SMED30026318
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30026318 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4Note: Hover over icons to view figure legend
Homology
BLAST of SMED30026318 vs. Planmine SMEST
Match: SMESG000060519.1 (SMESG000060519.1) HSP 1 Score: 76.2554 bits (186), Expect = 6.968e-17 Identity = 38/72 (52.78%), Postives = 46/72 (63.89%), Query Frame = -1 Query: 138 LNFSFIITGNLYPNFCNS-PQHDGNCDTIMENYYSHTYNHITYFICPTCKTTHKMNYTDFYLKHKEHLTQFN 350 LNF + I GNLYP +CNS H C +M+ YY H +N I F+CP+CKT H Y DF+ HK HLTQFN Sbjct: 151 LNF-YGIPGNLYPQYCNSFVNHSDECHDLMKKYYRHQFNGIEIFMCPSCKTYHAQPYLDFFFDHKVHLTQFN 221
BLAST of SMED30026318 vs. Planmine SMEST
Match: SMESG000077557.1 (SMESG000077557.1) HSP 1 Score: 72.4034 bits (176), Expect = 1.091e-15 Identity = 32/42 (76.19%), Postives = 33/42 (78.57%), Query Frame = -1 Query: 198 NLYPNFCNSPQHDGNCDTIMENYYSHTYNHITYFICPTCKTT 323 NLY N CNSPQH GNCD IMENYYSH N TYFICPTC +T Sbjct: 32 NLYSNICNSPQHHGNCDNIMENYYSHAKNTFTYFICPTCFST 73
BLAST of SMED30026318 vs. Planmine SMEST
Match: SMESG000060688.1 (SMESG000060688.1) HSP 1 Score: 72.4034 bits (176), Expect = 1.467e-15 Identity = 33/69 (47.83%), Postives = 43/69 (62.32%), Query Frame = -1 Query: 117 LYPNFCNSP-QHDGNCDTIMENYYSHTYNHITYFICPTCKTTHKMNYTDFYLKHKEHLTQFNCKRKYIF 320 LY N+C S H+ NC T M++YY H + I +FICPTC T H + Y +FY KH HL QF +K +F Sbjct: 139 LYKNYCQSEIGHNSNCHTTMKSYYGHRFYGIDFFICPTCDTVHDIEYLEFYKKHSSHLNQFKINKKALF 207
BLAST of SMED30026318 vs. Planmine SMEST
Match: SMESG000035558.1 (SMESG000035558.1) HSP 1 Score: 68.1662 bits (165), Expect = 3.833e-14 Identity = 33/63 (52.38%), Postives = 39/63 (61.90%), Query Frame = -1 Query: 138 NLYPNFCNSP-QHDGNCDTIMENYYSHTYNHITYFICPTCKTTHKMNYTDFYLKHKEHLTQFN 323 NLY +CNS H C +M+ YY H +N I FICP+CKT H Y DF+ HK HLTQFN Sbjct: 784 NLYHQYCNSSVNHSDECHGLMKKYYRHQFNGIEIFICPSCKTYHAQPYLDFFFDHKVHLTQFN 846
BLAST of SMED30026318 vs. Planmine SMEST
Match: SMESG000020698.1 (SMESG000020698.1) HSP 1 Score: 67.781 bits (164), Expect = 6.317e-14 Identity = 31/69 (44.93%), Postives = 40/69 (57.97%), Query Frame = -1 Query: 117 LYPNFCNSP-QHDGNCDTIMENYYSHTYNHITYFICPTCKTTHKMNYTDFYLKHKEHLTQFNCKRKYIF 320 LY N+C S H+ C T ME+YY H + I +FICP C T + Y +FY KH HL QF +K +F Sbjct: 134 LYKNYCQSGIGHNSKCHTTMESYYGHRFYGIDFFICPKCDTAQDIEYLEFYKKHSSHLNQFKINKKALF 202 The following BLAST results are available for this feature:
BLAST of SMED30026318 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30026318 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30026318 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30026318 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30026318 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 5
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30026318 ID=SMED30026318|Name=SMED30026318|organism=Schmidtea mediterranea sexual|type=transcript|length=413bpback to top protein sequence of SMED30026318-orf-1 >SMED30026318-orf-1 ID=SMED30026318-orf-1|Name=SMED30026318-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp MIYFNDFMIIYLNFSFIITGNLYPNFCNSPQHDGNCDTIMENYYSHTYNHback to top Annotated Terms
The following terms have been associated with this transcript:
|