Gelsolin-like protein

Overview
NameGelsolin-like protein
Smed IDSMED30026323
Length (bp)1381
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gelsolin-like protein (SMED30026323) t-SNE clustered cells

Violin plots show distribution of expression levels for Gelsolin-like protein (SMED30026323) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gelsolin-like protein (SMED30026323) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gelsolin-like protein (SMED30026323) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026323

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30026323SMESG000015925.1 dd_Smed_v4_1464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026323SMESG000015925.1 dd_Smed_v6_1464_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026323SMESG000015925.1 dd_Smed_v4_1464_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026323SMESG000015925.1 dd_Smed_v4_1464_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 203.371 bits (516), Expect = 7.082e-60
Identity = 115/340 (33.82%), Postives = 192/340 (56.47%), Query Frame = 2
Query:  236 IKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLS-SDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWD-----DDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKD 1228
            + K+SA+ + +     +   P L IWRIE  ++V  P + FG F++GD YIIL I+   + + YD+H+WIG+ S+ DE G AA  T ++D+FL  + VQHREVQ  ESE F+ YF Q L+   GG+ SG +HV T  Y   RLLHV+G K  V+  EV  + ++ N  DVFL D G  I QW G  + + ER  G   A+++   +R G+  + VVD ++  ++      ++  + +  +      D   +P  +    L+ +SD  G L   ++    +++  ++ +D +I+D G  +I+V+ G+K++  E++ A+ +A N++K  +YP +    V+ D
Sbjct:    1 MTKLSAQVKGSL----NITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKG-KRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYPPSTQVEVQND 335          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: AVIL (advillin [Source:HGNC Symbol;Acc:HGNC:14188])

HSP 1 Score: 202.216 bits (513), Expect = 1.119e-56
Identity = 115/318 (36.16%), Postives = 176/318 (55.35%), Query Frame = 2
Query:  290 NHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHE---------KLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIID-NGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQA 1204
            N P + +WRIEK ++   P++  G FY GD Y+IL+     + +  D+HFWIGK S+QDE   AA  T +LD++L   PVQHREVQ++ES+ F+ YF Q +IY  GG+ SG +HV T  Y   RLLHV+G K  +  +EV  +  + N  DVFL D G  I QW G  +N  ER      A+ +   +R G+ KI V++ D  +++      L D +          KP    E          +L+ ISD  G+L   ++    + +  +N DD +I+D +G +I+V+ G+ +++AE+Q A+  A  ++K   YP +
Sbjct:   12 NDPGIIVWRIEKMELALVPVSAHGNFYEGDCYVILSTRRVASLLSQDIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKQGGVASGMKHVETNTYDVKRLLHVKG-KRNIRATEVEMSWDSFNRGDVFLLDLGKVIIQWNGPESNSGERLKAMLLAKDIRDRERGGRAKIGVIEGDKEAASPELMKVLQDTLGR----RSIIKPTVPDEIIDQKQKSTIMLYHISDSAGQLAVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGATKAEKQAAMSKALGFIKMKSYPSS 324          

HSP 2 Score: 126.331 bits (316), Expect = 2.118e-30
Identity = 92/322 (28.57%), Postives = 150/322 (46.58%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSP-RLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWD----------DDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYL---KGTEYPQAPISVVKK 1225
            +WRIE  ++V      +G FY GD Y++L  Y    +  + ++ W G++++QDE   +AY+ VE+D   D   VQ R     E   F + F  +L+   GG     R    +   P RL  + G DK      EV A   +LNS+DVFL  T    + W GKG++ DER   +  A  L                D S N +   +   E +E WD          D +  + + + +  LF  S++TG+    +I   + ++  +N  DV ++D   Q+F++IG +++  E+++AL  A  YL        P  PI ++K+
Sbjct:  399 VWRIENLELVPVEYQWYGFFYGGDCYLVLYTYEVNGKPHHILYIWQGRHASQDELAASAYQAVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTS---RKGNAEPDPPVRLFQIHGNDKSNTKAVEVPAFASSLNSNDVFLLRTQAEHYLWYGKGSSGDERAMAKELASLLC---------------DGSENTVAEGQ---EPAEFWDLLGGKTPYANDKRLQQEILDVQSRLFECSNKTGQFVVTEI--TDFTQDDLNPTDVMLLDTWDQVFLWIGAEANATEKESALATAQQYLHTHPSGRDPDTPILIIKQ 697          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 202.216 bits (513), Expect = 1.511e-56
Identity = 112/320 (35.00%), Postives = 183/320 (57.19%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWD-----DDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKD 1228
            P L IWRIE  ++V  P + FG F++GD YIIL I+   + + YD+H+WIG+ S+ DE G AA  T ++D+FL  + VQHREVQ  ESE F+ YF Q L+   GG+ SG +HV T  Y   RLLHV+G K  V+  EV  + ++ N  DVFL D G  I QW G  + + ER  G   A+++   +R G+  + VVD ++  ++      ++  + +  +      D   +P  +    L+ +SD  G L   ++    +++  ++ +D +I+D G  +I+V+ G+K++  E++ A+ +A N++K  +YP +    V+ D
Sbjct:   17 PGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKG-KRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYPPSTQVEVQND 335          

HSP 2 Score: 121.709 bits (304), Expect = 8.052e-29
Identity = 97/317 (30.60%), Postives = 152/317 (47.95%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKL----LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            E+ +WRIE  ++V       G FY GD Y++L  Y  G +  Y ++ W G  ++QDE   +AY+ V LD   + +PVQ R     E     S F   + +  G  S   ++ T   S RL  V+G       + EV A    LNS+DVF+  T +  + W GKG + DER   +  A  +S     + + +VV E    +N  F+  L  +         + K L E   +    LF  S++TG+    +I   + ++  + EDDVF++D   Q+F +IG+ ++  E++ A   A  YLK       P+ PI VVK+
Sbjct:  399 EVQVWRIENLELVPVDSKWLGHFYGGDCYLLLYTYLIGEKQHYLLYVWQGSQASQDEITASAYQAVILDQKYNGEPVQIRVPMGKEPPHLMSIFKGRMVVYQGGTSRTNNLETGP-STRLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGKGCSGDEREMAKMVADTIS-----RTEKQVVVEGQEPAN--FWMALGGKAPY-----ANTKRLQEENLVITPRLFECSNKTGRFLATEI--PDFNQDDLEEDDVFLLDVWDQVFFWIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQ 700          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 191.43 bits (485), Expect = 4.394e-53
Identity = 109/336 (32.44%), Postives = 188/336 (55.95%), Query Frame = 2
Query:  278 VKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIIL-NIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKE-YSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP-QAPISVVKKDLKGNSAEQFNK 1261
            +K+   P L IWR+EKF +V  P N +G+F+ GD+Y+IL  +  R   + YD+H+W+G   +QDE G AA  TV+LD++L+ + VQHREVQ +ES  F  YF S L Y  GG+ SGF+HV+  E    RL  V+G ++ V  +EV  +  + N+ D F+ D G +I QW G  +N+ ER    + ++ +  ++R+G+ ++ V +E      ++        +    +D             L+++S+  G +    +   N  ++  +  +D FI+D+G+  +IFV+ G++++  ER+ AL  A +++   +YP Q  +SV+ +  +    +QF K
Sbjct:    9 LKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRV-VRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFK 343          

HSP 2 Score: 131.724 bits (330), Expect = 2.859e-32
Identity = 98/319 (30.72%), Postives = 144/319 (45.14%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKKDLKGNS 1243
            IWRIE    V      +G+FY GDSYIIL  Y  G      ++ W G  STQDE   +A  T +LD  L   PVQ R VQ  E     S F     +IY  G    G +   T   S RL  VR +      + EV      LNS+D F+  T +  + W+G GA++ E+   Q   + L   R   V++    E D      F+  L  + +         K +  H   LF  S++ G+   E++  G + +  +  DDV ++D   Q+FV++G+ S   E+  AL  A  Y++        + PI+VVK+  +  S
Sbjct:  398 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQ---TAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVL---RAQPVQVAEGSEPDG-----FWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEV-PGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPS 704          
BLAST of Gelsolin-like protein vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 191.43 bits (485), Expect = 4.928e-53
Identity = 109/336 (32.44%), Postives = 188/336 (55.95%), Query Frame = 2
Query:  278 VKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIIL-NIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKE-YSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP-QAPISVVKKDLKGNSAEQFNK 1261
            +K+   P L IWR+EKF +V  P N +G+F+ GD+Y+IL  +  R   + YD+H+W+G   +QDE G AA  TV+LD++L+ + VQHREVQ +ES  F  YF S L Y  GG+ SGF+HV+  E    RL  V+G ++ V  +EV  +  + N+ D F+ D G +I QW G  +N+ ER    + ++ +  ++R+G+ ++ V +E      ++        +    +D             L+++S+  G +    +   N  ++  +  +D FI+D+G+  +IFV+ G++++  ER+ AL  A +++   +YP Q  +SV+ +  +    +QF K
Sbjct:   17 LKAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRV-VRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHVSEEGTEPEAMLQVLGPKPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVLPEGGETPLFKQFFK 351          

HSP 2 Score: 132.109 bits (331), Expect = 2.580e-32
Identity = 98/319 (30.72%), Postives = 144/319 (45.14%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKKDLKGNS 1243
            IWRIE    V      +G+FY GDSYIIL  Y  G      ++ W G  STQDE   +A  T +LD  L   PVQ R VQ  E     S F     +IY  G    G +   T   S RL  VR +      + EV      LNS+D F+  T +  + W+G GA++ E+   Q   + L   R   V++    E D      F+  L  + +         K +  H   LF  S++ G+   E++  G + +  +  DDV ++D   Q+FV++G+ S   E+  AL  A  Y++        + PI+VVK+  +  S
Sbjct:  406 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSREGGQ---TAPASTRLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVL---RAQPVQVAEGSEPDG-----FWEALGGKAAYRTSPRLKDKKMDAHPPRLFACSNKIGRFVIEEV-PGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVKQGFEPPS 712          
BLAST of Gelsolin-like protein vs. Ensembl Celegans
Match: gsnl-1 (Gelsolin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21253])

HSP 1 Score: 192.2 bits (487), Expect = 1.341e-55
Identity = 125/332 (37.65%), Postives = 187/332 (56.33%), Query Frame = 2
Query:  302 LFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVIT--KEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSS-DRNGKVKIEVVDE---DDSSSNLIFYNKLSD--EISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKG-NISRAQINEDDVFIID--NGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNK 1261
            L +WRI KF +   P    G FY GD+YI L     G    +DVHFW+GK ++ DE G AA KTVE+D+ L   P QHRE+Q+YES LF SYF   I Y++GG ESG+RHV    K + P L H +G K  V  +EV     +LN  DVF+ D G  ++ W+   + + ER  G   A+ ++  +R G  K+ ++D+   D+ S+   ++  +S   ++S+  DDD +Y      +  L+++SD +G  K   + +G NI + Q++  D FI+D  NG  IFV+IG + +  ER  ALI+  NYLK    P+   + V + L+   + QF +
Sbjct:   19 LLVWRINKFVLEPVPEVDHGVFYIGDAYIALYQKYDG---CWDVHFWLGKNASTDEIGVAAIKTVEIDDSLGGIPTQHREIQNYESPLFLSYFPDGIRYVSGGYESGYRHVDDQFKNWKPHLFHCKG-KRNVRCTEVECEVNSLNLGDVFILDLGKDLYVWMPPESGRLERIKGMARAKNIADHERMGIPKVHILDDVEWDNDSTFWSYFGGVSSVRKVSKGKDDDDNYWKRLTEQITLWKVSDASGAAKVSMVSQGENIRKEQLDPKDAFILDAING-GIFVWIGHECTLEERSKALIWGQNYLKQHHLPRW--TQVTRVLESAESTQFTQ 343          

HSP 2 Score: 62.7734 bits (151), Expect = 2.025e-10
Identity = 52/188 (27.66%), Postives = 87/188 (46.28%), Query Frame = 2
Query:  713 KRNLNSDDVFLYDT-GTHIFQWIGKGANKDERYH----GQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNK 1261
            K  L+  D F+ D     IF WIG     +ER      GQ + +Q    R  +V   V++  +S+    ++         DW D+K          LLF++SDE+G L  E+I   N ++  ++ DDV I+D    I+V++G  ++  E++ AL  A  YL+  + P+   + +    +G     F K
Sbjct:  276 KEQLDPKDAFILDAINGGIFVWIGHECTLEERSKALIWGQNYLKQHHLPRWTQV-TRVLESAESTQFTQWF--------RDWVDEKKKNTFT---PLLFQVSDESGLLHVEEIA--NFTQEDLDGDDVMILDALNSIYVWVGANANANEKKEALNTAKLYLEKDKLPRHKKTAIDTIFQGKEPPTFKK 449          
BLAST of Gelsolin-like protein vs. Ensembl Celegans
Match: fli-1 (pep chromosome:WBcel235:III:8675297:8683732:-1 gene:WBGene00001443.1 transcript:B0523.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:fli-1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.018e-18
Identity = 80/341 (23.46%), Postives = 153/341 (44.87%), Query Frame = 2
Query:  302 LFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGN-EILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGG-IESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSS-DRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEH--------EKLLFRISDETGKLKFEKI--GKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAER---QNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVIGG 1273
            +++W IE F          G+FY+ D+Y++L      + ++ + + +W+G++++ D+   +A   V L N L+      RE  + E+E F + F + ++Y+ GG   SGF       +  RL     +   V +  V  +  +L+    FL D G  I+ W G  +        + FA++L+  DR GK +IE   +        F+  L+       + DK    + EH         K L++++   G L+  ++   KG   +  +    VF++D+   IF++IG+K++R  +   Q  ++  H  +   +Y Q     V ++ +G  +  F     G
Sbjct:  510 MWVWEIENFYPSIMDEAFHGQFYDADAYLVLKTTREASGQLRHAIFYWLGEHASLDKGMCSAVHAVGLRNHLNATCRTQREEMNDETEEFLTLFGEEIVYIEGGRTISGFYTTEKPAHLTRLYRAGVNGTAVEMEPVPLSVESLDPRFCFLLDAGETIWIWSGYKSRITVSNKARLFAERLNKRDRKGKSEIETCRQARCPPE--FWQALTG------NPDKPQGAIVEHVPEGFVAERKKLYKVNIGMGFLELPQVELPKGIAKQDMLGSKGVFVLDSNSDIFLWIGKKANRLLKMAGQKLVVELHQMIDRPDYAQ-----VYRETEGEESMMFRSKFAG 837          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078973)

HSP 1 Score: 202.986 bits (515), Expect = 3.069e-57
Identity = 112/313 (35.78%), Postives = 192/313 (61.34%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY--TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVIT-KEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLI-FYNKL----SDEISED--WDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            P L IWRIE F+ V +P   +G+FY GDS+I+LN     +  ++ +DVHFW+G  ++ DE G AA  TV+LD+ L+  PVQHREVQ +ES+LF SYF   I Y  GG+ +GF+HV T  +   RL  V+G K  V V +V  +  ++N+ D F+ D G+ I+ ++G  A + E+      A Q+   D NG+ ++++VD+  + ++   F++ L    +D++ ++   D+D  ++        L+++SD +GKLK + IG+  +++A ++  + FI+D G  IFV++G+ +++ E+ +A+  A  +L+  +YP
Sbjct:   70 PGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 381          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0309256)

HSP 1 Score: 202.986 bits (515), Expect = 3.069e-57
Identity = 112/313 (35.78%), Postives = 192/313 (61.34%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY--TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVIT-KEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLI-FYNKL----SDEISED--WDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            P L IWRIE F+ V +P   +G+FY GDS+I+LN     +  ++ +DVHFW+G  ++ DE G AA  TV+LD+ L+  PVQHREVQ +ES+LF SYF   I Y  GG+ +GF+HV T  +   RL  V+G K  V V +V  +  ++N+ D F+ D G+ I+ ++G  A + E+      A Q+   D NG+ ++++VD+  + ++   F++ L    +D++ ++   D+D  ++        L+++SD +GKLK + IG+  +++A ++  + FI+D G  IFV++G+ +++ E+ +A+  A  +L+  +YP
Sbjct:   70 PGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 381          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078969)

HSP 1 Score: 202.986 bits (515), Expect = 3.069e-57
Identity = 112/313 (35.78%), Postives = 192/313 (61.34%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY--TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVIT-KEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLI-FYNKL----SDEISED--WDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            P L IWRIE F+ V +P   +G+FY GDS+I+LN     +  ++ +DVHFW+G  ++ DE G AA  TV+LD+ L+  PVQHREVQ +ES+LF SYF   I Y  GG+ +GF+HV T  +   RL  V+G K  V V +V  +  ++N+ D F+ D G+ I+ ++G  A + E+      A Q+   D NG+ ++++VD+  + ++   F++ L    +D++ ++   D+D  ++        L+++SD +GKLK + IG+  +++A ++  + FI+D G  IFV++G+ +++ E+ +A+  A  +L+  +YP
Sbjct:   70 PGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 381          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078968)

HSP 1 Score: 202.986 bits (515), Expect = 3.069e-57
Identity = 112/313 (35.78%), Postives = 192/313 (61.34%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY--TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVIT-KEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLI-FYNKL----SDEISED--WDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            P L IWRIE F+ V +P   +G+FY GDS+I+LN     +  ++ +DVHFW+G  ++ DE G AA  TV+LD+ L+  PVQHREVQ +ES+LF SYF   I Y  GG+ +GF+HV T  +   RL  V+G K  V V +V  +  ++N+ D F+ D G+ I+ ++G  A + E+      A Q+   D NG+ ++++VD+  + ++   F++ L    +D++ ++   D+D  ++        L+++SD +GKLK + IG+  +++A ++  + FI+D G  IFV++G+ +++ E+ +A+  A  +L+  +YP
Sbjct:   70 PGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 381          
BLAST of Gelsolin-like protein vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0309257)

HSP 1 Score: 202.601 bits (514), Expect = 3.389e-57
Identity = 112/313 (35.78%), Postives = 192/313 (61.34%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY--TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVIT-KEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLI-FYNKL----SDEISED--WDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            P L IWRIE F+ V +P   +G+FY GDS+I+LN     +  ++ +DVHFW+G  ++ DE G AA  TV+LD+ L+  PVQHREVQ +ES+LF SYF   I Y  GG+ +GF+HV T  +   RL  V+G K  V V +V  +  ++N+ D F+ D G+ I+ ++G  A + E+      A Q+   D NG+ ++++VD+  + ++   F++ L    +D++ ++   D+D  ++        L+++SD +GKLK + IG+  +++A ++  + FI+D G  IFV++G+ +++ E+ +A+  A  +L+  +YP
Sbjct:   58 PGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP 369          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 205.297 bits (521), Expect = 6.828e-58
Identity = 118/318 (37.11%), Postives = 179/318 (56.29%), Query Frame = 2
Query:  275 KVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKP-LCEHEKL-----LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            KV +   P L IWR+E  ++V  P   FG+F+ GDSY+IL  +   N   YD+H+W+GK ++QDE G AA  T ++D+ L    VQHRE Q +ES  F+ YF Q +IY  GG+ SG + V T  Y+  RLLHV+G+K  V+  EV  +  + N  DVFL D G+ I QW G  +N+ ER  G   A+ +   +R G+ ++ VV+ DD  S+      +   + E   + K   P     EKL     L+ ISD  G L  +++    +++  +  +D +++D G  +IF++ G+K+S+AER  +L  A  Y+K   YP
Sbjct:   11 KVLNKTTPGLQIWRVENMELVPCPSKTFGQFFEGDSYVILYTHKTSNNFSYDIHYWLGKSTSQDEMGAAAIYTTQMDDHLGGVAVQHRETQGHESATFQGYFKQGIIYKKGGVASGMKQVETNTYNIRRLLHVKGNK-HVVAGEVEMSWNSFNKGDVFLLDLGSLIIQWNGPKSNRMERLRGMNLAKDIRDRERGGRAQVAVVEGDDEQSSEEAMKLMKQSLGERPKNIKEAIPDEIVDEKLKTAIKLYHISDAQGSLVVQEVAVKPLTQDLLKTEDCYLLDQGGIKIFIWKGKKASKAERTESLKMAEAYVKAKGYP 327          

HSP 2 Score: 112.079 bits (279), Expect = 7.358e-26
Identity = 90/317 (28.39%), Postives = 149/317 (47.00%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF--SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQA-----PISVVKK 1225
            E  +WRIE  ++        G FY GD Y+IL  Y   ++  Y ++ W G++++  E    AY+ V LD   + +PVQ R     E     + F    ++Y  G    G         S RL HV G ++     +EV     +LNS+DVF+  T    + W GKG + DER   +  A  + S R  +V  E  +  D   NL   ++ +       D++    P       LF  S++TG+    +I   N ++  ++EDDV ++D   Q++++IG+ ++  E++ A++ A  YLK   +P       P+ VVK+
Sbjct:  401 EAEVWRIEDNELAPVDRKWLGHFYGGDCYLILYKYEVSSKFHYILYMWQGRHASTAELTACAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGKMIVYEEGSSREGSSQ---SRPSVRLFHVHGTNEFNTRATEVPPRSSSLNSNDVFVLSTDKCCYLWYGKGCSGDEREMAKSLA-DIISKREKQVIAEGQEPADFWVNLGGKSQYASN-KRLQDENISITP------RLFECSNQTGRFIATEI--TNFNQDDLDEDDVMLLDIWDQVYLWIGKGANDTEKREAVVTAQEYLK--SHPAGRDLDTPVLVVKQ 702          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 205.297 bits (521), Expect = 6.828e-58
Identity = 118/318 (37.11%), Postives = 179/318 (56.29%), Query Frame = 2
Query:  275 KVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKP-LCEHEKL-----LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            KV +   P L IWR+E  ++V  P   FG+F+ GDSY+IL  +   N   YD+H+W+GK ++QDE G AA  T ++D+ L    VQHRE Q +ES  F+ YF Q +IY  GG+ SG + V T  Y+  RLLHV+G+K  V+  EV  +  + N  DVFL D G+ I QW G  +N+ ER  G   A+ +   +R G+ ++ VV+ DD  S+      +   + E   + K   P     EKL     L+ ISD  G L  +++    +++  +  +D +++D G  +IF++ G+K+S+AER  +L  A  Y+K   YP
Sbjct:   11 KVLNKTTPGLQIWRVENMELVPCPSKTFGQFFEGDSYVILYTHKTSNNFSYDIHYWLGKSTSQDEMGAAAIYTTQMDDHLGGVAVQHRETQGHESATFQGYFKQGIIYKKGGVASGMKQVETNTYNIRRLLHVKGNK-HVVAGEVEMSWNSFNKGDVFLLDLGSLIIQWNGPKSNRMERLRGMNLAKDIRDRERGGRAQVAVVEGDDEQSSEEAMKLMKQSLGERPKNIKEAIPDEIVDEKLKTAIKLYHISDAQGSLVVQEVAVKPLTQDLLKTEDCYLLDQGGIKIFIWKGKKASKAERTESLKMAEAYVKAKGYP 327          

HSP 2 Score: 112.079 bits (279), Expect = 7.358e-26
Identity = 90/317 (28.39%), Postives = 149/317 (47.00%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF--SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQA-----PISVVKK 1225
            E  +WRIE  ++        G FY GD Y+IL  Y   ++  Y ++ W G++++  E    AY+ V LD   + +PVQ R     E     + F    ++Y  G    G         S RL HV G ++     +EV     +LNS+DVF+  T    + W GKG + DER   +  A  + S R  +V  E  +  D   NL   ++ +       D++    P       LF  S++TG+    +I   N ++  ++EDDV ++D   Q++++IG+ ++  E++ A++ A  YLK   +P       P+ VVK+
Sbjct:  401 EAEVWRIEDNELAPVDRKWLGHFYGGDCYLILYKYEVSSKFHYILYMWQGRHASTAELTACAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGKMIVYEEGSSREGSSQ---SRPSVRLFHVHGTNEFNTRATEVPPRSSSLNSNDVFVLSTDKCCYLWYGKGCSGDEREMAKSLA-DIISKREKQVIAEGQEPADFWVNLGGKSQYASN-KRLQDENISITP------RLFECSNQTGRFIATEI--TNFNQDDLDEDDVMLLDIWDQVYLWIGKGANDTEKREAVVTAQEYLK--SHPAGRDLDTPVLVVKQ 702          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: vil1 (villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799])

HSP 1 Score: 205.297 bits (521), Expect = 6.828e-58
Identity = 118/318 (37.11%), Postives = 179/318 (56.29%), Query Frame = 2
Query:  275 KVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKP-LCEHEKL-----LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            KV +   P L IWR+E  ++V  P   FG+F+ GDSY+IL  +   N   YD+H+W+GK ++QDE G AA  T ++D+ L    VQHRE Q +ES  F+ YF Q +IY  GG+ SG + V T  Y+  RLLHV+G+K  V+  EV  +  + N  DVFL D G+ I QW G  +N+ ER  G   A+ +   +R G+ ++ VV+ DD  S+      +   + E   + K   P     EKL     L+ ISD  G L  +++    +++  +  +D +++D G  +IF++ G+K+S+AER  +L  A  Y+K   YP
Sbjct:   11 KVLNKTTPGLQIWRVENMELVPCPSKTFGQFFEGDSYVILYTHKTSNNFSYDIHYWLGKSTSQDEMGAAAIYTTQMDDHLGGVAVQHRETQGHESATFQGYFKQGIIYKKGGVASGMKQVETNTYNIRRLLHVKGNK-HVVAGEVEMSWNSFNKGDVFLLDLGSLIIQWNGPKSNRMERLRGMNLAKDIRDRERGGRAQVAVVEGDDEQSSEEAMKLMKQSLGERPKNIKEAIPDEIVDEKLKTAIKLYHISDAQGSLVVQEVAVKPLTQDLLKTEDCYLLDQGGIKIFIWKGKKASKAERTESLKMAEAYVKAKGYP 327          

HSP 2 Score: 112.079 bits (279), Expect = 7.358e-26
Identity = 90/317 (28.39%), Postives = 149/317 (47.00%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF--SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQA-----PISVVKK 1225
            E  +WRIE  ++        G FY GD Y+IL  Y   ++  Y ++ W G++++  E    AY+ V LD   + +PVQ R     E     + F    ++Y  G    G         S RL HV G ++     +EV     +LNS+DVF+  T    + W GKG + DER   +  A  + S R  +V  E  +  D   NL   ++ +       D++    P       LF  S++TG+    +I   N ++  ++EDDV ++D   Q++++IG+ ++  E++ A++ A  YLK   +P       P+ VVK+
Sbjct:  401 EAEVWRIEDNELAPVDRKWLGHFYGGDCYLILYKYEVSSKFHYILYMWQGRHASTAELTACAYQAVILDQKYNGEPVQVRVPMGKEPMHLMAIFKGKMIVYEEGSSREGSSQ---SRPSVRLFHVHGTNEFNTRATEVPPRSSSLNSNDVFVLSTDKCCYLWYGKGCSGDEREMAKSLA-DIISKREKQVIAEGQEPADFWVNLGGKSQYASN-KRLQDENISITP------RLFECSNQTGRFIATEI--TNFNQDDLDEDDVMLLDIWDQVYLWIGKGANDTEKREAVVTAQEYLK--SHPAGRDLDTPVLVVKQ 702          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: avil (advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683])

HSP 1 Score: 204.912 bits (520), Expect = 7.068e-58
Identity = 114/313 (36.42%), Postives = 176/313 (56.23%), Query Frame = 2
Query:  290 NHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKP--LCEHEKL----LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            N   + IWRIEK  +V  P    G+F++GD Y++L+    G  I YD+H+WIG  S+ DE G AA   V+LD FL   PVQHREVQ +ES +F  YF Q +IY +GG+ SG  HV T  Y+  RLLHV+G + KV  +EV  + ++ ++  VFL D G  I QW G  +N  ER  G   A+ +   +R G+ +I V++ D  ++  +    +   + E         P  + + E++    L+ +SD  G ++  +I    +++  +N DD +I+D G   IFV+ G+ +++AERQ A+  A  ++K   YP
Sbjct:   10 NSAGVLIWRIEKMDLVLIPEKFHGQFFDGDCYLLLSTCKSGKTISYDIHYWIGSASSIDEQGAAAMYAVQLDEFLGSTPVQHREVQQHESSMFCGYFKQGIIYKSGGVASGMNHVETNTYNIQRLLHVKGRR-KVTGTEVEVSWKSFDTGSVFLLDLGKTIIQWNGPESNTQERLKGMMLAKDIRDRERGGRAEIGVIEGDAEAAAPLLMQVMLSILGERPSTLPSGTPDDVTDREQMAKLTLYHVSDANGTMQITEIATSPLTQDLLNHDDCYILDQGGVSIFVWKGKMANKAERQAAMTRALEFIKLKNYP 321          

HSP 2 Score: 124.405 bits (311), Expect = 7.095e-30
Identity = 85/311 (27.33%), Postives = 148/311 (47.59%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            +WRIE  ++ E      G FY GD Y+IL  Y       Y ++ W G++++QDE    AY  V +D     +PVQ       E   F S F  +++   GG     +  +  E   RL  + G       + EV A   +LNS+DVFL  + + ++ W GKG++ DER   +  +  +   R+ +V  E  + ++      F+  L         D +  +   EH+  LF  S++TG+    ++ +   ++  + EDDV ++D   QIF+++G +++  ER+  +     YL+   G+  P  PI ++K+
Sbjct:  398 VWRIENLELAEVSKATHGFFYGGDCYLILYSYEVNGRKNYILYMWRGRHASQDEVTACAYHAVTVDQQYGGQPVQVSVTMGKEPRHFTSIFKGKMVIYEGGTSR--KGPVEPEPPVRLFQICGSHPSSTRAVEVPALAASLNSNDVFLLKSQSGVYLWYGKGSSGDERAMAKDLSVIMG--RSEQVMAEGQEPEE------FWQSLGGRTPYA-SDRRLQQVTLEHQPRLFECSNKTGRFTATEVTQ--FTQDDLREDDVMLLDTWDQIFLWMGNEANDVERRECVPTCAEYLRTHPGSRDPDTPIVIIKQ 695          
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 200.29 bits (508), Expect = 1.737e-56
Identity = 110/315 (34.92%), Postives = 182/315 (57.78%), Query Frame = 2
Query:  281 KSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY--TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKE-YSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQ 1201
            ++   P L +WRIEKF +V  P N +G FY GD+Y++L     T GN + YD+HFW+G Y TQDE G+AA  TV++D++L  KP+Q+REVQ +ES+ F  YF + L Y+ GG+ SGF+HV+T E    R+L V+G ++ V  +EV  +  + N  D F+ D G  I+QW G  +N+ E+    + A+ +  ++R+G+ ++ V DE      ++       ++ E   DD            L+++SD +G +    +   N  +++ +   D FI+D+G   +IFV+ G+ ++  ER+ A+  A  ++K   YP+
Sbjct:    9 RAGKEPGLQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQTSGN-LQYDLHFWLGDYCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGHESKAFLGYFKKGLQYMQGGVASGFKHVVTNEVVMQRVLQVKGRRV-VRATEVPVSWDSFNQGDCFILDLGNEIYQWCGSKSNRFEKLKATQLAKGIRDNERSGRARVYVCDEGVEREKMLEVLGEKPDLPEGASDDVKADASNRKMAKLYKVSDASGDMAIALVAAENPFTQSALESSDCFILDHGSDGKIFVWKGKDANMEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 123.25 bits (308), Expect = 1.183e-29
Identity = 95/330 (28.79%), Postives = 150/330 (45.45%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQH---------REVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFN 1258
            IWRIE    V    + +G+FY GDSYIIL  Y  G    + ++ W G  STQDE G +A    +LD+ L   PVQ          R VQ  E     S F     +++  G    G +   T     RL  VR +      + E+ A   NLNS+D F+  T    F W+G+GA+  E+    R AQQL     G + +   +  +   +  F++ L  + +      +    +  H   LF  S++TG+   E++  G +++  +  DDV I+D   Q+FV+IG ++   E+  A+  A  Y++     + P + + K  +G     F 
Sbjct:  397 IWRIEGSDKVPVDPSTYGQFYGGDSYIILYSYRHGGRQGHIIYIWQGADSTQDEIGASAILGAQLDDELGGGPVQMAGAPLTTQVRVVQGKEPAHLMSLFGGQPMVVHKGGTSREGGQ---TAPAETRLFQVRSNSAGCTRAVEIDAVSSNLNSNDAFVLVTPAASFIWVGQGASDIEK----RGAQQLC----GILGVSPSELSEGGEDGGFWDALGGKAAYR-TSSRLKDKMNAHPPRLFACSNKTGRFIIEEV-PGEMTQEDLATDDVMILDTWDQVFVWIGNEAHDEEKMEAMTSAAQYIQTDPANRDPRTAIVKIKQGFEPPTFT 713          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 194.512 bits (493), Expect = 1.057e-53
Identity = 113/317 (35.65%), Postives = 173/317 (54.57%), Query Frame = 2
Query:  287 CNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSD-RNGKVKIEVVDEDDSSSNLI---------FYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            C  P L IW +EK K+V  P   +G F+ GD YI+L      N ++ D+H+WIGK S+QDE G+AA+   ++D  L   P+QHREVQ +ES  FKSYF   +IY  GG+ SGF+HV T  Y+  RLLHV+G K  V  +EVA +  + N  DVFL D G  I QW G  +NK ER      AQ +  D R G+ +I V+D +  S +L+            +L D + ++  D++      +    L+ + ++   L  +++    +++  +  +D  I+D G  +I+V+ G+ SS  E+  A   A  +++   YP
Sbjct:    9 CRKPGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYNKQTPNGLISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRLLHVKGKK-HVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQ-----KANVRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP 319          

HSP 2 Score: 129.413 bits (324), Expect = 2.188e-31
Identity = 85/314 (27.07%), Postives = 160/314 (50.96%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYK-PLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQA-----PISVVKK 1225
            +WRIEK ++ E     +G+FY GD Y+IL  Y +     Y ++ W+G++++QDE    A++ V+LD    D+PVQ R     E    ++ F  ++I   GG      H    E   +L  V+G ++     +EV A   +LNS+DVF+  T +  + W GKG + DER   +  A  +S       K  +++  + +    F+  L  +    +  DK ++    ++   LF  S++TG+    ++   +  ++ ++EDDV ++D  ++IF+++G+ ++  E+  ++  +  YL+   +P       PI +VK+
Sbjct:  396 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPNYLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLGVH--EPEAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDEREMAKTVANIISKQD----KQTILEGQEPAE---FWVALGGKAP--YASDKRFQEQAVQYSPRLFECSNQTGRFVMTEV--VDFCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HPAGRDLATPIILVKQ 694          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 194.126 bits (492), Expect = 1.114e-53
Identity = 113/317 (35.65%), Postives = 173/317 (54.57%), Query Frame = 2
Query:  287 CNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSD-RNGKVKIEVVDEDDSSSNLI---------FYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            C  P L IW +EK K+V  P   +G F+ GD YI+L      N ++ D+H+WIGK S+QDE G+AA+   ++D  L   P+QHREVQ +ES  FKSYF   +IY  GG+ SGF+HV T  Y+  RLLHV+G K  V  +EVA +  + N  DVFL D G  I QW G  +NK ER      AQ +  D R G+ +I V+D +  S +L+            +L D + ++  D++      +    L+ + ++   L  +++    +++  +  +D  I+D G  +I+V+ G+ SS  E+  A   A  +++   YP
Sbjct:    9 CRKPGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILLYNKQTPNGLISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRLLHVKGKK-HVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQ-----KANVRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP 319          

HSP 2 Score: 129.413 bits (324), Expect = 2.120e-31
Identity = 85/314 (27.07%), Postives = 160/314 (50.96%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYK-PLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQA-----PISVVKK 1225
            +WRIEK ++ E     +G+FY GD Y+IL  Y +     Y ++ W+G++++QDE    A++ V+LD    D+PVQ R     E    ++ F  ++I   GG      H    E   +L  V+G ++     +EV A   +LNS+DVF+  T +  + W GKG + DER   +  A  +S       K  +++  + +    F+  L  +    +  DK ++    ++   LF  S++TG+    ++   +  ++ ++EDDV ++D  ++IF+++G+ ++  E+  ++  +  YL+   +P       PI +VK+
Sbjct:  396 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPNYLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLGVH--EPEAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDEREMAKTVANIISKQD----KQTILEGQEPAE---FWVALGGKAP--YASDKRFQEQAVQYSPRLFECSNQTGRFVMTEV--VDFCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HPAGRDLATPIILVKQ 694          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: jazf1 (JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950886])

HSP 1 Score: 192.586 bits (488), Expect = 3.493e-53
Identity = 115/317 (36.28%), Postives = 175/317 (55.21%), Query Frame = 2
Query:  287 CNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSD-RNGKVKIEVVDEDDSSSNLI---------FYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            C  P L IW +EK K+V  P   +G F+ GD YI+L  YT  N ++ D+H+WIGK S+QDE G+AA+   ++D  L   P+QHREVQ +ES  FKSYF   +IY  GG+ SGF+HV T  Y+  RLLHV+G K  V  +EVA +  + N  DVFL D G  I QW G  +NK ER      AQ +  D R G+ +I V+D +  S +L+            +L D + ++  D++      +    L+ + ++   L  +++    +++  +  +D  I+D G  +I+V+ G+ SS  E+  A   A  +++   YP
Sbjct:   35 CRKPGLQIWSMEKMKMVPIPEKAYGSFFEGDCYILL--YTP-NGLISDIHYWIGKDSSQDEQGSAAFYATQIDGLLGGGPIQHREVQGHESATFKSYFKNGVIYKKGGVSSGFKHVETNMYNIRRLLHVKGKK-HVTATEVAMSWNSFNKGDVFLLDLGKVIIQWNGPESNKSERIRACSLAQSIRDDERGGRAQIGVIDNEQDSPDLMQIMVAVLGARAGELKDSVPDEKADEQQ-----KANVRLYHVFEKDANLVVQELATKPLTQDLLQHEDCHILDQGGVKIYVWRGKNSSPEEKSAAFSRAVGFIQAKGYP 342          

HSP 2 Score: 129.028 bits (323), Expect = 2.353e-31
Identity = 86/314 (27.39%), Postives = 159/314 (50.64%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYK-PLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQA-----PISVVKK 1225
            +WRIEK ++ E     +G+FY GD Y+IL  Y +     Y ++ W+G++++QDE    A++ V+LD    D+PVQ R     E    ++ F  ++I   GG      H    E   +L  V+G ++     +EV A   +LNS+DVF+  T +  + W GKG + DER   +  A  +S     K   + + E    +   F+  L  +    +  DK ++    ++   LF  S++TG+    ++   +  ++ ++EDDV ++D  ++IF+++G+ ++  E+  ++  +  YL+   +P       PI +VK+
Sbjct:  419 VWRIEKLELAEVEPRTYGQFYGGDCYLILYTYMKSGRPNYLLYMWLGRHASQDEITACAFQAVQLDKKYHDQPVQIRVTMGKEPRHLQAMFKGKMIIYEGGTSRLGVH--EPEAPIKLFQVKGTNEYNTKATEVPARASSLNSNDVFVLKTESMCYLWCGKGCSGDEREMAKTVANIIS-----KQDKQTILEGQEPAE--FWVALGGKAP--YASDKRFQEQAVQYSPRLFECSNQTGRFVMTEV--VDFCQSDLDEDDVMLLDTWEEIFLWVGKSANDYEKTESVKASQEYLRA--HPAGRDLATPIILVKQ 717          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 190.66 bits (483), Expect = 5.499e-53
Identity = 110/305 (36.07%), Postives = 170/305 (55.74%), Query Frame = 2
Query:  302 LFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVITKEY-SPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIG-KGNISRAQINEDDVFIIDNG--QQIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            L IWRIE   +V  P   +G FY GD+Y++LN   + N   YD+H+W+GK  +QDE   AA  TV+LD FL  KPVQ+RE+Q +ES  F  YF   I Y  GG+ SGF+HV+T E  + RLLH++G ++ V  +EV  +  N NS D F+ D G  I+QW G   NK ER    + A  +  +++NG+ +I VV+E    + L        ++    D D            L+ +SD +G +K   +  +   S+A +  ++ FI+D+   ++IFV+ G+ ++  ER+ A+  A  +++   YP
Sbjct:   17 LQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKGRRV-VRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVVEEGSEPNELTKVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 320          

HSP 2 Score: 108.227 bits (269), Expect = 1.541e-24
Identity = 87/296 (29.39%), Postives = 142/296 (47.97%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ---LIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVI-VSEVAATKRNLNSDDVFLYDTGTHI-FQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYK--PLCEHEKL-----LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNAL 1159
            I+R+E    V    N FG+FY GD YIIL  Y +G      ++ W G  +T+DE   +A+ TV+LD  L D+ VQ R  Q  E     S F     +IY +G    G +   T   + RL  +R +   +  + EV      LNS+DVF+     +  ++WIGKGA+ +E    +  A  L      + K+  + E              DE     +  K Y+   L E + +     LF  S++TG+   E++  G  ++  + EDDV ++D  +Q+F++IG+ ++  E++ +L
Sbjct:  397 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAKG----LIIYTWQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFKDKPLIIYKDGTSRKGGQ---TPPSAVRLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSGYKWIGKGASGEEEKAAEYIANVL------RCKVSKIAEGQE----------PDEFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLIEEV-PGEFTQDDLAEDDVMLLDTHEQVFLWIGKDANEQEKKESL 668          
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 190.274 bits (482), Expect = 6.416e-53
Identity = 110/305 (36.07%), Postives = 170/305 (55.74%), Query Frame = 2
Query:  302 LFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVITKEY-SPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLS-SDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIG-KGNISRAQINEDDVFIIDNG--QQIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            L IWRIE   +V  P   +G FY GD+Y++LN   + N   YD+H+W+GK  +QDE   AA  TV+LD FL  KPVQ+RE+Q +ES  F  YF   I Y  GG+ SGF+HV+T E  + RLLH++G ++ V  +EV  +  N NS D F+ D G  I+QW G   NK ER    + A  +  +++NG+ +I VV+E    + L        ++    D D            L+ +SD +G +K   +  +   S+A +  ++ FI+D+   ++IFV+ G+ ++  ER+ A+  A  +++   YP
Sbjct:   17 LQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKGRRV-VRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVVEEGSEPNELTKVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 320          

HSP 2 Score: 83.5741 bits (205), Expect = 1.669e-16
Identity = 83/304 (27.30%), Postives = 137/304 (45.07%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ---LIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVI-VSEVAATKRNLNSDDVFLYDTGTHI-FQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYK--PLCEHEKL-----LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK 1183
            I+R+E    V    N FG+FY GD YIIL  Y +G      ++ W G  +T+DE   +A+ TV+LD  L D+ VQ R  Q  E     S F     +IY +G    G +   T   + RL  +R +   +  + EV      LNS+DVF+     +  ++WIGKGA+ +E    +  A  L      + K+  + E              DE     +  K Y+   L E + +     LF  S++TG+   + +    + R        F+     ++F++IG+ ++  E++ +L  A  Y++
Sbjct:  398 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAKG----LIIYTWQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFKDKPLIIYKDGTSRKGGQ---TPPSAVRLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSGYKWIGKGASGEEEKAAEYIANVL------RCKVSKIAEGQE----------PDEFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLVQVL----MIR--------FLFH--LKVFLWIGKDANEQEKKESLKSAKQYIE 664          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Vil1 (villin 1 [Source:MGI Symbol;Acc:MGI:98930])

HSP 1 Score: 205.297 bits (521), Expect = 6.711e-58
Identity = 119/325 (36.62%), Postives = 182/325 (56.00%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVD---EDDSSSNLIFYN-------KLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKD 1228
            P + IWRIE  ++V  P + FG F++GD Y++L I+   + + YD+H+WIG+ S+QDE G AA  T ++D++L  + VQHREVQ  ESE F+SYF Q L+   GG+ SG +HV T      RLLHV+G K  V+  EV  + ++ N  DVFL D G  I QW G  +N+ ER  G   A+++   +R G+  + VVD   E DS   +   N       +L   IS     D   +P  +    L+ +SD  GKL   ++    +++  +  +D +I+D G  +IFV+ G+ ++  ER  A+  A N++K  +YP +    V+ D
Sbjct:   17 PGIQIWRIEAMQMVPVPSSTFGSFFDGDCYVVLAIHKTSSTLSYDIHYWIGQDSSQDEQGAAAIYTTQMDDYLKGRAVQHREVQGNESETFRSYFKQGLVIRKGGVASGMKHVETNSCDVQRLLHVKG-KRNVLAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESNRMERLRGMALAKEIRDQERGGRTYVGVVDGEKEGDSPQLMAIMNHVLGPRKELKAAIS-----DSVVEPAAKAALKLYHVSDSEGKLVVREVATRPLTQDLLKHEDCYILDQGGLKIFVWKGKNANAQERSGAMSQALNFIKAKQYPPSTQVEVQND 335          

HSP 2 Score: 127.872 bits (320), Expect = 4.255e-31
Identity = 98/320 (30.63%), Postives = 157/320 (49.06%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRG---DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKL----LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            E+ +WRIE  ++V       G FY GD Y++L  Y  G +  Y ++ W G  ++QDE   +AY+ V LD   +D+PVQ R     E     S F  +++   GG  +  ++ +    S RL  VRG   D  K    EV A   +LNS+DVF+  T +  + W GKG + DER   +  A  +S     + + +VV E    +N  F+  L  +         + K L E  ++    LF  S++TG+    +I   + ++  + E+DVF++D   Q+F +IG+ ++  E++ A      YLK   G    + PI VVK+
Sbjct:  399 EVQVWRIEDLELVPVESKWLGHFYGGDCYLLLYTYLIGEKQHYLLYIWQGSQASQDEIAASAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMSIFKGRMVVYQGG--TSRKNNLEPVPSTRLFQVRGTNADNTKAF--EVTARATSLNSNDVFILKTPSCCYLWCGKGCSGDEREMAKMVADTIS-----RTEKQVVVEGQEPAN--FWMALGGKAPY-----ANTKRLQEENQVITPRLFECSNQTGRFLATEI--FDFNQDDLEEEDVFLLDVWDQVFFWIGKHANEEEKKAAATTVQEYLKTHPGNRDLETPIIVVKQ 700          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 198.749 bits (504), Expect = 4.861e-57
Identity = 112/336 (33.33%), Postives = 191/336 (56.85%), Query Frame = 2
Query:  278 VKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIIL-NIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKE-YSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP-QAPISVVKKDLKGNSAEQFNK 1261
            +K+   P L IWR+EKF +V  P N +G+F+ GD+Y+IL  +  R   + YD+H+W+G   +QDE G AA  TV+LD++L+ + VQHREVQ +ES  F  YF S L Y  GG+ SGF+HV+  E    RL  V+G ++ V  +EV  +  + N+ D F+ D G +I+QW G G+NK ER    + ++ +  ++R+G+ ++ V +E      ++        + E  +D             L+++S+  G +    +   N  ++  +  +D FI+D+G+  +IFV+ G++++  ER+ AL  A +++   +YP Q  +SV+ +  +    +QF K
Sbjct:   20 LKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRV-VRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFK 354          

HSP 2 Score: 86.6557 bits (213), Expect = 1.106e-17
Identity = 59/162 (36.42%), Postives = 73/162 (45.06%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIG 781
            IWRIE    V      +G+FY GDSYIIL  Y  G      ++ W G  STQDE   +A  T +LD  L   PVQ R VQ  E     S F     +IY  G    G +   T   S RL  VR        + EV      LNS+D F+  T +  + W+G
Sbjct:  409 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQ---TAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVG 567          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 199.134 bits (505), Expect = 5.283e-56
Identity = 112/336 (33.33%), Postives = 191/336 (56.85%), Query Frame = 2
Query:  278 VKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIIL-NIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKE-YSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP-QAPISVVKKDLKGNSAEQFNK 1261
            +K+   P L IWR+EKF +V  P N +G+F+ GD+Y+IL  +  R   + YD+H+W+G   +QDE G AA  TV+LD++L+ + VQHREVQ +ES  F  YF S L Y  GG+ SGF+HV+  E    RL  V+G ++ V  +EV  +  + N+ D F+ D G +I+QW G G+NK ER    + ++ +  ++R+G+ ++ V +E      ++        + E  +D             L+++S+  G +    +   N  ++  +  +D FI+D+G+  +IFV+ G++++  ER+ AL  A +++   +YP Q  +SV+ +  +    +QF K
Sbjct:    9 LKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRV-VRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFK 343          

HSP 2 Score: 132.494 bits (332), Expect = 1.302e-32
Identity = 98/319 (30.72%), Postives = 145/319 (45.45%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKKDLKGNS 1243
            IWRIE    V      +G+FY GDSYIIL  Y  G      ++ W G  STQDE   +A  T +LD  L   PVQ R VQ  E     S F     +IY  G    G +   T   S RL  VR        + EV      LNS+D F+  T +  + W+G GA++ E+   Q   + L   R+  V++E   E D+     F+  L  + +         K +  H   LF  S+  G+   E++  G + +  +  DDV ++D   Q+FV++G+ S   E+  AL  A  Y++        + PI+VV++  +  S
Sbjct:  398 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQ---TAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVL---RSQHVQVEEGSEPDA-----FWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEV-PGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPS 704          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 198.749 bits (504), Expect = 9.662e-56
Identity = 112/336 (33.33%), Postives = 191/336 (56.85%), Query Frame = 2
Query:  278 VKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIIL-NIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKE-YSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP-QAPISVVKKDLKGNSAEQFNK 1261
            +K+   P L IWR+EKF +V  P N +G+F+ GD+Y+IL  +  R   + YD+H+W+G   +QDE G AA  TV+LD++L+ + VQHREVQ +ES  F  YF S L Y  GG+ SGF+HV+  E    RL  V+G ++ V  +EV  +  + N+ D F+ D G +I+QW G G+NK ER    + ++ +  ++R+G+ ++ V +E      ++        + E  +D             L+++S+  G +    +   N  ++  +  +D FI+D+G+  +IFV+ G++++  ER+ AL  A +++   +YP Q  +SV+ +  +    +QF K
Sbjct:   58 LKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGRRV-VRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHVSEEGGEPEAMLQVLGPKPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVLPEGGETPLFKQFFK 392          

HSP 2 Score: 132.494 bits (332), Expect = 1.463e-32
Identity = 98/319 (30.72%), Postives = 145/319 (45.45%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKKDLKGNS 1243
            IWRIE    V      +G+FY GDSYIIL  Y  G      ++ W G  STQDE   +A  T +LD  L   PVQ R VQ  E     S F     +IY  G    G +   T   S RL  VR        + EV      LNS+D F+  T +  + W+G GA++ E+   Q   + L   R+  V++E   E D+     F+  L  + +         K +  H   LF  S+  G+   E++  G + +  +  DDV ++D   Q+FV++G+ S   E+  AL  A  Y++        + PI+VV++  +  S
Sbjct:  447 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPMIIYKGGTSRDGGQ---TAPASIRLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVL---RSQHVQVEEGSEPDA-----FWEALGGKTAYRTSPRLKDKKMDAHPPRLFACSNRIGRFVIEEV-PGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIETDPANRDRRTPITVVRQGFEPPS 753          
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Match: Avil (advillin [Source:MGI Symbol;Acc:MGI:1333798])

HSP 1 Score: 198.749 bits (504), Expect = 1.502e-55
Identity = 112/318 (35.22%), Postives = 176/318 (55.35%), Query Frame = 2
Query:  290 NHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHE---------KLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIID-NGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQA 1204
            N P +  WRIEK ++   P++  G FY GD YI+L+    G+ +  ++HFWIGK S+QDE   AA  T +LD++L   PVQHREVQ++ES+ F+ YF Q +IY  GG+ SG +HV T  Y   RLLHV+G K  +  +EV  +  + N  DVFL D G  I QW G  +N  ER      A+ +   +R G+ +I V++ D  +++      L D +          KP    E          +L+ +SD  G+L   ++    + +  +N DD +I+D +G +I+V+ G+ +++ E+Q A+  A +++K   YP +
Sbjct:   12 NDPRIITWRIEKMELALVPLSAHGNFYEGDCYIVLSTRRVGSLLSQNIHFWIGKDSSQDEQSCAAIYTTQLDDYLGGSPVQHREVQYHESDTFRGYFKQGIIYKKGGVASGMKHVETNTYDVKRLLHVKG-KRNIQATEVEMSWDSFNRGDVFLLDLGMVIIQWNGPESNSGERLKAMLLAKDIRDRERGGRAEIGVIEGDKEAASPGLMTVLQDTLGR----RSMIKPAVSDEIMDQQQKSSIMLYHVSDTAGQLSVTEVATRPLVQDLLNHDDCYILDQSGTKIYVWKGKGATKVEKQAAMSKALDFIKMKGYPSS 324          

HSP 2 Score: 111.309 bits (277), Expect = 1.656e-25
Identity = 89/314 (28.34%), Postives = 151/314 (48.09%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ--LIYLNGGIESGFRHVITKEYSP--RLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYL---KGTEYPQAPISVVKK 1225
            +WRIE  ++V       G FY GD Y++L  Y    +  Y ++ W G+++++DE   +AY+ VE+D   D  PVQ R     E   F + F    +IY  G    G      +E  P  RL  + G DK      EV+A+  +LNS+DVFL  T    + W GKG++ DER   +     L  D N     E  +  +      F++ L  + +   +D +  +   + +  LF  S++TG+    ++   + ++  ++  DV ++D   Q+F++IG +++  E++ AL  A  YL        P  PI ++K+
Sbjct:  399 VWRIENLELVPVEYQWHGFFYGGDCYLVLYTYDVNGKPHYILYIWQGRHASRDELAASAYRAVEVDQQFDGAPVQVRVSMGKEPRHFMAIFKGKLVIYEGGTSRKG-----NEEPDPPVRLFQIHGNDKSNTKAVEVSASASSLNSNDVFLLRTQAEHYLWYGKGSSGDERAMAKELVDLL-CDGNADTVAEGQEPPE------FWDLLGGKTAYA-NDKRLQQETLDVQVRLFECSNKTGRFLVTEV--TDFTQEDLSPGDVMLLDTWDQVFLWIGAEANATEKKGALSTAQEYLVTHPSGRDPDTPILIIKQ 697          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q7JQD3|GELS1_LUMTE (Gelsolin-like protein 1 OS=Lumbricus terrestris OX=6398 GN=AM PE=1 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 4.489e-103
Identity = 170/375 (45.33%), Postives = 228/375 (60.80%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPE-LFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY---TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVIGG 1273
            ++K K+Y WKDSN+ L G+  ++ +KK SA TE AW   K     E L IWRI  FKV EWP NQ G+FYNGDSYIILN Y    + NE+ YDVHFWIG  S+QDEYGTAAYKTVELD FLDDKPVQHREVQ YESELF++YF Q L  L GG E+GF HV   EY PRLLH  G K ++ V EV   K  L+  DVF+ D G  ++QW GK ++K+E +   ++   + S+R  K + E ++++ +  +  FY  L+       D+    KPL + E  L ++SD  G LK  ++ +G ++    + +DVFI+D G Q FV++G+             +H +L  T +P API V+K   +G   + FN  I  
Sbjct:    5 LIKAKEYDWKDSNLALFGSDTEKQVKKDSAATEPAW---KGAGQKEGLKIWRIVNFKVTEWPQNQHGKFYNGDSYIILNTYKPDPKSNELAYDVHFWIGSQSSQDEYGTAAYKTVELDTFLDDKPVQHREVQGYESELFRNYFKQGLTILEGGAETGFHHVKPTEYKPRLLHFSGQKQQIYVHEVPLVKERLDHKDVFILDLGLTLYQWNGKESSKEEGFKAMQYLGLMRSERP-KAEAETLEDESTPESHKFYTSLTGT-----DEPNLVKPLVKEENQLLKVSDAGGHLKTTEVKRGAVNSKDFSSNDVFILDTGDQCFVWVGKGRFAVGEAEWTRISHAHLMKTCHPLAPIHVIK---EGQLCKAFNVAIAA 367          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q24800|SEVE_ECHGR (Severin OS=Echinococcus granulosus OX=6210 GN=AG8 PE=2 SV=3)

HSP 1 Score: 301.597 bits (771), Expect = 9.603e-98
Identity = 168/379 (44.33%), Postives = 229/379 (60.42%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTR---GNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQL----IYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLI----FYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVI 1267
            +VK K Y WKDSN+EL G+ +DR +KK SA TEK W  V     P L +WR+ +F +   P ++ G FYNGDSY+I    TR   G+++LY+VHFWIGK+ST DEYGTAAYKTVELD FLDD  VQHREV+ YES+LFKSYF +L    + L GG  SGFRHV   EY PRLL    +     + +VA +K++++S DVF+ D G+  +Q+ G   +  E+     F Q L S RNG+    V+DE D+  ++     F+  L D         K  +P  E  K L+++SD +GKL+   + +G+ S+  I  DDV+II   + +FVYIG+  S  E++NAL  AH +L+    P  PI+VV  +     AE F K I
Sbjct:    4 LVKAKDYDWKDSNMELFGSSKDRQVKKESAMTEKCWEPVGRATSPFLMVWRVNQFTLEPVPSDEIGNFYNGDSYVICKA-TRSPGGDKLLYNVHFWIGKHSTADEYGTAAYKTVELDTFLDDAAVQHREVEGYESQLFKSYFDKLVILKVILKGGYASGFRHVKPDEYRPRLLRFCKEGKTTYMRQVAFSKQSVHSGDVFILDLGSRAYQFNGSKCSAFEKSSAAAFLQDLESKRNGRCNTSVLDEADTPQDVGVLHEFWTALPDVPV------KELEPPKEVIKSLYKLSDSSGKLELTIVSEGSASKHDIKPDDVYIILTKEGLFVYIGKDCSVLEKRNALSNAHKFLQTCPNPFLPITVVTDE----QAESFLKGI 371          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|Q8MPM1|GELS2_LUMTE (Gelsolin-like protein 2 OS=Lumbricus terrestris OX=6398 GN=gelsolin PE=1 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 1.222e-94
Identity = 161/373 (43.16%), Postives = 223/373 (59.79%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY-TRGNE-ILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVIGG 1273
            +VK K+Y WKDSN+ + G+  D+S+KK SA  E AW  V       L IWRI  FKV EWP   +G F++GDSYIILN Y  +G E + YDVHFWIG  STQDEY  AAYKTVELD +LDD  +QHR+ +  ES+LF SYF   L  + GG E GF +V  +EY  RLLH  G K  ++V EV    + L SDDVF+ D G  ++QW G G+NKDER+   ++ Q L ++R G    + ++E+    +  FY  L+ E  ED  +D+         K L R+SD  G  K   +  G+I+ + ++  DVFI+DNG   FV++G  +S  E++N L YAH++L  T +P  PI    +  +G +++ FN  +  
Sbjct:    4 LVKAKRYDWKDSNLAMFGSALDKSVKKESALKEAAWKGVG--EKVGLKIWRIVNFKVTEWPEKDYGSFFSGDSYIILNTYKLKGREELAYDVHFWIGSKSTQDEYCVAAYKTVELDAYLDDAAIQHRDAEGNESDLFLSYFENGLTIMEGGAEMGFNNVKPEEYKARLLHFSGLKKHIVVKEVPLCPQRLKSDDVFILDLGRTLYQWNGTGSNKDERFKAMQYLQNLKAER-GAATSKTLEEEHIDKSHEFYTSLTGE-DEDLPEDQTDSAAV---KTLLRVSDAAGHFKSTVVKTGHIAASDLDSKDVFILDNGSTCFVWVGNGASAQEKRNGLGYAHSHLMKTPHPLIPI---LRHQRGQASKCFNAALAA 366          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|P10733|SEVE_DICDI (Severin OS=Dictyostelium discoideum OX=44689 GN=sevA PE=1 SV=1)

HSP 1 Score: 276.559 bits (706), Expect = 3.675e-88
Identity = 145/339 (42.77%), Postives = 206/339 (60.77%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYL 1180
            M+K +K     +NV  IGT  D+  +  +A TE  W  V     P L IWRIE FKVV  P + +G+FY+GDSYIIL+ +  GN + +D+HF++G ++TQDE GTAAYKTVELD+FL   P+Q+R+ Q YES  F S F +   L+GG+ESGF HV   EY PRLLH+ GDK    V+EV     +LNS D FL D G  I+Q+ G  ++  E+      A+ + ++R G  K+EV  E DS     F+  L     +     KH     + EK+L+++SD +G LKF ++ +G I+++ +  +DVFIID G +I+ +IG KSS  E++ A  +A  YL
Sbjct:    1 MIKNRKLDITSTNVAGIGTDLDKKCRLDAASTEAQWKGVGQA--PGLKIWRIENFKVVPVPESSYGKFYDGDSYIILHTFKEGNSLKHDIHFFLGTFTTQDEAGTAAYKTVELDDFLGGAPIQYRQCQSYESPSFLSLFPKYFILSGGVESGFNHVKPTEYKPRLLHISGDK-NAKVAEVPLATSSLNSGDCFLLDAGLTIYQFNGSKSSPQEKNKAAEVARAIDAERKGLPKVEVFCETDSDIPAEFWKLLG---GKGAIAAKHETAPTKSEKVLYKLSDASGSLKFSEVSRGKINKSSLKSEDVFIIDLGNEIYTWIGSKSSPNEKKTAFSHATQYL 333          
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Match: sp|O93510|GELS_CHICK (Gelsolin OS=Gallus gallus OX=9031 GN=GSN PE=2 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.440e-57
Identity = 115/314 (36.62%), Postives = 179/314 (57.01%), Query Frame = 2
Query:  281 KSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILN-IYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQ 1201
            K+   P L IWRIEKF +V  P N +G+F+ GDSY++LN I  R   + YD+HFW+G  S+QDE G AA  TV++D++L  K VQHREVQ +ES  F  YF S + Y  GG+ SGFRHV+  E +  RLL V+G +  V  +EV  +  + N+ D F+ D G++I+QW G  +N+ ER      A+ +  +++NG+ K+ V +E      ++        + +   DD            L+++S+  G +    +   N  S+A +N +D FI+D+G   +IFV+ G  ++  ER+ AL  A +++    YP+
Sbjct:   57 KAGKEPGLQIWRIEKFDLVPVPKNLYGDFFTGDSYLVLNTIRQRSGNLQYDLHFWLGDESSQDERGAAAIFTVQMDDYLQGKAVQHREVQGHESSTFLGYFKSGIKYKAGGVASGFRHVVPNEVTVQRLLQVKGRR-TVRATEVPVSWESFNTGDCFILDLGSNIYQWCGSNSNRQERLKATVLAKGIRDNEKNGRAKVFVSEEGAEREEMLQVLGPKPSLPQGASDDTKTDTANRKLAKLYKVSNGAGNMAVSLVADENPFSQAALNTEDCFILDHGTDGKIFVWKGRSANSDERKAALKTATDFIDKMGYPK 369          

HSP 2 Score: 129.798 bits (325), Expect = 8.093e-31
Identity = 93/316 (29.43%), Postives = 150/316 (47.47%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ---LIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKKDLK 1234
            IWRIE  + V      +G+FY GDSYIIL  Y    +    ++ W G +STQDE  T+A+ TV+LD  L   PVQ R VQ  E     S F     ++Y  G    G +   T     RL  VR        + E+      LNS+D F+  T +  + W+G+G+N  E    Q   + L +     V++    E D+     F+  L  +           K +  +   LF  S+++G+   E++  G++++  +  DDV I+D   Q+FV+IG+ +   E+  AL  A  Y++    +   + P+++VK+ L+
Sbjct:  445 IWRIEGSEKVPVDPATYGQFYGGDSYIILYDYRHAGKQGQIIYTWQGAHSTQDEIATSAFLTVQLDEELGGSPVQKRVVQGKEPPHLMSMFGGKPLIVYKGGTSREGGQ---TTPAQTRLFQVRSSTSGATRAVELDPAASQLNSNDAFVLKTPSAAYLWVGRGSNSAELSGAQELLKVLGAR---PVQVSEGREPDN-----FWVALGGKAPYRTSPRLKDKKMDAYPPRLFACSNKSGRFTIEEV-PGDLTQDDLATDDVMILDTWDQVFVWIGKDAQEEEKTEALKSAKRYIETDPASRDKRTPVTLVKQGLE 748          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8GFK5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019412g3 PE=4 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 4.596e-131
Identity = 191/373 (51.21%), Postives = 251/373 (67.29%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY--TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSD--------EISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQ 1252
            M KP+KY WKDSN+ L G+K ++ +KK ++E E AW  VK C   ELF+WRIEKFKV  WP   +G+F++GDSYI+LN+Y    G+E+LYDVHFWIGK+STQDEYGTAAYKTVELD FLDDK VQHREVQ +ES +FKSYF  + YL GG  +GFR V  +EY PRLLH  G +  + V EV  T++ LNS+DVF+ D G   +QW GK  NKDER     F QQL ++R+GK +   +DE+   S   FY  L D        E+  D    K         K +FR+SDE+GKL++  + +GN  R+ INEDDV+IID G +IFVY+G ++S AE+ NAL YAH+YLK T++P  P++  + ++K    E+
Sbjct:    1 MQKPQKYDWKDSNLALFGSKTEKDVKKAASEVETAWQPVKECTSDELFVWRIEKFKVKAWPKEDYGKFFSGDSYIVLNVYKDPDGDELLYDVHFWIGKHSTQDEYGTAAYKTVELDTFLDDKAVQHREVQEHESSMFKSYFKTITYLKGGCATGFRQVKPEEYKPRLLHFCGVRRNIEVKEVKLTRKALNSNDVFILDLGRTAYQWNGKTCNKDERIKAAAFLQQLENERHGKTQTFTLDENSIGSEHKFYQSLPDVPYAKKSSEVKSDVRSGK---------KAMFRLSDESGKLQYSLVSEGNCPRSMINEDDVYIIDTGVEIFVYVGARASDAEKMNALQYAHDYLKTTQHPLIPVTACRGNMKNPQMEK 364          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8FYV1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 4.268e-130
Identity = 183/368 (49.73%), Postives = 249/368 (67.66%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVI 1267
            M KPK+Y WKDSN+ L G+  +R +KK SAE E AW  V     P+L++WRIE FKVVEWP + +G+FY+GDSYIILN Y   +++ YDVHFWIGK ST DEYGTAAYKTVELD  LDD PVQHREVQ +ES L +SYF ++ YL GG  SGFR+V T+EY PRLLHVRG++  ++V+EV  +++ L++ DV++ D G    QW G GANK+E++   ++   L S+RNG++    ++ED + +   FY  L+DE  E  D      P    +K + ++SD TGKL F+ +   ++S++ I EDDVFIIDNG +++VY+GE +S  ER NAL YAHNYL+ +  P  P++VV       +   FN V 
Sbjct:    1 MNKPKQYDWKDSNLALFGSDTERQVKKESAEKEPAWKPVLEAQKPQLYVWRIENFKVVEWPRDLYGKFYSGDSYIILNAYMEADKLCYDVHFWIGKESTADEYGTAAYKTVELDTLLDDLPVQHREVQGHESALMRSYFPEITYLAGGCPSGFRNVTTREYKPRLLHVRGERQNIVVTEVPRSRKALDNTDVYILDLGDRAIQWNGSGANKNEKFKAAQYLSNLKSERNGRLAASTLEEDGTPTEHEFYTSLTDEEVER-DSASGGSPGA--QKRMMKLSDATGKLNFDLVSTDSLSKSNITEDDVFIIDNGFEVYVYVGENASMTERHNALAYAHNYLRDSVNPLLPVTVVTPQAPAKTKAAFNAVF 365          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1I8GIF7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 389.808 bits (1000), Expect = 6.742e-130
Identity = 183/368 (49.73%), Postives = 249/368 (67.66%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVI 1267
            M KPK+Y WKDSN+ L G+  +R +KK SAE E AW  V     P+L++WRIE FKVVEWP + +G+FY+GDSYIILN Y   +++ YDVHFWIGK ST DEYGTAAYKTVELD  LDD PVQHREVQ +ES L +SYF ++ YL GG  SGFR+V T+EY PRLLHVRG++  ++V+EV  +++ L++ DV++ D G    QW G GANK+E++   ++   L S+RNG++    ++ED + +   FY  L+DE  E  D      P    +K + ++SD TGKL F+ +   ++S++ I EDDVFIIDNG +++VY+GE +S  ER NAL YAHNYL+ +  P  P++VV       +   FN V 
Sbjct:    1 MNKPKQYDWKDSNLALFGSDTERQVKKESAEKEPAWKPVLEAQKPQLYVWRIENFKVVEWPRDLYGKFYSGDSYIILNAYMEADKLCYDVHFWIGKESTADEYGTAAYKTVELDTLLDDLPVQHREVQGHESALMRSYFPEITYLAGGCPSGFRNVTTREYKPRLLHVRGERQNIVVTEVPRSRKALDNTDVYILDLGDRAIQWNGSGANKNEKFKAAQYLSNLKSERNGRLAASTLEEDGTPTEHEFYTSLTDEEVER-DSASGGSPGA--QKRMMKLSDATGKLNFDLVSTDSLSKSNITEDDVFIIDNGFEVYVYVGENASLTERHNALAYAHNYLRDSVNPLLPVTVVTPQAPAKTKAAFNAVF 365          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A1W6I1A3 (Gelsolin-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 5.362e-128
Identity = 176/243 (72.43%), Postives = 208/243 (85.60%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSS 892
            M K +KY WKDSNVELIG+ EDRS+KK SA+TEKAW   K+C    LFIWRIEKFKVVEWP  +FGEF+ GDSYI+LNIY +  E+LYD+HFWIGKYSTQDEYGTAAYKTVELD  LDDKP+QHREVQ YES++FKSYF  +IYL GG ESGFRHV T+EY+PRLLHVRG+K  +I+SEV++TK+NLNSDDVF++D+G+ I+QWIGKGANKDER   Q+FAQQL+SDRNGK+KIEV+DE   S
Sbjct:    1 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERXKAQQFAQQLNSDRNGKLKIEVLDEGQMS 243          
BLAST of Gelsolin-like protein vs. TrEMBL
Match: A0A267FTU3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033145g1 PE=4 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 1.239e-124
Identity = 175/374 (46.79%), Postives = 253/374 (67.65%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNE--ILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISE---DWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKG-NISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVI 1267
            M KP++YSWKD+N+ L G+ E+R +KK +AE E AWA+V  C+ P+LF+WRIE+FKV +W  + +G+F++GDSYI+LN+Y   +E  + YD+HFWIG +ST DEYGTAAYKTVELD  LDD+PVQHREVQ +ES+LFKSYF ++ Y++GG  SGF  V T+EY+PRL H +G++  +IV EV  +++ L+  DV++ D G   +QW  +G NKDER+   ++ ++L  +RNG++  EV+D+DD+     FYN L+DE  E   D +         + +K ++R+S E+G L+F ++ +G   SR  + E+DVFIIDNG +I+VY+GE +S  E  NAL YAH Y      P  P++VV       +   F  V 
Sbjct:    1 MQKPQQYSWKDTNLALFGSDEERKVKKEAAELEPAWAEVLECSEPKLFVWRIEQFKVAKWESDLYGKFFDGDSYIVLNVYQEEDEDKLCYDIHFWIGVHSTADEYGTAAYKTVELDTLLDDRPVQHREVQGHESDLFKSYFPEITYMSGGCPSGFNKVHTREYTPRLFHFKGERRNIIVKEVTMSRKALDETDVYILDLGDRAYQWNSRGCNKDERFKAAQYLRKLCEERNGRLDTEVLDQDDAEEEHEFYNSLTDEELEPISDLEQASFSMAFSQPDKSVYRLSGESGSLEFSEVSRGPAASRGAVTEEDVFIIDNGHEIYVYVGENASPDEIHNALTYAHKYANELSNPLLPLTVVNSKAPARTRRAFESVF 374          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: avil (advillin [Source:NCBI gene;Acc:103036458])

HSP 1 Score: 209.92 bits (533), Expect = 5.134e-60
Identity = 120/311 (38.59%), Postives = 173/311 (55.63%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISE------DWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            P + IWRIEK ++V  P   +G FY GD Y++L     G  + YD+H+WIG  S+QDE G AA  T++LD+FL   PVQHREVQH+ES  F  YF Q +IY  GG+ SG RHV T      RLL V+G K KV   EV  +  + N  DVFL D G  I QW G  +NK ER  G   A+ +   +R G+ +I V++ D   ++ +    L+  I E          D         +  LF +SD  G++K  ++    + +  +N DD +I+D G  ++FV+ G+++++AERQ A+  A  ++K   YP
Sbjct:   12 PGILIWRIEKMELVLVPEKSYGNFYEGDCYVLLCTKKVGGSLSYDIHYWIGSESSQDEQGAAAVYTIQLDDFLGSAPVQHREVQHHESSSFCGYFKQGIIYKKGGVASGMRHVETNSSDVQRLLQVKG-KRKVTAKEVEMSWNSFNLGDVFLLDIGKTIIQWNGPDSNKQERMKGMLLAKDIRDRERGGRAEIGVIEGDAEKNSPLLMEALTSIIGERPAKLPSGTSDDQADQQQMAQVTLFHVSDADGEMKVMEVATRPLVQDLLNHDDCYILDQGGVKLFVWKGKRANKAERQAAMSRALEFIKLKGYP 321          

HSP 2 Score: 136.346 bits (342), Expect = 4.647e-34
Identity = 92/315 (29.21%), Postives = 156/315 (49.52%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCE-HEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            +L IWRIE  ++ E     +G FY GD YIIL  Y    +  Y ++ W G+++TQDE   +A++ V +D     +PVQ R     E   F + F  +L+   GG     +  +  E   RL  + G D       EV A   +LNS+DVFL      ++ W GKG++ DER   +  +  L     G    E++ E    +   F+N L  +    + +DK  + + + H+  LF  S++TG+    ++   + ++  + EDDV ++D   Q+F++IG +++  ER+ +++    YL+   G      PI +VK+
Sbjct:  395 QLQIWRIENLELAEVDPKTYGYFYGGDCYIILYTYEVNRKKSYILYIWQGRHATQDELAASAFQAVTVDQQYGGEPVQVRVTMGKEPRHFMAIFKGKLVIFEGGTSR--KGGLDPEPLVRLFQISGTDSTNTKAIEVPAQAASLNSNDVFLLKNQGTMYLWYGKGSSGDERAMAKEVSTVLG---RGSFSAEIMAEGQEPAE--FWNLLGGKAP--YANDKRLQQVVQDHQPRLFECSNKTGRFIVTEV--TDFTQDDLIEDDVMLLDTWDQVFLWIGNEANEVERKESVVTCQEYLRTHPGARDCDTPILLVKQ 698          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: avil (advillin [Source:NCBI gene;Acc:103036458])

HSP 1 Score: 209.534 bits (532), Expect = 1.681e-59
Identity = 120/311 (38.59%), Postives = 173/311 (55.63%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISE------DWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            P + IWRIEK ++V  P   +G FY GD Y++L     G  + YD+H+WIG  S+QDE G AA  T++LD+FL   PVQHREVQH+ES  F  YF Q +IY  GG+ SG RHV T      RLL V+G K KV   EV  +  + N  DVFL D G  I QW G  +NK ER  G   A+ +   +R G+ +I V++ D   ++ +    L+  I E          D         +  LF +SD  G++K  ++    + +  +N DD +I+D G  ++FV+ G+++++AERQ A+  A  ++K   YP
Sbjct:   12 PGILIWRIEKMELVLVPEKSYGNFYEGDCYVLLCTKKVGGSLSYDIHYWIGSESSQDEQGAAAVYTIQLDDFLGSAPVQHREVQHHESSSFCGYFKQGIIYKKGGVASGMRHVETNSSDVQRLLQVKG-KRKVTAKEVEMSWNSFNLGDVFLLDIGKTIIQWNGPDSNKQERMKGMLLAKDIRDRERGGRAEIGVIEGDAEKNSPLLMEALTSIIGERPAKLPSGTSDDQADQQQMAQVTLFHVSDADGEMKVMEVATRPLVQDLLNHDDCYILDQGGVKLFVWKGKRANKAERQAAMSRALEFIKLKGYP 321          

HSP 2 Score: 136.346 bits (342), Expect = 6.195e-34
Identity = 92/315 (29.21%), Postives = 156/315 (49.52%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCE-HEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            +L IWRIE  ++ E     +G FY GD YIIL  Y    +  Y ++ W G+++TQDE   +A++ V +D     +PVQ R     E   F + F  +L+   GG     +  +  E   RL  + G D       EV A   +LNS+DVFL      ++ W GKG++ DER   +  +  L     G    E++ E    +   F+N L  +    + +DK  + + + H+  LF  S++TG+    ++   + ++  + EDDV ++D   Q+F++IG +++  ER+ +++    YL+   G      PI +VK+
Sbjct:  395 QLQIWRIENLELAEVDPKTYGYFYGGDCYIILYTYEVNRKKSYILYIWQGRHATQDELAASAFQAVTVDQQYGGEPVQVRVTMGKEPRHFMAIFKGKLVIFEGGTSR--KGGLDPEPLVRLFQISGTDSTNTKAIEVPAQAASLNSNDVFLLKNQGTMYLWYGKGSSGDERAMAKEVSTVLG---RGSFSAEIMAEGQEPAE--FWNLLGGKAP--YANDKRLQQVVQDHQPRLFECSNKTGRFIVTEV--TDFTQDDLIEDDVMLLDTWDQVFLWIGNEANEVERKESVVTCQEYLRTHPGARDCDTPILLVKQ 698          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 204.142 bits (518), Expect = 5.159e-58
Identity = 114/316 (36.08%), Postives = 187/316 (59.18%), Query Frame = 2
Query:  281 KSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILN-IYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKE-YSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKL--LFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQ 1201
            ++   P L +WRIEKF +V  P N +G FY GD+Y+ILN I  R   + YD+HFW+G + TQDE G+AA  TV++D++L  KP+Q+REVQ +ES+ F  YF + L Y+ GG+ SGF+HV+T E    R+L V+G ++ V  +EV  +  + N+ D F+ D G  I+QW G  +N+ E+    + A+ +  ++R+G+ ++ V DE      ++       ++ E   DD   K    + KL  L+++SD +G +    +   N  S++ +   D FI+D+G   +IFV+ G+ ++  ER+ A+  A  ++K   YP+
Sbjct:    9 RAGKQPGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQRSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVKGRRV-VRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCDEGVEREKILEVLGEKPDLPEGAGDD--LKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 127.102 bits (318), Expect = 6.355e-31
Identity = 94/321 (29.28%), Postives = 146/321 (45.48%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFN 1258
            IWRIE    V    +  G+FY GDSYIIL  Y  G    + ++ W G  STQDE G +A    +LD+ L   PVQ R VQ  E     S F     ++Y  G    G +  + +    RL  VR +      + EV A   NLNS+D F+  T    F W+G GA+  E+   Q     L     G    E+ +  +S     F+  L  + +      +    +  H   LF  S++TG+   E++  G +++  +  DDV I+D   Q+FV++G ++   E+  A+  A  Y++     + P + + K  +G+    F 
Sbjct:  397 IWRIEGADKVPVDPSTHGQFYGGDSYIILYNYRHGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQVRVVQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSALAET---RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEKQGAQGLCDIL-----GVSASEITEGGESDD---FWAALGGKAAYR-TSTRLKDKMDVHPPRLFACSNKTGRFIIEEV-PGEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYIETDPAKRDPRTPIVKIKQGSEPPTFT 704          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 204.142 bits (518), Expect = 5.887e-58
Identity = 114/316 (36.08%), Postives = 187/316 (59.18%), Query Frame = 2
Query:  281 KSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILN-IYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKE-YSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKL--LFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQ 1201
            ++   P L +WRIEKF +V  P N +G FY GD+Y+ILN I  R   + YD+HFW+G + TQDE G+AA  TV++D++L  KP+Q+REVQ +ES+ F  YF + L Y+ GG+ SGF+HV+T E    R+L V+G ++ V  +EV  +  + N+ D F+ D G  I+QW G  +N+ E+    + A+ +  ++R+G+ ++ V DE      ++       ++ E   DD   K    + KL  L+++SD +G +    +   N  S++ +   D FI+D+G   +IFV+ G+ ++  ER+ A+  A  ++K   YP+
Sbjct:    9 RAGKQPGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQRSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVKGRRV-VRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCDEGVEREKILEVLGEKPDLPEGAGDD--LKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 119.398 bits (298), Expect = 1.989e-28
Identity = 94/330 (28.48%), Postives = 146/330 (44.24%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPV---------QHREVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFN 1258
            IWRIE    V    +  G+FY GDSYIIL  Y  G    + ++ W G  STQDE G +A    +LD+ L   PV         Q R VQ  E     S F     ++Y  G    G +  + +    RL  VR +      + EV A   NLNS+D F+  T    F W+G GA+  E+   Q     L     G    E+ +  +S     F+  L  + +      +    +  H   LF  S++TG+   E++  G +++  +  DDV I+D   Q+FV++G ++   E+  A+  A  Y++     + P + + K  +G+    F 
Sbjct:  397 IWRIEGADKVPVDPSTHGQFYGGDSYIILYNYRHGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQVAGVPITTQVRVVQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSALAET---RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEKQGAQGLCDIL-----GVSASEITEGGESDD---FWAALGGKAAYR-TSTRLKDKMDVHPPRLFACSNKTGRFIIEEV-PGEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYIETDPAKRDPRTPIVKIKQGSEPPTFT 713          
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Match: vill (villin like [Source:NCBI gene;Acc:103022178])

HSP 1 Score: 195.667 bits (496), Expect = 2.026e-54
Identity = 122/328 (37.20%), Postives = 184/328 (56.10%), Query Frame = 2
Query:  257 TEKAWAKVKSCNH-PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVV--DEDDSSSNLI-----FYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIID-NGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQA 1204
            TEK     K+ ++ P L IW I   K+V  P   FG F+ GD YIIL       + + D+H+WIG  S+QDE G AA    +LD +L   PVQHR+VQ YES  F+ YF Q +IY  GG+ SGF+HV +  Y+  RLLHV+G K  V  +EV  + ++ NS DVFL D G  I QW G  +N+ ER  G   AQ +   +R G+ +I VV  D +++SS LI        + +  + +   DD   +    H K L+++SD +G+L  +++    +++  ++ +D +I D  G  + V+ G+K++  ER+ AL  A  ++K   YP +
Sbjct:    2 TEKVLDTFKNISYKPGLQIWTINNLKMVPVPEQAFGSFFEGDCYIILYGSNDDTQSM-DIHYWIGNGSSQDEQGAAAIYVTQLDEYLGGSPVQHRDVQGYESAKFRGYFKQGIIYKKGGVASGFKHVESNVYNILRLLHVKGKK-NVTATEVEVSWKSFNSGDVFLLDMGKSIVQWNGPQSNRGERLKGCLLAQDIRDRERGGRARIGVVEGDREEASSELIKMMISVLGQRTGSLRDAVPDDTPDQFQVSHVK-LYQVSDTSGQLMVQEVASSPLTQDLLHSEDCYIADVGGLSLAVWKGKKATVEERRAALERAVGFIKAKNYPAS 326          

HSP 2 Score: 154.451 bits (389), Expect = 4.178e-40
Identity = 98/315 (31.11%), Postives = 164/315 (52.06%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHY-KPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            E+ IWRIE  ++ E P   +G+FY GD Y++L  Y R N+  Y ++ W+G+++TQDE    AY+ V +DN  +  PVQ R     E   F + F  +LI   GG  +G   V+  +   RL  VRG +++    +EV A   +LNS+D+FL  T    + W GKG + DER  G+  +  LS     K   ++V E        F+  L  + +  +  DK + + +  H   LF  S++ G+ +  ++ +   ++  ++EDDV ++D   ++F++IG  +++ E Q +   A  YLK       P+ P+  VK+
Sbjct:  398 EVQIWRIENLELQEVPRGTYGQFYGGDCYLVLYTYNRANKPQYILYMWLGRHATQDEITACAYQAVNVDNRYNGAPVQVRVTMGKEPRHFLAIFKGRLIIYEGG--TGKPGVVNPDPGARLFQVRGTNEINTKATEVPARASSLNSNDIFLLKTDLVTYTWYGKGCSGDEREMGKVVSDVLS-----KQDKQIVMEGQEPPQ--FWVALGGKGA--YSSDKRFEREVALHSPRLFNCSNQVGQFRMTEVAQ--FTQDDLDEDDVMLLDTWDELFLWIGNSANQYETQESYRCAVEYLKTHPAKRDPETPVITVKQ 699          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: avil (advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683])

HSP 1 Score: 196.052 bits (497), Expect = 3.862e-55
Identity = 115/311 (36.98%), Postives = 174/311 (55.95%), Query Frame = 2
Query:  302 LFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEIL--YDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKP--LCEHEK----LLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQ-QIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            L IWR+EK ++   P   +G F+ GD YIIL+    G+     YDVH+W+G+ S+QDE   AA  T +LD+ L   PVQHRE Q +ESE+F+ YF S ++Y  GG+ SGF H  T  Y+  RLLH++G K  V  +EV  +  + +  DVFL D G  I QW G  +N+ E+  G + A  +   +R G+ +I VV+ +D  S+      L+  + E   D     P    +H +     L+ +S++ G L  E++    +++  +N DD +I+D G  +I+V+ G  SS+ ERQ A+  A  Y+K   YP
Sbjct:   14 LHIWRVEKMELAAVPQKAYGSFFEGDCYIILSAKKAGSSPTPTYDVHYWVGQESSQDEQAAAAMYTTQLDDALGGFPVQHREYQGHESEVFRGYFKSGVVYKKGGVASGFHHTETNSYNVQRLLHIKGRK-AVTATEVNLSWDSFSRGDVFLLDLGKVIIQWNGPDSNRVEKIKGMQLASDIRDRERGGRAQIGVVEGNDEDSSPELMAVLTAALGERHGDLSPGSPDEPTDHSRKANVKLYHVSEKGGNLMVEEVATRPLTQDLLNHDDCYILDQGGIKIYVWKGRGSSKEERQAAMKRALGYIKAKGYP 323          

HSP 2 Score: 139.043 bits (349), Expect = 1.346e-35
Identity = 97/318 (30.50%), Postives = 159/318 (50.00%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF--SQLIY---LNGGIESGFRHVITKEYSP--RLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYK-PLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            ++RIE  ++        G+FY GD Y++L  YT  N++ Y ++ W G+++TQDE   +AY+ V LD     +PVQ R V   E + F + F    +IY     GG      + I     P  RL  VRG D+      EV A    LNS+DVF+ +     F W GKG + DER   +  A  L+  R+ +  +E  +  +      F+  L  +    +  +K  +    E +  LF  S +TG+    +I   + S+  ++EDDV ++D   Q+F+++G+ +S AE++ ++  A +YL+   G   P  PI +VK+
Sbjct:  400 MFRIEDLELKPVEKRLHGQFYGGDCYLVLYTYTSNNKLAYLLYMWQGRHATQDEVAASAYQAVALDQKYGGEPVQVRVVMGKEPKHFLAIFHGKLIIYEMVAQGGTSRAGGNDIGGAAPPTTRLFQVRGTDEFNTKAVEVPARASALNSNDVFVLNAEVACFLWCGKGCSGDEREMARSLADGLTR-RDKQTVLEGQEPPE------FWAALGGKAP--YASEKRMQVEEAEVQPRLFECSTQTGRFVVTEI--SDFSQDDLDEDDVMLLDTWDQVFLWVGQGASDAEKKESMTTAADYLRTHPGARDPDTPIIIVKQ 706          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 162.54 bits (410), Expect = 2.931e-47
Identity = 82/208 (39.42%), Postives = 125/208 (60.10%), Query Frame = 2
Query:  293 HPELFIWRIEKFKVVEWPINQFGEFYNGDSYIIL-NIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLI 904
             P L +WR+EK  +V  P   +G FY GD+Y++L ++  R   + YD+HFW+G   +QDE G AA  TV++D+ L  +PVQHREVQ +ES  F  YF   I Y  GG+ SGFRHV+       RLLHV+G +  V  +EV  +  + N  D F+ D G +I+QW G  +N+ ER    + A+ +  ++R+G+ +++V++E      L+
Sbjct:   13 QPGLQVWRVEKLDLVAVPKELYGSFYTGDAYVLLFSVRNRAGNMQYDLHFWLGNECSQDESGAAAIFTVQMDDHLGGQPVQHREVQGFESTAFSGYFKNGIKYKPGGVASGFRHVVPNLVDVKRLLHVKGRR-TVRATEVPLSWASFNQGDCFIVDLGANIYQWCGSKSNRFERLKATQVAKGIRDNERSGRARVDVLEEGMQPDGLV 219          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008894.1 (pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 gene:ENSPMAG00000008055.1 transcript:ENSPMAT00000008894.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 2.755e-11
Identity = 45/132 (34.09%), Postives = 65/132 (49.24%), Query Frame = 2
Query:  296 PELFIWRIEKFKVVEWPINQF--GEFYNGDSYIILNIYTRGN-EILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLI-YLNGGIESGFRHVITKEYSPRLLHVRGDK 679
            P + +W IE F  V     ++  G+FY+ D YI+L  +   N  I +++++WIG  +T D+   AA   V L NFL  +    RE    ESE F + F   I Y+ GG  SGF  V    +  RL    G +
Sbjct:  498 PGVSVWHIENF--VPQLTEEYYHGKFYDADCYIVLRTFIDENGAIAWEIYYWIGAKATLDKKACAAIHAVNLRNFLGAEGRSQREEMDDESEEFLAVFDGSISYIEGGTSSGFFTVEENAHIIRLYRCHGTQ 627          
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003626.1 (pep scaffold:Pmarinus_7.0:GL477855:13850:40700:-1 gene:ENSPMAG00000003299.1 transcript:ENSPMAT00000003626.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 7.743e-7
Identity = 51/201 (25.37%), Postives = 87/201 (43.28%), Query Frame = 2
Query:  617 GFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVK---IEVVDED-DSSSNLI--FYNKLSDEIS----EDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRA-QINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKG 1186
            G RHV T+   PR +                   +LNS D FL  T  H + WIG+ AN  E+      A  + + R+   +   I +++E  + SSN    F++ L   +S       ++D+ Y+         FR+  E  +L  +    G + R   +N  DV + D G +++V+ G++ + A+R+ A   A     G
Sbjct:  275 GRRHVQTRLVEPRAI-------------------SLNSGDCFLLLTHQHCYLWIGEFANVIEKAKASDLATYIQTKRDLGCRASSITIIEEGINCSSNRARSFWDLLGGRVSYKGTGPPEEDELYENDVVATNCAFRLQGE--RLVPDDECWGKVPRCTMLNPCDVVVFDFGSEVYVWHGKEVTLAQRKVAFQLAKQLWVG 454          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO40348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7K4])

HSP 1 Score: 334.339 bits (856), Expect = 4.144e-112
Identity = 171/354 (48.31%), Postives = 237/354 (66.95%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCE-HEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVV 1219
            + K K+Y WKDSN+ L G+  ++++KK SA+TE AW  + +   P + IWRI KFKV +WP   +G FYNGDSYIIL       E+++DVHFWIGK ST DEYGTAAYKTVELD FLDDKPVQHREV+ +ES+LFKSYFS++  L+GG ESGF+HV  KEY+PRL  VRG+K  V ++ +   K NL +DD F+ D G  +FQW G  ANK+E++      +   S R GK +  V+  DD +   I   +  + I  D ++    +   E  EK+LF +SD TG+L+  +I +G  + R+ + EDDV+I D+G+  +VY+G+ +S  ER+NA+ YAHNYL  TE+P  P++V+
Sbjct:    4 LRKQKEYDWKDSNLALFGSDTEKNVKKESAQTETAW--IGAGEKPGMKIWRIVKFKVTKWPEENYGSFYNGDSYIILRTKKENEELVHDVHFWIGKKSTADEYGTAAYKTVELDTFLDDKPVQHREVEGHESDLFKSYFSEMTLLDGGAESGFKHVGPKEYTPRLFLVRGNKKNVTLTNIELVKGNLTNDDCFIIDLGLELFQWNGIDANKEEKWKAGEICRDWRSKRGGKPRHIVL--DDCTVEKIEELEELEGILPDGENSFKKQAGSEPSEKVLFSLSDRTGQLQCNEIARGKEVKRSLLKEDDVYIFDSGRHCYVYVGKAASIDERRNAMTYAHNYLMRTEHPLLPVTVI 353          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO49235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV0])

HSP 1 Score: 317.005 bits (811), Expect = 3.079e-105
Identity = 174/356 (48.88%), Postives = 233/356 (65.45%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRG--NEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLK-VIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEH-EKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVV 1219
            + K K+  WKD+N+ L G+  ++++K+ +A TE AW    +     L IWRIEKFKV  W    +G FY+GDSYIILN Y     +E+ YDVHFWIGK STQDEYGTAAYKTVELD  L+DKP+QHREVQ +ES+LFKSYF  L  L GG++SGFRHV  +EY PRLL VRG  +   +V EV   + +L S+DVF+ D G +++ W+G   +KDE++ G +   ++ S+RNGK K EV DE     +  FY KL   +S+D +D    K   +  E  L+RISD +GK++  +I KG ISR   +E DVF+ D G+ +FVY G K+S  ER+ AL   HN+L  T++P A IS V
Sbjct:    4 LRKQKQPEWKDTNLALFGSDIEKNVKREAAATEIAWKNAGT--REGLQIWRIEKFKVKVWSREDYGSFYDGDSYIILNTYKESGEDELKYDVHFWIGKDSTQDEYGTAAYKTVELDIHLNDKPIQHREVQGFESKLFKSYFKSLTILKGGVDSGFRHVKPQEYKPRLLRVRGTTVSNCVVEEVLLARSSLCSEDVFILDKGLNLYLWVGVKCDKDEKFRGMQEILKIKSERNGKPKSEVNDESSMKPDDDFY-KLLPNVSKDCEDSSFPKGDYDSFEPELYRISDASGKIQKTQIKKGRISRKDFDEQDVFLFDTGRHLFVYTGNKASIDERRLALQIGHNHLMRTDHPFAAISTV 356          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO49234 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGU9])

HSP 1 Score: 301.212 bits (770), Expect = 8.933e-99
Identity = 174/390 (44.62%), Postives = 242/390 (62.05%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY--TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVI-VSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSD----EISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKI--GKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVIGG*SLEFSFHFFT 1306
            + K ++  W+D+N+ L G+  ++++K+ +A  E+AW+   +     L IWR+E+FKV     + +G+FY+GDSYIILN Y     +E  YDVHFWIG+ STQDEYGTAAYKTVELD +L+DKPVQHREVQ +ES+LF SYF  L  L GG++SGF+HV  + Y PRLL V G   K + V EV   +++LNSDDVF+ D G  I+QW GK  +KDE++   + A +L S+R G+  IEV+DE +  S   FY  L D    E   D+DD          E +L R+SD +G++K  ++  GKG I+R   +E DVF+ D G  +FVY G K+S  ER+ AL    NYL GT +P A IS +  +      E+F + +   S   S H +T
Sbjct:    4 LRKQEQPKWQDTNLALFGSDIEKNVKREAAGQERAWSG--AGKREGLQIWRVEQFKVKSVLRDDYGKFYDGDSYIILNTYKDPEEDEFKYDVHFWIGQDSTQDEYGTAAYKTVELDIYLNDKPVQHREVQGHESKLFMSYFDSLTILKGGVKSGFKHVRPEVYQPRLLRVYGTTPKSVKVEEVPFVRKSLNSDDVFILDKGKTIYQWNGKDCDKDEKFRAAQEANRLKSERGGRPVIEVIDEGEDRS-APFYRFLPDLPCKEEKGDYDD---------FEPVLLRVSDASGQMKLTEMKKGKGRITRNDFDEKDVFLFDTGNVLFVYSGNKASIDERRLALQIGTNYLNGTNHPFASISAIYDE---RLPEEFLEALAPSSAPSSGHAYT 378          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO43190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ87])

HSP 1 Score: 297.745 bits (761), Expect = 1.323e-97
Identity = 163/379 (43.01%), Postives = 230/379 (60.69%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTR------GNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFA---QQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRI-SDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVI 1267
            +VK KKY WKDSN+ L G+  ++++KK SAE E AW          + +WRI KFKV  WP   +G FYNGDSYI+LN Y +        E+ YDVHFWIG++S+QDEYGTAAYKTVELD+FLDDKPV+HREV+ +ES LFKSYF  LI L GG E+GFR V  + Y PRLLH      K+ V+E +  + N+N+ DVF+ D G  ++QW G   + DE++    F    Q+  S   G+  ++          + F + LS E   +         LC+   + F + SD +G L F ++ +G+ + R+Q+N +DVFI+D+G   +V+ G+ SS  ER+ A+ +AHNYL  ++ P  PI+ V   ++GN  + FNK  
Sbjct:    4 LVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWEGAG--KEVGVQVWRIVKFKVTHWPKQDYGHFYNGDSYIVLNTYKKDPSSEACGELSYDVHFWIGRFSSQDEYGTAAYKTVELDHFLDDKPVEHREVEGHESTLFKSYFDALITLKGGAETGFRRVNPEAYKPRLLHFCKKNKKIEVTEKSLKRANMNNGDVFIVDLGLTLYQWNGSRCSPDEKFSAAHFMDIIQKEISTNKGRKSVKSGILKLLLERVEFNSTLSSEPVAE------CLVLCQSNIICFMVLSDASGHLVFSEVSRGSAVKRSQLNTNDVFIMDSGDHCYVWSGKGSSVDERRRAMEFAHNYLMKSDSPFLPITCV---VEGNETDDFNKAF 371          
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Match: EDO43191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ88])

HSP 1 Score: 275.018 bits (702), Expect = 3.556e-89
Identity = 155/374 (41.44%), Postives = 220/374 (58.82%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGN--EILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPL------CEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFN 1258
            +VK KKY WKDSN+ L G+  ++++KK SAE E AW    +     + +WRI KFKV  WP   +G+F+NGDSYI+LN Y   +   +LYDVHFWIGK+S+QDEYGTAAYKTVELD+FL+D PVQHREV+ +ES+LFK YFS L  + GG +SGF+HV+ + Y+PRL HV  +   VIV +    + N+ + DVF+ D G  I+QW                           V +  V   ++ +   F  KL+  I E        + L       E E++   +SD +G L  E++ +G+ ISR+Q++ +DVF+ D G   +V++G  +S  ER  A+ YAHNYL  T++P  P++VV    +G     FN
Sbjct:    4 LVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWEG--AGKEVGVQVWRIVKFKVEHWPKEDYGKFFNGDSYIVLNTYKEPSTENLLYDVHFWIGKFSSQDEYGTAAYKTVELDHFLNDVPVQHREVEGHESKLFKGYFSTLTIMKGGADSGFKHVLPEAYTPRLFHVFKEGKCVIVRQKQMKRTNMCNSDVFIVDLGLVIYQWY-------------------------SVLLNAVFYTENQTVENFNPKLAKTIPEGKPKKDKVQALLSLLIKAEMEQM--EVSDASGSLNCEEVSRGSAISRSQLDSNDVFLFDTGCHCYVWVGAGASIDERGKAMTYAHNYLGQTDHPFLPVTVVA---EGKETNDFN 345          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 206.838 bits (525), Expect = 1.731e-58
Identity = 111/314 (35.35%), Postives = 184/314 (58.60%), Query Frame = 2
Query:  281 KSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILN-IYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQ 1201
            ++  +P L +WR+EKF +V  P N +G FY GD+Y++LN I  R  ++ YD+HFW+G   +QDE G+AA  TV++D+FL  KP+Q+REVQ +ES+ F  YF S + Y+ GG+ SGF+HV+T E S  RLL ++G ++ V  +EVA    + N DD F+ D G  I+QW G  +N+ E+    + A+ +  ++R+G+ ++ V DE      ++       ++     DD H          L+++S+ +G +    +   N  +++ +   D FI+D G   +IFV+ G+ ++  ER+ AL  A  ++K   YP+
Sbjct:  106 RAGKNPGLQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQRSGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIKGRRV-VRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCDEGMEREQMLKVLGPKPDLPAGASDDIHADVSNRKSAKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYPK 418          

HSP 2 Score: 120.939 bits (302), Expect = 8.203e-29
Identity = 89/314 (28.34%), Postives = 138/314 (43.95%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLK-VIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYK-PLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            IWR+E         + +G+FY GDSYIIL  Y  G    + ++ W G  S+QDE G  A    +LD  L   PVQ R +Q  E     S F     ++Y  G    G +    +    RL  VR +        E+ A   NLNS+D FL  T      W+G GA++ E+   Q+    L         +   +  +      F+  L  +   D+      K  +  H   LF  S++TG    E++  G +++  +  DDV I+D   Q+FV+IG ++   E+  A+  A  Y++       P+ PI  +K+
Sbjct:  494 IWRVEGSDKAPVDPSTYGQFYGGDSYIILYNYRHGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQVRVIQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSAPAET---RLFQVRSNSTGHTRAVELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEKQGAQQLCDILG--------VSASELSEGGETAQFWGALGGK--ADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEV-PGELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYVETDPANRDPRTPIVKIKQ 793          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 206.838 bits (525), Expect = 1.768e-58
Identity = 111/314 (35.35%), Postives = 184/314 (58.60%), Query Frame = 2
Query:  281 KSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILN-IYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGN-ISRAQINEDDVFIIDNGQ--QIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQ 1201
            ++  +P L +WR+EKF +V  P N +G FY GD+Y++LN I  R  ++ YD+HFW+G   +QDE G+AA  TV++D+FL  KP+Q+REVQ +ES+ F  YF S + Y+ GG+ SGF+HV+T E S  RLL ++G ++ V  +EVA    + N DD F+ D G  I+QW G  +N+ E+    + A+ +  ++R+G+ ++ V DE      ++       ++     DD H          L+++S+ +G +    +   N  +++ +   D FI+D G   +IFV+ G+ ++  ER+ AL  A  ++K   YP+
Sbjct:  106 RAGKNPGLQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQRSGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIKGRRV-VRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCDEGMEREQMLKVLGPKPDLPAGASDDIHADVSNRKSAKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYPK 418          

HSP 2 Score: 112.464 bits (280), Expect = 4.559e-26
Identity = 89/326 (27.30%), Postives = 138/326 (42.33%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQH------------REVQHYESELFKSYFS---QLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLK-VIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYK-PLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            IWR+E         + +G+FY GDSYIIL  Y  G    + ++ W G  S+QDE G  A    +LD  L   PVQ             R +Q  E     S F     ++Y  G    G +    +    RL  VR +        E+ A   NLNS+D FL  T      W+G GA++ E+   Q+    L         +   +  +      F+  L  +   D+      K  +  H   LF  S++TG    E++  G +++  +  DDV I+D   Q+FV+IG ++   E+  A+  A  Y++       P+ PI  +K+
Sbjct:  494 IWRVEGSDKAPVDPSTYGQFYGGDSYIILYNYRHGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQFSQVVGAPITTQVRVIQGKEPAHLMSLFGGKPMVVYKGGTSREGGQSAPAET---RLFQVRSNSTGHTRAVELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEKQGAQQLCDILG--------VSASELSEGGETAQFWGALGGK--ADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEV-PGELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYVETDPANRDPRTPIVKIKQ 805          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: avil (advillin [Source:NCBI gene;Acc:101170835])

HSP 1 Score: 205.297 bits (521), Expect = 5.271e-58
Identity = 119/322 (36.96%), Postives = 184/322 (57.14%), Query Frame = 2
Query:  281 KSCNH-PELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQ-LIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVD---EDDSSSNLIFYN--------KLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIID-NGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYP 1198
            K+  H P + IWR+EK ++V       G FY GD Y++L+ +   N + YD+H+WIG  S+QDE G AA  TV+LD +L   P+QHREVQ++ES+ FK YF   +IY  GG+ +G RHV T  Y   RLLHV+G K +VI  EV  + ++ N  DVFL DTG  I QW G  +NK ER+ G   A+ +   +R G+ ++  V+   E  S   +   N        KL+D   ++  D +    L      L+ +SD  G++K  ++    + +  ++ +  +++D  G +IFV+ G+K+++AERQ A+  A +++K   YP
Sbjct:    6 KAVTHNPGIIIWRVEKMELVLVSEKTHGNFYEGDCYVLLSTHKVKNVLSYDIHYWIGSESSQDEQGAAAVYTVQLDEYLGSSPIQHREVQNHESDTFKGYFKNGIIYKKGGVATGMRHVETNTYDVKRLLHVKGKK-RVIAQEVELSWKSFNLGDVFLLDTGKTIIQWNGPKSNKQERHKGLLLAKDIRDRERGGRAEVRTVEGEAEKQSPQEMEIMNSFLGERTFKLTDGPPDETFDQEQMGKLS-----LYCVSDADGQMKVTEVATRPLVQDLLDHESCYLLDQGGAKIFVWKGKKANKAERQAAMARALDFIKTKNYP 321          

HSP 2 Score: 140.584 bits (353), Expect = 1.914e-35
Identity = 95/318 (29.87%), Postives = 158/318 (49.69%), Query Frame = 2
Query:  308 IWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVS-EVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHY-------KPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLK---GTEYPQAPISVVKK 1225
            +WRIE  + V      +G FY GD Y+IL  Y   N+  Y ++ W G+++TQDE    A++ V LD   +D+PVQ R     E   F + F  +++   GG  +  +     E   RL  V G  L    + EV A   +LNS+DVFL  + T I+ W GKG++ DER      A+++SS       +  +D   SS  ++   +   E  E       Y       + L +++  LF  S++TG+    ++   N  +  +NEDDV ++D   Q+F+++G+ ++  ER+ ++  +  YL+   G   P  PI ++K+
Sbjct:  398 VWRIENLEPVPVDRQWYGYFYGGDCYLILYTYLVNNKKCYLLYMWQGRHATQDELAACAFQAVALDQKYNDEPVQVRVTMGKEPRHFMALFKGKMVIFEGG--TSRKGASEPEPPVRLFQVHGSDLSNTKTFEVPALAASLNSNDVFLLRSQTQIYLWCGKGSSGDER----AMAKEVSS-------VICLDSQRSSEEIVAEGQEPMEFWELLGGKAPYASSKRLQQVLLDYQPRLFECSNKTGRFIVTEVTHFN--QDDLNEDDVMLLDTWDQVFLWVGKDANEIERKESVATSQEYLRTHPGDRDPDTPIIMIKQ 700          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 191.43 bits (485), Expect = 5.988e-53
Identity = 116/329 (35.26%), Postives = 178/329 (54.10%), Query Frame = 2
Query:  302 LFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY-TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKL------LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDN-GQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQF 1255
            L IW I   K+V  P   FG F+ GD YI+LNI   +G     DVH+WIG  S+QDE G AA    +LD +L   PVQ+REVQ YES  F+SYF S +IY  GG+ SGF HV T  Y+  RL+HV+G K  V   EV  +  + N+ D+FL DTG  I QW G  +N+ E+      AQ +   +R G+ +I VV+  +   +      ++  + E  +  +   P  +H+++      L+ + +  G L  +++    +++  +   D FI+D+ G  + V+ G+++S+ ERQ A+  A  Y+K   YP  P + V+   +G  +  F
Sbjct:   19 LQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNIRENKGAAQSIDVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRLMHVKGKK-HVTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEKHDQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYP--PSTGVEVMSEGGESAMF 344          

HSP 2 Score: 149.828 bits (377), Expect = 1.578e-38
Identity = 101/325 (31.08%), Postives = 166/325 (51.08%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEY---PQAPISVVKKDLKGNSAEQFN 1258
            ++ +WRIE  ++VE      G+FY GD Y++L  Y R N+  Y ++ W G+++TQDE    AY+ V +D+  +  PVQ R V   E   F + F  + I   GG  +G       E S RL  VRG +++    +EV A   +LNS+DVFL  T    + W GKG + DER        + +SD   +   +VV E    +N  F+  L  + S   D     + L  H   LF  S++TG+ +  ++   + +++ ++EDDV ++D  +++F++IG+ ++++E  +A   A  YL+       P  PI  +K   +GN    F 
Sbjct:  401 DVTVWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQYILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGG--TGRAGAANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMA-----KTTSDVLFRQDKQVVMEGQEPAN--FWVALGGKSSYASDKRLQKEELI-HSPRLFECSNQTGRFRMTEV--YDFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPDTPIISIK---QGNEPPTFT 710          
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 191.815 bits (486), Expect = 6.152e-53
Identity = 116/329 (35.26%), Postives = 178/329 (54.10%), Query Frame = 2
Query:  302 LFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIY-TRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYS-PRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQL-SSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKL------LFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDN-GQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQF 1255
            L IW I   K+V  P   FG F+ GD YI+LNI   +G     DVH+WIG  S+QDE G AA    +LD +L   PVQ+REVQ YES  F+SYF S +IY  GG+ SGF HV T  Y+  RL+HV+G K  V   EV  +  + N+ D+FL DTG  I QW G  +N+ E+      AQ +   +R G+ +I VV+  +   +      ++  + E  +  +   P  +H+++      L+ + +  G L  +++    +++  +   D FI+D+ G  + V+ G+++S+ ERQ A+  A  Y+K   YP  P + V+   +G  +  F
Sbjct:   37 LQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNIRENKGAAQSIDVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRLMHVKGKK-HVTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEKHDQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYP--PSTGVEVMSEGGESAMF 362          

HSP 2 Score: 149.828 bits (377), Expect = 1.621e-38
Identity = 101/325 (31.08%), Postives = 166/325 (51.08%), Query Frame = 2
Query:  299 ELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYF-SQLIYLNGGIESGFRHVITKEYSPRLLHVRG-DKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEY---PQAPISVVKKDLKGNSAEQFN 1258
            ++ +WRIE  ++VE      G+FY GD Y++L  Y R N+  Y ++ W G+++TQDE    AY+ V +D+  +  PVQ R V   E   F + F  + I   GG  +G       E S RL  VRG +++    +EV A   +LNS+DVFL  T    + W GKG + DER        + +SD   +   +VV E    +N  F+  L  + S    D +  K    H   LF  S++TG+ +  ++   + +++ ++EDDV ++D  +++F++IG+ ++++E  +A   A  YL+       P  PI  +K   +GN    F 
Sbjct:  419 DVTVWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQYILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFIIFEGG--TGRAGAANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMA-----KTTSDVLFRQDKQVVMEGQEPAN--FWVALGGKSSYA-SDKRLQKEELIHSPRLFECSNQTGRFRMTEV--YDFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRSHPAGRDPDTPIISIK---QGNEPPTFT 728          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015925.1 (SMESG000015925.1)

HSP 1 Score: 751.895 bits (1940), Expect = 0.000e+0
Identity = 367/370 (99.19%), Postives = 368/370 (99.46%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVIGG 1273
            MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWP NQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKH+KPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQF KVIGG
Sbjct:    1 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPKNQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHHKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFKKVIGG 370          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015924.1 (SMESG000015924.1)

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 259/370 (70.00%), Postives = 313/370 (84.59%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVIGG 1273
            M K +KY WKDSNVELIG+ EDRS+KK SA+TEKAW   K+C    LFIWRIEKFKVVEWP  +FGEF+ GDSYI+LNIY +  E+LYD+HFWIGKYSTQDEYGTAAYKTVELD  LDDKP+QHREVQ YES++FKSYF  +IYL GG ESGFRHV T+EY+PRLLHVRG+K  +I+SEV++TK+NLNSDDVF++D+G+ I+QWIGKGANKDER+  Q+FAQQL+SDRNGK+KIEV+DE   S N  FYNKLS+  +E   DDK++K L  HEK LFRISDETG LKFE++  GN +++ I+E+DVFIIDNGQ I+VY+GEK+S  ER+NALIYAHNYLK T+YPQAPI+VVKKD+KG +AE+FNKV+ G
Sbjct:    1 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSN--NEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVLNG 368          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015928.1 (SMESG000015928.1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 267/370 (72.16%), Postives = 302/370 (81.62%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVIGG 1273
            M K KKY WKDSNVELIG+ EDR++KK SAE E AW K K+C+H ELFIWRIEKFKVVEWP  Q GEFY GDSYI+LNIY R NE+LYDVHFWIGKYSTQDEYGTAAYKTVELDN LDDKPVQHREVQHYESELFKSYF  LIYL GG ESGFRHV T EY+PRLLHVRG+K  +IVSEV ATK NLNS+DVF+YDTGTHIF+WIGKGANKDE++ GQ FAQ L+SDRNGK K+EVVDE + S N  FY  LSD +  D +DDK    L   +K LFRISD +G LKFE I  G  ++  INEDD+FI+DNG +++VYIGE +S  ERQNALIYAHNYLK TEYPQ P++V+KKD+KG +AE FNKVI G
Sbjct:    1 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACSHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSD-LQPD-EDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKVIEG 368          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015927.1 (SMESG000015927.1)

HSP 1 Score: 508.834 bits (1309), Expect = 2.524e-180
Identity = 246/368 (66.85%), Postives = 303/368 (82.34%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKVI 1267
            M +  KY WKDSNVELIG+ EDRS+KK SAETEKAWA  K+CNH  LF+WRIEKFKVVEWP  Q+GEFY GDSYI+L I+ +  ++ YDVHFWIGKYSTQDEYGTAAYKTVELD  LDDKPVQHREVQHYES LFKSYF  ++YL GG ESGFRHV T+EY PRLLH +GDK  +I++E++ATK+NL SDDVF+YDTG+ IFQWIGKGANKDE+Y  Q+FAQQL++DRNGK+ IEV+DE+++ SN   +  LSD  S+  ++D+H K L   E  LF+ISD TG LKFEK+  G ++++QINE+DVFI+DNGQ ++VY+GE SS  ER+NALIYAHNYLK T+YPQAP++V+ KD+KG +AE FNK++
Sbjct:    1 MKRSAKYDWKDSNVELIGSSEDRSVKKSSAETEKAWAAAKACNHAALFVWRIEKFKVVEWPKVQYGEFYEGDSYIVLKIFEKEKQLNYDVHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPVQHREVQHYESNLFKSYFQNIVYLKGGHESGFRHVNTREYIPRLLHFKGDKRNIIITEISATKKNLKSDDVFIYDTGSSIFQWIGKGANKDEKYKAQQFAQQLNADRNGKLNIEVLDEEETPSNHELFKHLSD--SDPEEEDQHLKVLNLQETQLFKISDATGSLKFEKVAAGKLNKSQINEEDVFIVDNGQIVYVYVGEGSSPNERKNALIYAHNYLKETDYPQAPVTVINKDVKGANAENFNKLV 366          
BLAST of Gelsolin-like protein vs. Planmine SMEST
Match: SMESG000015922.1 (SMESG000015922.1)

HSP 1 Score: 465.307 bits (1196), Expect = 3.351e-163
Identity = 226/367 (61.58%), Postives = 281/367 (76.57%), Query Frame = 2
Query:  164 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFNKV 1264
            M KP+KY+WKDSNV L G+ EDR +KK SAETE AW K K CN   L IWRIEKFKV+EWP  Q G FY GDSYIILNI  + N +LYD+HFWIGK+STQDEYGTA YKTVELD  LDD+PVQHREVQHYES+LFKSYF +LIYL GG ESGFR V  + Y+PRLLHV+G K  + VSEV+AT +NLNS+DVF+ DTG  IFQWIGKGANKDE++  ++F QQL+SDRNGK  +EV+DE+++  N  FYN LSD   +  DD+K++  L   EK +FRISD TG LKFEK+      ++ ++E+DVFIID+G ++ VYIGE SS  ER+ +LIYAH YLK T +PQAP++V+ K + G + ++FN +
Sbjct:    1 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKKAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNGKCLVEVIDEEETLDNHEFYNFLSD--IKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNI 362          
The following BLAST results are available for this feature:
BLAST of Gelsolin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIL17.082e-6033.82villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
AVIL1.119e-5636.16advillin [Source:HGNC Symbol;Acc:HGNC:14188][more]
VIL11.511e-5635.00villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
GSN4.394e-5332.44gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
GSN4.928e-5332.44gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gsnl-11.341e-5537.65Gelsolin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
fli-12.018e-1823.46pep chromosome:WBcel235:III:8675297:8683732:-1 gen... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gel3.069e-5735.78gene:FBgn0010225 transcript:FBtr0078973[more]
Gel3.069e-5735.78gene:FBgn0010225 transcript:FBtr0309256[more]
Gel3.069e-5735.78gene:FBgn0010225 transcript:FBtr0078969[more]
Gel3.069e-5735.78gene:FBgn0010225 transcript:FBtr0078968[more]
Gel3.389e-5735.78gene:FBgn0010225 transcript:FBtr0309257[more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vil16.828e-5837.11villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
vil16.828e-5837.11villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
vil16.828e-5837.11villin 1 [Source:ZFIN;Acc:ZDB-GENE-040426-799][more]
avil7.068e-5836.42advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683][more]
gsna1.737e-5634.92gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jazf11.057e-5335.65JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
jazf11.114e-5335.65JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
jazf13.493e-5336.28JAZF zinc finger 1 [Source:Xenbase;Acc:XB-GENE-950... [more]
ndc805.499e-5336.07NDC80 kinetochore complex component [Source:Xenbas... [more]
ndc806.416e-5336.07NDC80 kinetochore complex component [Source:Xenbas... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vil16.711e-5836.62villin 1 [Source:MGI Symbol;Acc:MGI:98930][more]
Gsn4.861e-5733.33gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn5.283e-5633.33gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn9.662e-5633.33gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Avil1.502e-5535.22advillin [Source:MGI Symbol;Acc:MGI:1333798][more]
back to top
BLAST of Gelsolin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7JQD3|GELS1_LUMTE4.489e-10345.33Gelsolin-like protein 1 OS=Lumbricus terrestris OX... [more]
sp|Q24800|SEVE_ECHGR9.603e-9844.33Severin OS=Echinococcus granulosus OX=6210 GN=AG8 ... [more]
sp|Q8MPM1|GELS2_LUMTE1.222e-9443.16Gelsolin-like protein 2 OS=Lumbricus terrestris OX... [more]
sp|P10733|SEVE_DICDI3.675e-8842.77Severin OS=Dictyostelium discoideum OX=44689 GN=se... [more]
sp|O93510|GELS_CHICK2.440e-5736.62Gelsolin OS=Gallus gallus OX=9031 GN=GSN PE=2 SV=1[more]
back to top
BLAST of Gelsolin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GFK54.596e-13151.21Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FYV14.268e-13049.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GIF76.742e-13049.73Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1W6I1A35.362e-12872.43Gelsolin-like protein OS=Schmidtea mediterranea OX... [more]
A0A267FTU31.239e-12446.79Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
avil5.134e-6038.59advillin [Source:NCBI gene;Acc:103036458][more]
avil1.681e-5938.59advillin [Source:NCBI gene;Acc:103036458][more]
gsna5.159e-5836.08gelsolin-like [Source:NCBI gene;Acc:103033745][more]
gsna5.887e-5836.08gelsolin-like [Source:NCBI gene;Acc:103033745][more]
vill2.026e-5437.20villin like [Source:NCBI gene;Acc:103022178][more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
avil3.862e-5536.98advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683][more]
gsna2.931e-4739.42gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
ENSPMAT00000008894.12.755e-1134.09pep scaffold:Pmarinus_7.0:GL484493:7018:36468:1 ge... [more]
ENSPMAT00000003626.17.743e-725.37pep scaffold:Pmarinus_7.0:GL477855:13850:40700:-1 ... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gelsolin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403484.144e-11248.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492353.079e-10548.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492348.933e-9944.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431901.323e-9743.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431913.556e-8941.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gelsolin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsna1.731e-5835.35gelsolin [Source:NCBI gene;Acc:101167720][more]
gsna1.768e-5835.35gelsolin [Source:NCBI gene;Acc:101167720][more]
avil5.271e-5836.96advillin [Source:NCBI gene;Acc:101170835][more]
vill5.988e-5335.26villin like [Source:NCBI gene;Acc:101155645][more]
vill6.152e-5335.26villin like [Source:NCBI gene;Acc:101155645][more]
back to top
BLAST of Gelsolin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015925.10.000e+099.19SMESG000015925.1[more]
SMESG000015924.10.000e+070.00SMESG000015924.1[more]
SMESG000015928.10.000e+072.16SMESG000015928.1[more]
SMESG000015927.12.524e-18066.85SMESG000015927.1[more]
SMESG000015922.13.351e-16361.58SMESG000015922.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026323 ID=SMED30026323|Name=Gelsolin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1381bp
ATTTAATTATGCTTATTTTAAACCAATCACATTTGGACTAGCGAACTCAT
AAGACAGACAAGCTTTCATATATTTATTAACATTTATTTCTTATTGTATA
TGAATACGGTTGAAGTGTTTTATTTAAACTAGATCTTTTTAGTATAGCTA
AAACAAAATAGAAATGGTAAAACCGAAAAAATATTCTTGGAAAGATTCTA
ATGTTGAATTAATAGGAACAAAGGAAGATCGTAGTATAAAAAAAATATCT
GCCGAAACGGAGAAAGCATGGGCTAAAGTAAAGTCATGCAATCATCCGGA
ATTATTTATCTGGAGGATAGAGAAGTTCAAAGTAGTTGAATGGCCTATAA
ACCAATTTGGGGAATTCTATAATGGAGATTCGTATATCATACTAAATATT
TATACAAGAGGAAATGAGATTCTTTACGATGTACATTTTTGGATTGGAAA
ATATTCAACTCAAGATGAATACGGAACTGCCGCCTACAAAACAGTAGAAT
TGGATAATTTCCTTGATGATAAACCGGTACAACATAGAGAGGTGCAGCAT
TACGAATCAGAGTTGTTTAAGAGCTATTTTTCTCAATTAATTTATCTGAA
CGGTGGAATTGAAAGTGGATTTAGACATGTAATTACGAAAGAATATTCAC
CAAGATTGCTTCATGTCCGTGGCGACAAACTAAAAGTCATTGTATCGGAA
GTTGCTGCAACGAAAAGAAATTTGAACTCGGATGATGTTTTTCTGTATGA
CACAGGCACCCACATTTTTCAATGGATCGGAAAAGGTGCAAATAAAGATG
AAAGATATCATGGTCAGAGGTTTGCTCAACAATTGAGTTCAGATAGAAAT
GGAAAAGTAAAAATTGAAGTTGTGGATGAAGATGACTCTTCATCAAATCT
TATTTTTTATAATAAATTATCGGATGAAATTAGTGAGGATTGGGATGATG
ATAAACACTATAAACCTTTATGTGAACATGAAAAATTACTTTTTAGAATT
TCCGATGAAACAGGAAAACTAAAATTTGAAAAGATAGGCAAAGGAAATAT
TTCCAGAGCCCAAATAAATGAAGATGATGTTTTTATTATAGATAACGGAC
AGCAGATTTTCGTGTACATCGGTGAAAAATCAAGTCGGGCTGAACGGCAA
AATGCACTTATATATGCTCATAACTACCTAAAGGGAACGGAATATCCTCA
AGCTCCAATATCCGTGGTAAAGAAGGATCTGAAAGGAAATAGTGCTGAGC
AATTCAATAAAGTTATTGGGGGCTAATCTTTGGAATTTTCGTTTCATTTT
TTTACTTTGATTAAAACAAACATTTCATACTTTGATTTTCATTATTGTTA
GAAATTTACAAAATCCTTTCTTTAAAAAAAA
back to top

protein sequence of SMED30026323-orf-1

>SMED30026323-orf-1 ID=SMED30026323-orf-1|Name=SMED30026323-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=371bp
MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIW
RIEKFKVVEWPINQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQ
DEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSYFSQLIYLNGGIE
SGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTH
IFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYN
KLSDEISEDWDDDKHYKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQ
INEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPIS
VVKKDLKGNSAEQFNKVIGG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0005509calcium ion binding
GO:0005546phosphatidylinositol-4,5-bisphosphate binding
GO:0003779actin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR030007Villin
IPR007122Villin/Gelsolin
IPR029006ADF-H/Gelsolin-like_dom_sf
IPR007123Gelsolin-like_dom
Vocabulary: biological process
TermDefinition
GO:0045010actin nucleation
GO:0051014actin filament severing
GO:0051693actin filament capping
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007122Villin/GelsolinPRINTSPR00597GELSOLINcoord: 175..195
score: 35.5
coord: 89..107
score: 32.3
coord: 327..346
score: 22.95
coord: 122..142
score: 30.09
coord: 298..320
score: 34.19
coord: 64..80
score: 47.06
IPR007122Villin/GelsolinSMARTSM00262VILL_6coord: 161..255
e-value: 4.4E-12
score: 56.2
coord: 45..142
e-value: 3.9E-21
score: 86.2
coord: 275..359
e-value: 1.5E-6
score: 37.8
IPR007122Villin/GelsolinPANTHERPTHR11977VILLINcoord: 41..355
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 262..368
e-value: 4.0E-20
score: 73.6
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 156..259
e-value: 2.5E-28
score: 100.4
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 30..155
e-value: 2.6E-41
score: 142.4
IPR007123Gelsolin-like domainPFAMPF00626Gelsolincoord: 55..135
e-value: 7.0E-14
score: 51.5
coord: 295..352
e-value: 3.7E-9
score: 36.4
coord: 176..245
e-value: 5.0E-14
score: 51.9
IPR030007VillinPANTHERPTHR11977:SF35VILLIN-1coord: 41..355
NoneNo IPR availableCDDcd11290gelsolin_S1_likecoord: 36..148
e-value: 3.27087E-51
score: 164.704
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 264..350
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 160..243
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 43..172