMRLEVYQASQDDISLEKPTGTTQS 302          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Match: NOL4 (nucleolar protein 4 [Source:NCBI gene;Acc:100494971])

HSP 1 Score: 62.7734 bits (151), Expect = 1.507e-9
Identity = 51/146 (34.93%), Postives = 70/146 (47.95%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEI---DKS-KTDAQYLDYIESAMSST 1658
            A+N+FVR  +D  LDR +   +QPK  I ++ + C   F  + + R R +IR YLK+CRR   K +G    +  PSH+ S  A TI   A    E E  N            +  L +  E    DKS K D   + Y  SA+SST
Sbjct:  383 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEY-QERARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAETILASA---CESESRNA---------AKRMRLDRQDETPPADKSHKQDTAQVTYSTSAVSST 513          

HSP 2 Score: 51.6026 bits (122), Expect = 4.158e-6
Identity = 26/76 (34.21%), Postives = 41/76 (53.95%), Query Frame = 3
Query:  399 KIHLWTKKTFSSSAKNLGIIRRIVVLEEFFDLIKSLHERPNKDG-----YNGQKKLFNMIKNRYACLPRDAVDKYI 611
            K   W     + SA     +RR+ V+E+FFD+I S+H     +G     + GQK+ +  I   YA LPR+AV +++
Sbjct:   52 KFKFWVLGYQNISAYQKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISETYAFLPREAVTRFL 127          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Match: NOL4 (nucleolar protein 4 [Source:NCBI gene;Acc:100494971])

HSP 1 Score: 51.9878 bits (123), Expect = 2.953e-6
Identity = 26/76 (34.21%), Postives = 41/76 (53.95%), Query Frame = 3
Query:  399 KIHLWTKKTFSSSAKNLGIIRRIVVLEEFFDLIKSLHERPNKDG-----YNGQKKLFNMIKNRYACLPRDAVDKYI 611
            K   W     + SA     +RR+ V+E+FFD+I S+H     +G     + GQK+ +  I   YA LPR+AV +++
Sbjct:   52 KFKFWVLGYQNISAYQKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISETYAFLPREAVTRFL 127          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Match: NOL4 (nucleolar protein 4 [Source:NCBI gene;Acc:100494971])

HSP 1 Score: 51.9878 bits (123), Expect = 3.052e-6
Identity = 26/76 (34.21%), Postives = 41/76 (53.95%), Query Frame = 3
Query:  399 KIHLWTKKTFSSSAKNLGIIRRIVVLEEFFDLIKSLHERPNKDG-----YNGQKKLFNMIKNRYACLPRDAVDKYI 611
            K   W     + SA     +RR+ V+E+FFD+I S+H     +G     + GQK+ +  I   YA LPR+AV +++
Sbjct:   52 KFKFWVLGYQNISAYQKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISETYAFLPREAVTRFL 127          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4l (nucleolar protein 4-like [Source:MGI Symbol;Acc:MGI:1918765])

HSP 1 Score: 69.707 bits (169), Expect = 5.973e-12
Identity = 45/124 (36.29%), Postives = 62/124 (50.00%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDK 1604
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG    + TP H+ S  A  I   A      E E    AK  + +I Q    +P  +DK
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAAC-----ESETRKAAKRMRLEIYQSSQEEPIALDK 304          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4l (nucleolar protein 4-like [Source:MGI Symbol;Acc:MGI:1918765])

HSP 1 Score: 68.9366 bits (167), Expect = 1.776e-11
Identity = 45/124 (36.29%), Postives = 62/124 (50.00%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDK 1604
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG    + TP H+ S  A  I   A      E E    AK  + +I Q    +P  +DK
Sbjct:  433 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAAC-----ESETRKAAKRMRLEIYQSSQEEPIALDK 548          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4 (nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:2441684])

HSP 1 Score: 61.6178 bits (148), Expect = 2.132e-9
Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR +   +QPK  I ++ + C   F  + + R R +IR YLK+CRR   K +G    +  PSH+ S  A +I
Sbjct:  192 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEY-QERARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESI 274          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4 (nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:2441684])

HSP 1 Score: 61.2326 bits (147), Expect = 3.144e-9
Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR +   +QPK  I ++ + C   F  + + R R +IR YLK+CRR   K +G    +  PSH+ S  A +I
Sbjct:  337 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEY-QERARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESI 419          

HSP 2 Score: 51.6026 bits (122), Expect = 3.564e-6
Identity = 22/57 (38.60%), Postives = 36/57 (63.16%), Query Frame = 3
Query:  456 IRRIVVLEEFFDLIKSLHERPNKDG-----YNGQKKLFNMIKNRYACLPRDAVDKYI 611
            +RR+ V+E+FFD+I S+H     +G     + GQK+ +  I   YA LPR+AV +++
Sbjct:   26 LRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFL 82          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Match: Nol4 (nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:2441684])

HSP 1 Score: 60.8474 bits (146), Expect = 4.271e-9
Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR +   +QPK  I ++ + C   F  + + R R +IR YLK+CRR   K +G    +  PSH+ S  A +I
Sbjct:  410 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEY-QERARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESI 492          

HSP 2 Score: 54.299 bits (129), Expect = 5.345e-7
Identity = 42/157 (26.75%), Postives = 69/157 (43.95%), Query Frame = 3
Query:  180 DFRTEFDSSIFKEFGPHSNSKCFTDEKRKEYIEKLLVADISRELPK-------QLRGFSLGDSHTNWEPAEWRFRSKSVDKIHLWTKKTFSSSAKNLGI-IRRIVVLEEFFDLIKSLHERPNKDG-----YNGQKKLFNMIKNRYACLPRDAVDKYI 611
            D   +F     + +G    +K  T  K+ E I +LL    S            + +GF LG      +P E R       ++     KT      +  + +RR+ V+E+FFD+I S+H     +G     + GQK+ +  I   YA LPR+AV +++
Sbjct:    6 DMYRQFQDWCLRTYGDSGKTKTVT-RKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLG------QPDEVRGGGGGAKQVLFVRVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFL 155          
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Match: sp|Q6DIB4|NOL4L_MOUSE (Nucleolar protein 4-like OS=Mus musculus OX=10090 GN=Nol4l PE=2 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 3.727e-11
Identity = 45/124 (36.29%), Postives = 62/124 (50.00%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDK 1604
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG    + TP H+ S  A  I   A      E E    AK  + +I Q    +P  +DK
Sbjct:  248 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAAC-----ESETRKAAKRMRLEIYQSSQEEPIALDK 363          
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Match: sp|Q96MY1|NOL4L_HUMAN (Nucleolar protein 4-like OS=Homo sapiens OX=9606 GN=NOL4L PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 5.092e-11
Identity = 45/124 (36.29%), Postives = 62/124 (50.00%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDK 1604
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG    + TP H+ S  A  I   A      E E    AK  + +I Q    +P  +DK
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAAC-----ESETRKAAKRMRLEIYQSSQDEPIALDK 304          
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Match: sp|Q5RFT9|NOL4L_PONAB (Nucleolar protein 4-like OS=Pongo abelii OX=9601 GN=NOL4L PE=2 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 4.242e-10
Identity = 44/124 (35.48%), Postives = 61/124 (49.19%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDK 1604
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR Y K+CRR   K NG    + TP H+ S  A  I   A      E E    AK  + +I Q    +P  +DK
Sbjct:  189 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYHKSCRR--MKKNGMEMTRPTPPHLTSAMAENILAAAC-----ESETRKAAKRMRLEIYQSSQDEPIALDK 304          
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Match: sp|O94818|NOL4_HUMAN (Nucleolar protein 4 OS=Homo sapiens OX=9606 GN=NOL4 PE=1 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 3.043e-8
Identity = 33/86 (38.37%), Postives = 49/86 (56.98%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR +   +QPK  I ++ + C   F  + + R R +IR YLK+CRR   K +G    +  PSH+ S  A +I
Sbjct:  410 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEY-QERARKRIRTYLKSCRR--MKRSGFEMSRPIPSHLTSAVAESI 492          

HSP 2 Score: 53.9138 bits (128), Expect = 4.718e-6
Identity = 42/157 (26.75%), Postives = 69/157 (43.95%), Query Frame = 3
Query:  180 DFRTEFDSSIFKEFGPHSNSKCFTDEKRKEYIEKLLVADISRELPK-------QLRGFSLGDSHTNWEPAEWRFRSKSVDKI-HLWTKKTFSSSAKNLGIIRRIVVLEEFFDLIKSLHERPNKDG-----YNGQKKLFNMIKNRYACLPRDAVDKYI 611
            D   +F     + +G    +K  T  K+ E I +LL    S            + +GF LG      +P E R       ++ ++  K T          +RR+ V+E+FFD+I S+H     +G     + GQK+ +  I   YA LPR+AV +++
Sbjct:    6 DMYRQFQDWCLRTYGDSGKTKTVT-RKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLG------QPDEVRGGGGGAKQVLYVPVKTTDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFL 155          
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Match: sp|P60954|NOL4_MOUSE (Nucleolar protein 4 OS=Mus musculus OX=10090 GN=Nol4 PE=2 SV=2)

HSP 1 Score: 53.9138 bits (128), Expect = 3.883e-6
Identity = 43/161 (26.71%), Postives = 70/161 (43.48%), Query Frame = 3
Query:  180 DFRTEFDSSIFKEFGPHSNSKCFTDEKRKEYIEKLLVADISRELPK-------QLRGFSLGDSHTNWEPAEWRFRSKSVDKIHLWTKKTFSSSAKNLGI-----IRRIVVLEEFFDLIKSLHERPNKDG-----YNGQKKLFNMIKNRYACLPRDAVDKYI 611
            D   +F     + +G    +K  T  K+ E I +LL    S            + +GF LG      +P E R       ++     KT       +G+     +RR+ V+E+FFD+I S+H     +G     + GQK+ +  I   YA LPR+AV +++
Sbjct:    6 DMYRQFQDWCLRTYGDSGKTKTVT-RKKYERIVQLLNGSESSSTDNAKFKFWVKSKGFQLG------QPDEVRGGGGGAKQVLFVRVKT----TDGVGVDEKLSLRRVAVVEDFFDIIYSMHVETGPNGEQIRKHAGQKRTYKAISESYAFLPREAVTRFL 155          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: A0A0R3SGV9 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS4160 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.320e-26
Identity = 86/240 (35.83%), Postives = 135/240 (56.25%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQ-----FFLSK----PQEIDKSKTDAQYLDYIESAMSSTSLEPQYPNSSNTAWADNEHFSSMLANFLPSLYGMIPLPPLLTLNVSGVSGDGVSPPPAHINPHFNS-----IPSSLFYVMD-GCSLYSA 1907
            AYN FVRK++D TLDRTITFCEQP+  ISSLE IC++A+   +  RHR +IR YLKACRRNSKK+ G+++MK+ P +  S +A  I   A   V K+IE L      + D+ +      F +K    P  +   +T +   ++    +S+TS      +++ T+    +HFS   +N L +L     +PP+ +L+ S +    +   P  ++P + S     +PSSL +  + G +L+S+
Sbjct:  184 AYNNFVRKVVDETLDRTITFCEQPRNAISSLERICSKAWPQLEAKRHRNRIRAYLKACRRNSKKNRGQINMKEPPMNALSAEARQIVASAINLVRKDIEQL------REDLRRDNSPSVFTAKNGTVPHNLRCPETYSNNSNH-HRGISTTSTNSSLHSNAKTSIFTEDHFSLSKSNSLQNL-----IPPIPSLSKSSIE-KSLQSTPTWLDPQYFSALMRFLPSSLQFNKNLGVNLFSS 410          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: A0A564Y3V0 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS2809 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.610e-26
Identity = 86/240 (35.83%), Postives = 135/240 (56.25%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQ-----FFLSK----PQEIDKSKTDAQYLDYIESAMSSTSLEPQYPNSSNTAWADNEHFSSMLANFLPSLYGMIPLPPLLTLNVSGVSGDGVSPPPAHINPHFNS-----IPSSLFYVMD-GCSLYSA 1907
            AYN FVRK++D TLDRTITFCEQP+  ISSLE IC++A+   +  RHR +IR YLKACRRNSKK+ G+++MK+ P +  S +A  I   A   V K+IE L      + D+ +      F +K    P  +   +T +   ++    +S+TS      +++ T+    +HFS   +N L +L     +PP+ +L+ S +    +   P  ++P + S     +PSSL +  + G +L+S+
Sbjct:  204 AYNNFVRKVVDETLDRTITFCEQPRNAISSLERICSKAWPQLEAKRHRNRIRAYLKACRRNSKKNRGQINMKEPPMNALSAEARQIVASAINLVRKDIEQL------REDLRRDNSPSVFTAKNGTVPHNLRCPETYSNNSNH-HRGISTTSTNSSLHSNAKTSIFTEDHFSLSKSNSLQNL-----IPPIPSLSKSSIE-KSLQSTPTWLDPQYFSALMRFLPSSLQFNKNLGVNLFSS 430          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: A0A183BDP8 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS17333 PE=4 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.415e-25
Identity = 51/101 (50.50%), Postives = 74/101 (73.27%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENL 1535
            AYN FVR+++D TLDRTITFCEQP+  I++LE+ICA+A+   +  RHR +IR YLKACRRNSKK+ G+++MK+ P +  S +A  + + A   V  +++ L
Sbjct:   74 AYNNFVRRIVDDTLDRTITFCEQPRHAITALESICAKAWPRMEMKRHRNRIRAYLKACRRNSKKNKGQINMKEAPMNGLSIEARQLVSNALSLVADDVDQL 174          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: A0A3P7C871 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS3890 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.442e-25
Identity = 60/115 (52.17%), Postives = 79/115 (68.70%), Query Frame = 3
Query: 1191 QKMNGLKKPTDIDMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENL 1535
            Q+  G+  P  +  AYN FVRKL+D TLDRTITFCEQP+  IS+LE ICA+A+   +  RHR +IR YLKACRRNSKK+ G+++MK+ P +  S +A  +   A   V K+IE L
Sbjct:  211 QEEAGIIGPELLIAAYNNFVRKLVDETLDRTITFCEQPRHAISALERICAKAWPQLESKRHRNRIRAYLKACRRNSKKNRGQINMKEPPLNGLSVEARQMVVFALNLVTKDIEQL 325          
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Match: A0A183SI42 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.509e-25
Identity = 60/115 (52.17%), Postives = 79/115 (68.70%), Query Frame = 3
Query: 1191 QKMNGLKKPTDIDMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENL 1535
            Q+  G+  P  +  AYN FVRKL+D TLDRTITFCEQP+  IS+LE ICA+A+   +  RHR +IR YLKACRRNSKK+ G+++MK+ P +  S +A  +   A   V K+IE L
Sbjct:  211 QEEAGIIGPELLIAAYNNFVRKLVDETLDRTITFCEQPRHAISALERICAKAWPQLESKRHRNRIRAYLKACRRNSKKNRGQINMKEPPLNGLSVEARQMVVFALNLVTKDIEQL 325          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Cavefish
Match: nol4la (nucleolar protein 4-like [Source:NCBI gene;Acc:103039117])

HSP 1 Score: 65.4698 bits (158), Expect = 1.635e-10
Identity = 43/113 (38.05%), Postives = 57/113 (50.44%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQ 1571
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR  K   G    + TP H+ S  A  I   A    E E  N   AK  + DI Q
Sbjct:  468 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRRMKK---GGFETRPTPPHLTSAMAENILAAA---CESETRN--AAKRMRLDIYQ 571          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Cavefish
Match: nol4lb (nucleolar protein 4 like [Source:NCBI gene;Acc:103032141])

HSP 1 Score: 64.6994 bits (156), Expect = 2.504e-10
Identity = 43/113 (38.05%), Postives = 59/113 (52.21%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQ 1571
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG +  + TP H+ S  A  I   A    E E  N   AK  + D+ Q
Sbjct:  463 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERARKRIRTYLKSCRR--MKKNG-METRPTPPHLTSAMAENILAAA---CESETRN--AAKRMRMDVYQ 566          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Medaka
Match: nol4lb (nucleolar protein 4-like [Source:NCBI gene;Acc:101169180])

HSP 1 Score: 65.4698 bits (158), Expect = 1.044e-10
Identity = 35/86 (40.70%), Postives = 49/86 (56.98%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG +  + TP H+ S  A  I
Sbjct:  246 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNG-METRPTPPHLTSAMAENI 327          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Medaka
Match: nol4lb (nucleolar protein 4-like [Source:NCBI gene;Acc:101169180])

HSP 1 Score: 65.4698 bits (158), Expect = 1.044e-10
Identity = 35/86 (40.70%), Postives = 49/86 (56.98%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTI 1490
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR   K NG +  + TP H+ S  A  I
Sbjct:  246 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQE-RARKRIRTYLKSCRR--MKKNG-METRPTPPHLTSAMAENI 327          
BLAST of Nucleolar protein isoform 2 vs. Ensembl Medaka
Match: nol4la (nucleolar protein 4-like [Source:NCBI gene;Acc:101174833])

HSP 1 Score: 65.855 bits (159), Expect = 1.208e-10
Identity = 46/125 (36.80%), Postives = 63/125 (50.40%), Query Frame = 3
Query: 1233 AYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDKS 1607
            A+N+FVR  +D  LDR +   +QPK  I ++   C+  F  F + R R +IR YLK+CRR  K   G   ++ TP H+ S  A  I   A    E E  N   AK  + DI      +P  +DKS
Sbjct:  446 AFNMFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEF-QERSRKRIRTYLKSCRRMKK---GGFEIRPTPPHLTSAMAENILAAA---CESETRN--AAKRMRLDIYP-VTEEPITVDKS 560          

HSP 2 Score: 50.0618 bits (118), Expect = 8.656e-6
Identity = 46/170 (27.06%), Postives = 76/170 (44.71%), Query Frame = 3
Query:  183 FRTEFDSSIFKEFGPHSNSKCFTDEKRKEYIEKLLVADISRELPKQLRGFSLGDSHTNWEPAEWRFRSKSVD--------------------KIHLWTKKTFS--SSAKNLGIIRRIVVLEEFFDLIKSLHERPNKD-----GYNGQKKLFNMIKNRYACLPRDAVDKYI 611
            FR EF     + +G    +K  T  K  + ++ LL  D S        G  + +SH N   A+++F  KS                       +++  K T S  +SA+    ++R+ V+E+FFD+I ++H     D      + GQKK +  I   YA LPR+AV +++
Sbjct:   26 FR-EFQDWCLRTYGDSGKTKTVTRRKYNKIMQTLLQNDESD-------GVYVDNSHIN---AKFKFWVKSKGFQVGTNVLGEHNKKGAPGKPVLYVPVKSTCSDGNSAQENCSLKRVAVVEDFFDIIYAMHVEMGADPGRAPKHAGQKKTYKAIAETYAFLPREAVTRFL 184          
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Match: SMESG000007822.1 (SMESG000007822.1)

HSP 1 Score: 1339.71 bits (3466), Expect = 0.000e+0
Identity = 662/662 (100.00%), Postives = 662/662 (100.00%), Query Frame = 3
Query:  129 MLNSNLFSTKTNLPNHIDFRTEFDSSIFKEFGPHSNSKCFTDEKRKEYIEKLLVADISRELPKQLRGFSLGDSHTNWEPAEWRFRSKSVDKIHLWTKKTFSSSAKNLGIIRRIVVLEEFFDLIKSLHERPNKDGYNGQKKLFNMIKNRYACLPRDAVDKYITMWRKATTQLSSYEHDRDGVNSRKTLITAIPGLAPITGIXXXXXXXXXXXXXXXXIQTNSVNKDFHTKTNSVINSKMSIDSMNKFSGISMVYHPQAQTDHKLTHSPLANIKYQFENGENKLLSNDLQEGYFPNSAHKQDSNSSNHGSMKENSFENDDIIPNKRIKLEDGDSETNTENEEILDENSSPTTGDPIQKMNGLKKPTDIDMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDKSKTDAQYLDYIESAMSSTSLEPQYPNSSNTAWADNEHFSSMLANFLPSLYGMIPLPPLLTLNVSGVSGDGVSPPPAHINPHFNSIPSSLFYVMDGCSLYSATSQILEKMLHCNSIDPDFGMQLLLNRSASQEAINCMRITARYLLSRSLMMESFLIKESTKLDILSEEKN 2114
            MLNSNLFSTKTNLPNHIDFRTEFDSSIFKEFGPHSNSKCFTDEKRKEYIEKLLVADISRELPKQLRGFSLGDSHTNWEPAEWRFRSKSVDKIHLWTKKTFSSSAKNLGIIRRIVVLEEFFDLIKSLHERPNKDGYNGQKKLFNMIKNRYACLPRDAVDKYITMWRKATTQLSSYEHDRDGVNSRKTLITAIPGLAPITGISSSTTAALSTMAADLTIQTNSVNKDFHTKTNSVINSKMSIDSMNKFSGISMVYHPQAQTDHKLTHSPLANIKYQFENGENKLLSNDLQEGYFPNSAHKQDSNSSNHGSMKENSFENDDIIPNKRIKLEDGDSETNTENEEILDENSSPTTGDPIQKMNGLKKPTDIDMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDKSKTDAQYLDYIESAMSSTSLEPQYPNSSNTAWADNEHFSSMLANFLPSLYGMIPLPPLLTLNVSGVSGDGVSPPPAHINPHFNSIPSSLFYVMDGCSLYSATSQILEKMLHCNSIDPDFGMQLLLNRSASQEAINCMRITARYLLSRSLMMESFLIKESTKLDILSEEKN
Sbjct:    1 MLNSNLFSTKTNLPNHIDFRTEFDSSIFKEFGPHSNSKCFTDEKRKEYIEKLLVADISRELPKQLRGFSLGDSHTNWEPAEWRFRSKSVDKIHLWTKKTFSSSAKNLGIIRRIVVLEEFFDLIKSLHERPNKDGYNGQKKLFNMIKNRYACLPRDAVDKYITMWRKATTQLSSYEHDRDGVNSRKTLITAIPGLAPITGISSSTTAALSTMAADLTIQTNSVNKDFHTKTNSVINSKMSIDSMNKFSGISMVYHPQAQTDHKLTHSPLANIKYQFENGENKLLSNDLQEGYFPNSAHKQDSNSSNHGSMKENSFENDDIIPNKRIKLEDGDSETNTENEEILDENSSPTTGDPIQKMNGLKKPTDIDMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDKSKTDAQYLDYIESAMSSTSLEPQYPNSSNTAWADNEHFSSMLANFLPSLYGMIPLPPLLTLNVSGVSGDGVSPPPAHINPHFNSIPSSLFYVMDGCSLYSATSQILEKMLHCNSIDPDFGMQLLLNRSASQEAINCMRITARYLLSRSLMMESFLIKESTKLDILSEEKN 662          
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Match: SMESG000009276.1 (SMESG000009276.1)

HSP 1 Score: 297.36 bits (760), Expect = 2.954e-93
Identity = 173/334 (51.80%), Postives = 230/334 (68.86%), Query Frame = 3
Query: 1095 KRIKLEDGDSETNTENEEILDENSSPTTGDPIQKMNGLKKPTDIDMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEID--KSKTDAQYLDYIESAMSSTS-LEPQYPNSSNTAWADNEHFSSMLANFLPSLYGMIPLPPLLTLNVSGVSGDGVSPPPAHINPHFNSIPSSLFYVMDGCSLYSATSQILEKMLHCNSIDPDFGMQLLLNRSASQEAINCMRITARYLLSRSLMMESFLIKESTK 2087
            K+ KLE   SE   EN E  + N  P   +  +     KKPTD DMAYNIFVR+++D TLDRT+TFCEQPK +ISSLE+IC+ AF + DK RHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS+KA+ +ANEA  ++ KE++ L LAK G+S+ N   +S+    D  + + D + L+ I    SS S  +  Y     T+ +DN+ FS+ L+  +P  YG++P PP+L  ++ G+ G G +PPPAH     NSI    F ++   +   AT+ +LEKMLHC SIDPDFG +LL N+ A+QE+I+CMR+ AR+LL+RSL+MES+LI+E  K
Sbjct:   79 KKPKLE---SEFGIENGENFETNIIPCNINGAKVTGSTKKPTDTDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILKLAKLGRSE-NPDSVSQGNSSDDGRPEIDLKSLECIVDNDSSPSNSDFNYLKYPITSSSDNDPFSAALSGLVPPPYGILPPPPILPSSIPGLPGRGCTPPPAHC----NSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNKLAAQESISCMRVMARFLLNRSLIMESYLIREMHK 404          
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Match: SMESG000009276.1 (SMESG000009276.1)

HSP 1 Score: 297.36 bits (760), Expect = 4.135e-93
Identity = 172/331 (51.96%), Postives = 229/331 (69.18%), Query Frame = 3
Query: 1095 KRIKLEDGDSETNTENEEILDENSSPTTGDPIQKMNGLKKPTDIDMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEID--KSKTDAQYLDYIESAMSSTS-LEPQYPNSSNTAWADNEHFSSMLANFLPSLYGMIPLPPLLTLNVSGVSGDGVSPPPAHINPHFNSIPSSLFYVMDGCSLYSATSQILEKMLHCNSIDPDFGMQLLLNRSASQEAINCMRITARYLLSRSLMMESFLIKE 2078
            K+ KLE   SE   EN E  + N  P   +  +     KKPTD DMAYNIFVR+++D TLDRT+TFCEQPK +ISSLE+IC+ AF + DK RHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCS+KA+ +ANEA  ++ KE++ L LAK G+S+ N   +S+    D  + + D + L+ I    SS S  +  Y     T+ +DN+ FS+ L+  +P  YG++P PP+L  ++ G+ G G +PPPAH     NSI    F ++   +   AT+ +LEKMLHC SIDPDFG +LL N+ A+QE+I+CMR+ AR+LL+RSL+MES+LI+E
Sbjct:   88 KKPKLE---SEFGIENGENFETNIIPCNINGAKVTGSTKKPTDTDMAYNIFVRRVVDDTLDRTVTFCEQPKDIISSLEDICSTAFPTLDKGRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSEKAFAMANEALSRINKELQILKLAKLGRSE-NPDSVSQGNSSDDGRPEIDLKSLECIVDNDSSPSNSDFNYLKYPITSSSDNDPFSAALSGLVPPPYGILPPPPILPSSIPGLPGRGCTPPPAHC----NSIHFGPFSLLGSTAQQPATNMLLEKMLHCTSIDPDFGYELLRNKLAAQESISCMRVMARFLLNRSLIMESYLIRE 410          
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Match: SMESG000051494.1 (SMESG000051494.1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.995e-21
Identity = 55/156 (35.26%), Postives = 95/156 (60.90%), Query Frame = 3
Query: 1227 DMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLENICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDKAYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDKSKTDAQYLDYIESAMSSTSLEPQYPNSSNT 1694
            ++AYN+ +R++ID  LDR + F  QPK +++ +  I    F  +++S+HR K+R YLKACRRNSKK+NG++ MK+T +++ S     + ++ +   EKE  ++I     K +  +F L++  +I +S  +A     I S+MS  + + Q  N +NT
Sbjct:  181 EIAYNLLLRRIIDEALDRNVIFSHQPKELLNLINTILVRQFPEYEESKHRSKVRSYLKACRRNSKKNNGRILMKNTAAYLSSGPGNRLMHQIYNN-EKETIDII-----KKESERFKLTQNGKISQSHLEAP----IVSSMSVLNNQQQILNITNT 326          
The following BLAST results are available for this feature:
BLAST of Nucleolar protein isoform 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NOL4L1.060e-1136.29nucleolar protein 4 like [Source:HGNC Symbol;Acc:H... [more]
NOL4L1.077e-1136.29nucleolar protein 4 like [Source:HGNC Symbol;Acc:H... [more]
NOL4L2.798e-1136.29nucleolar protein 4 like [Source:HGNC Symbol;Acc:H... [more]
NOL43.119e-938.37nucleolar protein 4 [Source:HGNC Symbol;Acc:HGNC:7... [more]
NOL44.823e-938.37nucleolar protein 4 [Source:HGNC Symbol;Acc:HGNC:7... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG463013.463e-1344.32gene:FBgn0283651 transcript:FBtr0445729[more]
CG463014.468e-1344.32gene:FBgn0283651 transcript:FBtr0445730[more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nol4lb8.635e-1136.00nucleolar protein 4-like b [Source:ZFIN;Acc:ZDB-GE... [more]
nol4la2.374e-1038.05nucleolar protein 4-like a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nol4l4.396e-1132.00nucleolar protein 4-like [Source:NCBI gene;Acc:100... [more]
nol4l4.976e-1132.00nucleolar protein 4-like [Source:NCBI gene;Acc:100... [more]
NOL41.507e-934.93nucleolar protein 4 [Source:NCBI gene;Acc:10049497... [more]
NOL42.953e-634.21nucleolar protein 4 [Source:NCBI gene;Acc:10049497... [more]
NOL43.052e-634.21nucleolar protein 4 [Source:NCBI gene;Acc:10049497... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nol4l5.973e-1236.29nucleolar protein 4-like [Source:MGI Symbol;Acc:MG... [more]
Nol4l1.776e-1136.29nucleolar protein 4-like [Source:MGI Symbol;Acc:MG... [more]
Nol42.132e-938.37nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:244... [more]
Nol43.144e-938.37nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:244... [more]
Nol44.271e-938.37nucleolar protein 4 [Source:MGI Symbol;Acc:MGI:244... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DIB4|NOL4L_MOUSE3.727e-1136.29Nucleolar protein 4-like OS=Mus musculus OX=10090 ... [more]
sp|Q96MY1|NOL4L_HUMAN5.092e-1136.29Nucleolar protein 4-like OS=Homo sapiens OX=9606 G... [more]
sp|Q5RFT9|NOL4L_PONAB4.242e-1035.48Nucleolar protein 4-like OS=Pongo abelii OX=9601 G... [more]
sp|O94818|NOL4_HUMAN3.043e-838.37Nucleolar protein 4 OS=Homo sapiens OX=9606 GN=NOL... [more]
sp|P60954|NOL4_MOUSE3.883e-626.71Nucleolar protein 4 OS=Mus musculus OX=10090 GN=No... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3SGV91.320e-2635.83Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A564Y3V01.610e-2635.83Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A183BDP81.415e-2550.50Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A3P7C8712.442e-2552.17Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A183SI422.509e-2552.17Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nol4la1.635e-1038.05nucleolar protein 4-like [Source:NCBI gene;Acc:103... [more]
nol4lb2.504e-1038.05nucleolar protein 4 like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nucleolar protein isoform 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nol4lb1.044e-1040.70nucleolar protein 4-like [Source:NCBI gene;Acc:101... [more]
nol4lb1.044e-1040.70nucleolar protein 4-like [Source:NCBI gene;Acc:101... [more]
nol4la1.208e-1036.80nucleolar protein 4-like [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Nucleolar protein isoform 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000007822.10.000e+0100.00SMESG000007822.1[more]
SMESG000009276.12.954e-9351.80SMESG000009276.1[more]
SMESG000009276.14.135e-9351.96SMESG000009276.1[more]
SMESG000051494.11.995e-2135.26SMESG000051494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026334 ID=SMED30026334|Name=Nucleolar protein isoform 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2266bp
CTGTGTACTAGCGCAAACGTCGCGTGGTGGGAATTGAGTGTTGTAGCATA
CATAAATGCAGTCTCATTTTAGATTGCTCTATTTGTATTACTTACTATTC
CATTGCAGAATTTTCGAACGAAATTCAAATGCTCAATTCTAATTTATTTT
CTACGAAAACCAATTTGCCGAATCATATCGATTTCAGAACCGAATTTGAT
TCTTCGATTTTCAAAGAATTCGGACCTCATAGCAATTCGAAATGTTTCAC
AGATGAAAAACGAAAAGAATACATTGAAAAATTGTTAGTTGCAGACATTT
CTCGTGAGTTACCCAAACAATTGCGTGGATTTTCACTAGGGGATTCTCAC
ACGAATTGGGAACCAGCCGAATGGAGATTTCGTTCGAAAAGTGTCGATAA
AATTCATCTCTGGACAAAGAAGACATTTTCGTCTTCTGCTAAAAATCTCG
GCATAATTCGTCGAATTGTGGTGCTGGAAGAATTTTTCGATTTGATTAAA
TCTCTCCACGAACGACCGAACAAAGATGGATATAATGGACAGAAAAAACT
GTTTAATATGATTAAAAATCGATACGCCTGCCTGCCGCGTGACGCAGTTG
ACAAATATATCACAATGTGGCGCAAAGCCACCACACAATTGTCGTCTTAC
GAACACGACCGAGATGGAGTTAATTCACGCAAAACACTGATAACAGCGAT
TCCAGGACTAGCGCCAATAACAGGAATATCATCATCAACAACCGCGGCCC
TGTCTACAATGGCGGCGGACTTAACAATACAGACGAATTCTGTTAATAAA
GACTTCCATACGAAGACAAATTCGGTTATCAACTCCAAAATGTCAATTGA
CTCCATGAATAAGTTCTCAGGAATTTCAATGGTCTATCATCCGCAAGCGC
AAACCGATCACAAGTTGACTCACTCGCCTCTCGCCAATATAAAATATCAA
TTTGAAAACGGAGAAAACAAATTGCTGTCGAACGATTTACAAGAGGGATA
TTTTCCAAATTCTGCTCACAAACAAGATAGCAACAGTTCCAATCACGGAT
CCATGAAGGAAAATAGTTTCGAAAATGATGATATTATTCCCAACAAACGT
ATCAAACTTGAAGATGGAGACTCCGAAACCAATACTGAAAATGAAGAAAT
TCTAGATGAGAACAGTTCCCCTACTACAGGTGATCCAATTCAGAAAATGA
ACGGACTGAAAAAACCGACAGACATTGACATGGCGTACAATATATTCGTT
AGGAAATTAATCGACAGCACCCTTGATAGAACTATCACATTTTGTGAACA
ACCGAAATTAGTAATTTCAAGTCTTGAGAACATATGCGCCGAAGCCTTCC
AATCATTCGACAAATCAAGGCACAGAATAAAAATTCGCGGTTATCTTAAA
GCTTGTCGTAGAAATTCCAAAAAACACAACGGAAAGGTATCAATGAAAGA
CACTCCTTCTCACATGTGCTCGGATAAAGCCTACACAATAGCCAATGAAG
CCTTTCAGAAAGTTGAAAAAGAAATAGAAAATTTAATTTTGGCTAAACCA
GGCAAGTCCGACATAAATCAGTTTTTCTTATCTAAACCACAAGAGATAGA
TAAGTCAAAAACTGATGCACAATATCTCGATTATATAGAGTCAGCAATGA
GCTCCACTAGTTTGGAACCACAATATCCCAACTCAAGCAATACGGCATGG
GCAGATAATGAGCATTTTTCATCAATGCTGGCCAATTTCCTGCCGTCTCT
CTATGGAATGATTCCCTTGCCGCCATTGCTGACACTCAATGTCAGCGGCG
TGTCTGGAGATGGTGTATCCCCACCACCTGCTCACATTAATCCACATTTC
AACTCCATACCTAGTAGTTTGTTTTATGTAATGGATGGATGCAGTCTTTA
CTCAGCAACGAGTCAGATTCTAGAGAAAATGCTCCATTGCAATTCCATAG
ATCCTGACTTCGGAATGCAATTGCTACTTAACAGATCAGCCAGCCAAGAA
GCCATAAATTGTATGCGGATTACTGCTAGATATCTTCTCAGCCGGTCATT
AATGATGGAATCATTTTTGATTAAAGAATCAACTAAACTTGATATTTTAT
CCGAAGAAAAAAATTGATCCAGAGTATAATTTTGTAAAGAGTTATATTGT
GTAAAACCGGGGTTCACGTTATGTTCCAGTTGATTGTATTGTGGTTTTTT
TTTACTAGATAATGAACTGAACAAGATTTAATTATAATATACATATATTG
TGGTATTCGCTACATT
back to top

protein sequence of SMED30026334-orf-1

>SMED30026334-orf-1 ID=SMED30026334-orf-1|Name=SMED30026334-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=663bp
MLNSNLFSTKTNLPNHIDFRTEFDSSIFKEFGPHSNSKCFTDEKRKEYIE
KLLVADISRELPKQLRGFSLGDSHTNWEPAEWRFRSKSVDKIHLWTKKTF
SSSAKNLGIIRRIVVLEEFFDLIKSLHERPNKDGYNGQKKLFNMIKNRYA
CLPRDAVDKYITMWRKATTQLSSYEHDRDGVNSRKTLITAIPGLAPITGI
SSSTTAALSTMAADLTIQTNSVNKDFHTKTNSVINSKMSIDSMNKFSGIS
MVYHPQAQTDHKLTHSPLANIKYQFENGENKLLSNDLQEGYFPNSAHKQD
SNSSNHGSMKENSFENDDIIPNKRIKLEDGDSETNTENEEILDENSSPTT
GDPIQKMNGLKKPTDIDMAYNIFVRKLIDSTLDRTITFCEQPKLVISSLE
NICAEAFQSFDKSRHRIKIRGYLKACRRNSKKHNGKVSMKDTPSHMCSDK
AYTIANEAFQKVEKEIENLILAKPGKSDINQFFLSKPQEIDKSKTDAQYL
DYIESAMSSTSLEPQYPNSSNTAWADNEHFSSMLANFLPSLYGMIPLPPL
LTLNVSGVSGDGVSPPPAHINPHFNSIPSSLFYVMDGCSLYSATSQILEK
MLHCNSIDPDFGMQLLLNRSASQEAINCMRITARYLLSRSLMMESFLIKE
STKLDILSEEKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039788NOL4/NOL4L
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 311..332
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 297..355
NoneNo IPR availablePANTHERPTHR12449:SF23NUCLEOLAR PROTEIN 4-LIKE Acoord: 346..494
NoneNo IPR availablePANTHERPTHR12449:SF23NUCLEOLAR PROTEIN 4-LIKE Acoord: 102..161
IPR039788Nucleolar protein 4 familyPANTHERPTHR12449FAMILY NOT NAMEDcoord: 102..161
IPR039788Nucleolar protein 4 familyPANTHERPTHR12449FAMILY NOT NAMEDcoord: 346..494