GPI ethanolamine phosphate transferase 2

Overview
NameGPI ethanolamine phosphate transferase 2
Smed IDSMED30026317
Length (bp)2762
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GPI ethanolamine phosphate transferase 2 (SMED30026317) t-SNE clustered cells

Violin plots show distribution of expression levels for GPI ethanolamine phosphate transferase 2 (SMED30026317) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GPI ethanolamine phosphate transferase 2 (SMED30026317) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GPI ethanolamine phosphate transferase 2 (SMED30026317) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026317

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30026317SMESG000000707.1 SmedASXL_017517SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 209.149 bits (531), Expect = 1.912e-58
Identity = 126/329 (38.30%), Postives = 186/329 (56.53%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT--EKYSSFNDLNTG-VYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNS-------SLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI-DRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLH 1156
            KV++++IDALR D     K   F    T  V    S  +  + + P+VTMPRIK + TG +  F D+I NL S  +  D++I       K R+ F+GD+TW KLFP  F + D T SFFV DY EVDNNVTR++  ++    +WD+ I+HYLGLDHIGH+ GP S LI  KL+E+   + +I     H+S  +        +L+++ GDHGMS+ G HG ++  E+ T    IS+    K  D R P  + Q+D++  +AI  G+PIP +S G + + +++   RP+ ++ R L  N   L  L  EN+ S+  +  FE  +   E LH
Sbjct:   67 KVVIVLIDALRDDFVFGSKGVKFMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGK-RIVFYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKR-GDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKI-----HTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQENVPSYEKDPGFEQFKMS-ERLH 385          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 198.364 bits (503), Expect = 1.766e-56
Identity = 110/282 (39.01%), Postives = 164/282 (58.16%), Query Frame = 2
Query:  290 VYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNS-------SLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI-DRSRALFSNFFHLINLDLENLQSF 1111
            V    S  +  + + P+VTMPRIK + TG +  F D+I NL S  +  D++I       K R+ F+GD+TW KLFP  F + D T SFFV DY EVDNNVTR++  ++    +WD+ I+HYLGLDHIGH+ GP S LI  KL+E+   + +I     H+S  +        +L+++ GDHGMS+ G HG ++  E+ T    IS+    K  D R P  + Q+D++  +AI  G+PIP +S G + + +++   RP+ ++ R L  N   L  L  EN+ S+
Sbjct:    8 VEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGK-RIVFYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKR-GDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKI-----HTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQENVPSY 280          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 210.69 bits (535), Expect = 9.047e-56
Identity = 126/329 (38.30%), Postives = 186/329 (56.53%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT--EKYSSFNDLNTG-VYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNS-------SLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI-DRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLH 1156
            KV++++IDALR D     K   F    T  V    S  +  + + P+VTMPRIK + TG +  F D+I NL S  +  D++I       K R+ F+GD+TW KLFP  F + D T SFFV DY EVDNNVTR++  ++    +WD+ I+HYLGLDHIGH+ GP S LI  KL+E+   + +I     H+S  +        +L+++ GDHGMS+ G HG ++  E+ T    IS+    K  D R P  + Q+D++  +AI  G+PIP +S G + + +++   RP+ ++ R L  N   L  L  EN+ S+  +  FE  +   E LH
Sbjct:   67 KVVIVLIDALRDDFVFGSKGVKFMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGK-RIVFYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKR-GDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKI-----HTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQENVPSYEKDPGFEQFKMS-ERLH 385          

HSP 2 Score: 69.707 bits (169), Expect = 2.228e-11
Identity = 57/184 (30.98%), Postives = 94/184 (51.09%), Query Frame = 1
Query: 2155 RFKSVKLSNV---LLMLMIVICRPHNIVLLA-GFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLY 2694
            + K+V L  +   L++L  ++ RPHN+ +LA   + +  M + IW   LRH +  E  +     G   F+ QGNS++++TVDI  G+VG+  Y  +   +L    T+ G + W    + +LS    S S LSH       I             +    + +++ + +RYHLF+WSVF+P+LLY
Sbjct:  780 KLKTVGLWEIYSGLVLLAALLFRPHNLPVLAFSLLIQTLMTKFIW-KPLRH-DAAEITVMHYWFGQAFFYFQGNSNNIATVDISAGFVGLDTYVEIPAVLLTAFGTYAGPVLWASHLVHFLSSETRSGSALSHACFCYALIC------------SIPVFTYIVLVTSLRYHLFIWSVFSPKLLY 949          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 210.305 bits (534), Expect = 1.117e-55
Identity = 126/329 (38.30%), Postives = 186/329 (56.53%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT--EKYSSFNDLNTG-VYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNS-------SLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI-DRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLH 1156
            KV++++IDALR D     K   F    T  V    S  +  + + P+VTMPRIK + TG +  F D+I NL S  +  D++I       K R+ F+GD+TW KLFP  F + D T SFFV DY EVDNNVTR++  ++    +WD+ I+HYLGLDHIGH+ GP S LI  KL+E+   + +I     H+S  +        +L+++ GDHGMS+ G HG ++  E+ T    IS+    K  D R P  + Q+D++  +AI  G+PIP +S G + + +++   RP+ ++ R L  N   L  L  EN+ S+  +  FE  +   E LH
Sbjct:   67 KVVIVLIDALRDDFVFGSKGVKFMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGK-RIVFYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKR-GDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKI-----HTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQENVPSYEKDPGFEQFKMS-ERLH 385          

HSP 2 Score: 69.707 bits (169), Expect = 2.414e-11
Identity = 57/184 (30.98%), Postives = 94/184 (51.09%), Query Frame = 1
Query: 2155 RFKSVKLSNV---LLMLMIVICRPHNIVLLA-GFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLY 2694
            + K+V L  +   L++L  ++ RPHN+ +LA   + +  M + IW   LRH +  E  +     G   F+ QGNS++++TVDI  G+VG+  Y  +   +L    T+ G + W    + +LS    S S LSH       I             +    + +++ + +RYHLF+WSVF+P+LLY
Sbjct:  788 KLKTVGLWEIYSGLVLLAALLFRPHNLPVLAFSLLIQTLMTKFIW-KPLRH-DAAEITVMHYWFGQAFFYFQGNSNNIATVDISAGFVGLDTYVEIPAVLLTAFGTYAGPVLWASHLVHFLSSETRSGSALSHACFCYALIC------------SIPVFTYIVLVTSLRYHLFIWSVFSPKLLY 957          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 201.83 bits (512), Expect = 1.352e-55
Identity = 115/299 (38.46%), Postives = 171/299 (57.19%), Query Frame = 2
Query:  290 VYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNS-------SLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI-DRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLH 1156
            V    S  +  + + P+VTMPRIK + TG +  F D+I NL S  +  D++I       K R+ F+GD+TW KLFP  F + D T SFFV DY EVDNNVTR++  ++    +WD+ I+HYLGLDHIGH+ GP S LI  KL+E+   + +I     H+S  +        +L+++ GDHGMS+ G HG ++  E+ T    IS+    K  D R P  + Q+D++  +AI  G+PIP +S G + + +++   RP+ ++ R L  N   L  L  EN+ S+  +  FE  +   E LH
Sbjct:    8 VEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGK-RIVFYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKR-GDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKI-----HTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQENVPSYEKDPGFEQFKMS-ERLH 296          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596322:8599308:-1 gene:WBGene00009204.1 transcript:F28C6.4b.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 169.859 bits (429), Expect = 9.666e-44
Identity = 104/288 (36.11%), Postives = 155/288 (53.82%), Query Frame = 2
Query:  167 FKNTSQYFQKLSVDKVILIVIDALRFD-MTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSE-WDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHS-SFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDY-------RSPPTIDQSDLSTIIAILTGVPIPSNSRGV 1000
            FK+ +Q  +  S  +++ +VIDA R   +T   S  +   + +    +  +    + P+VT+PRI    TG + +F  ++ NL + E+   N I  + +  K +++FFGDDTW +L P  F+K +   SFFV DY +VDNNVTR++   ++N +  WD  I+HYLGLDHIGH  G  S  IP KL E+   I RI K +  S S    S +IV GDHGM+  G HGGA+ +E                 +Y       + PP I+Q D+S+ I  +  +PIP  S G+
Sbjct:   42 FKDGNQ--ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGK-KVHFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDDVIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596322:8599317:-1 gene:WBGene00009204.1 transcript:F28C6.4b.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 169.859 bits (429), Expect = 9.666e-44
Identity = 104/288 (36.11%), Postives = 155/288 (53.82%), Query Frame = 2
Query:  167 FKNTSQYFQKLSVDKVILIVIDALRFD-MTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSE-WDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHS-SFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDY-------RSPPTIDQSDLSTIIAILTGVPIPSNSRGV 1000
            FK+ +Q  +  S  +++ +VIDA R   +T   S  +   + +    +  +    + P+VT+PRI    TG + +F  ++ NL + E+   N I  + +  K +++FFGDDTW +L P  F+K +   SFFV DY +VDNNVTR++   ++N +  WD  I+HYLGLDHIGH  G  S  IP KL E+   I RI K +  S S    S +IV GDHGM+  G HGGA+ +E                 +Y       + PP I+Q D+S+ I  +  +PIP  S G+
Sbjct:   42 FKDGNQ--ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGK-KVHFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDDVIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596322:8600265:-1 gene:WBGene00009204.1 transcript:F28C6.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 169.859 bits (429), Expect = 9.666e-44
Identity = 104/288 (36.11%), Postives = 155/288 (53.82%), Query Frame = 2
Query:  167 FKNTSQYFQKLSVDKVILIVIDALRFD-MTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSE-WDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHS-SFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDY-------RSPPTIDQSDLSTIIAILTGVPIPSNSRGV 1000
            FK+ +Q  +  S  +++ +VIDA R   +T   S  +   + +    +  +    + P+VT+PRI    TG + +F  ++ NL + E+   N I  + +  K +++FFGDDTW +L P  F+K +   SFFV DY +VDNNVTR++   ++N +  WD  I+HYLGLDHIGH  G  S  IP KL E+   I RI K +  S S    S +IV GDHGM+  G HGGA+ +E                 +Y       + PP I+Q D+S+ I  +  +PIP  S G+
Sbjct:   42 FKDGNQ--ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGK-KVHFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDDVIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596300:8599308:-1 gene:WBGene00009204.1 transcript:F28C6.4a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 170.244 bits (430), Expect = 1.482e-43
Identity = 104/288 (36.11%), Postives = 155/288 (53.82%), Query Frame = 2
Query:  167 FKNTSQYFQKLSVDKVILIVIDALRFD-MTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSE-WDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHS-SFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDY-------RSPPTIDQSDLSTIIAILTGVPIPSNSRGV 1000
            FK+ +Q  +  S  +++ +VIDA R   +T   S  +   + +    +  +    + P+VT+PRI    TG + +F  ++ NL + E+   N I  + +  K +++FFGDDTW +L P  F+K +   SFFV DY +VDNNVTR++   ++N +  WD  I+HYLGLDHIGH  G  S  IP KL E+   I RI K +  S S    S +IV GDHGM+  G HGGA+ +E                 +Y       + PP I+Q D+S+ I  +  +PIP  S G+
Sbjct:   42 FKDGNQ--ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGK-KVHFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDDVIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          

HSP 2 Score: 51.2174 bits (121), Expect = 3.975e-6
Identity = 36/120 (30.00%), Postives = 64/120 (53.33%), Query Frame = 1
Query: 2338 MMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHV-SSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLY 2694
            M SFF  GNS+SLST+ + + YVG+  YQP+L+G+ L ++T+ G + ++        +     S L+H+ S RI  +  + +                    + + HLF+WSV++P+++Y
Sbjct:  634 MSSFFYTGNSNSLSTLSLTSAYVGLSSYQPILVGLQLMLYTFSGPILFLCG-----CNASSCTSLLNHLFSYRISSMCTSLIC-----------------LYIFQNHLFIWSVYSPKVVY 731          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Match: F28C6.4 (pep chromosome:WBcel235:II:8596286:8599317:-1 gene:WBGene00009204.1 transcript:F28C6.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F28C6.4)

HSP 1 Score: 170.244 bits (430), Expect = 1.482e-43
Identity = 104/288 (36.11%), Postives = 155/288 (53.82%), Query Frame = 2
Query:  167 FKNTSQYFQKLSVDKVILIVIDALRFD-MTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSE-WDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHS-SFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDY-------RSPPTIDQSDLSTIIAILTGVPIPSNSRGV 1000
            FK+ +Q  +  S  +++ +VIDA R   +T   S  +   + +    +  +    + P+VT+PRI    TG + +F  ++ NL + E+   N I  + +  K +++FFGDDTW +L P  F+K +   SFFV DY +VDNNVTR++   ++N +  WD  I+HYLGLDHIGH  G  S  IP KL E+   I RI K +  S S    S +IV GDHGM+  G HGGA+ +E                 +Y       + PP I+Q D+S+ I  +  +PIP  S G+
Sbjct:   42 FKDGNQ--ESSSSPRLVFMVIDAFRLSFLTSSKSPMSFTKSEITKKSAKLFDAYARMPTVTLPRITAYLTGTLPSFGTVLTNLATAEMKTANWISRIQKIGK-KVHFFGDDTWIRLLPRSFEKFEGVTSFFVSDYTDVDNNVTRHLDTELSNTNHSWDALILHYLGLDHIGHSLGGSSSKIPEKLKEMDDVIGRIHKYLKSSTSVDQESYLIVCGDHGMTAAGSHGGASPDETRVPVVIWKFGREEGNKNYGNQDDSLKQPPRIEQIDVSSTIFDVFNMPIPIESYGI 326          

HSP 2 Score: 51.2174 bits (121), Expect = 3.975e-6
Identity = 36/120 (30.00%), Postives = 64/120 (53.33%), Query Frame = 1
Query: 2338 MMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHV-SSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLY 2694
            M SFF  GNS+SLST+ + + YVG+  YQP+L+G+ L ++T+ G + ++        +     S L+H+ S RI  +  + +                    + + HLF+WSV++P+++Y
Sbjct:  634 MSSFFYTGNSNSLSTLSLTSAYVGLSSYQPILVGLQLMLYTFSGPILFLCG-----CNASSCTSLLNHLFSYRISSMCTSLIC-----------------LYIFQNHLFIWSVYSPKVVY 731          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Match: PIG-G (gene:FBgn0033187 transcript:FBtr0088904)

HSP 1 Score: 178.718 bits (452), Expect = 9.395e-46
Identity = 129/379 (34.04%), Postives = 207/379 (54.62%), Query Frame = 2
Query:  200 SVDKVILIVIDALRFDMTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRF-QKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLIN---LDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENL----IELLRRIQQLKLANSFQFNTLFMELGVLL 1312
            + D  +L+++DALR D  +  S         YS    + K+ +  P+VTMPR+K+ITTG +SNF D+ LN+  TE   D+ +  L +  +  ++F GD TW KLFP+ F ++V+  +SF+V D+YE D NVT+ +   +   S+W + I+HYLGLDHIGHVEG  S  +P KL E+ + + +IL    H SF N  L+++TGDHGM+D GGHGG T  E     +   N  N  K    S    +Q DL+  +++L  V IP+ S G +  ++LQ +     +  A F N  HL+N   +   +     S++ T       LH+   + ++ G+   + ++ ++N     + + R I  L   +  +F+  F+ +G+ L
Sbjct:   62 AYDSFVLLLVDALRDDFPDATSM-----PVAYSRACEKLKLHVDIPTVTMPRLKSITTGTLSNFIDIALNVGHTEQMQDSFLHRLKQQNRV-VSFAGDHTWVKLFPSEFTRQVENHDSFYVNDFYEGDRNVTKTLETELER-SDWSLLILHYLGLDHIGHVEGNASPRVPLKLKEMDEVVKKILD---HKSFPN-VLLMLTGDHGMADGGGHGGNTPAETLVPLYLYYN--NCSKTPSAS-KRYNQIDLAPTLSVLLSVEIPTLSIGCLIPEMLQSLSLE-HQLYAYFYNAHHLLNKARVKFGHEIVHRSDYYTWYQNATLLHKKLLRPLREGDGGGASQVYYQNAKLNYMRVAREISDLLSESLVKFDYGFIAVGLAL 425          

HSP 2 Score: 62.3882 bits (150), Expect = 1.781e-9
Identity = 42/140 (30.00%), Postives = 72/140 (51.43%), Query Frame = 1
Query: 2332 IGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFG--HLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSL 2745
            +  M FF QGNS+SLST+D+  GY+G   Y P ++ I +T++T+    H F  +V     SD  +    +  +       + + +   ++ +        + +    RYHLF++SVF+P++LY C+  LV    + V SL
Sbjct:  781 LARMFFFYQGNSNSLSTIDLTPGYIGQTNYNPSIVAIFVTLNTYSADIHAFLYLVVHTLRSD--LRSVGIMQLHPPYSIAADSLIAPLYAALIMLPAAFYLCLLVGFRYHLFIYSVFSPKVLYDCYTVLVFYLVFLVTSL 918          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Match: PIG-O (gene:FBgn0034346 transcript:FBtr0086691)

HSP 1 Score: 139.428 bits (350), Expect = 3.486e-33
Identity = 88/291 (30.24%), Postives = 150/291 (51.55%), Query Frame = 2
Query:  209 KVILIVIDALRFDMTEKYSSFNDLNTGVYSNISLRYKVKLQT--------------PSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRS-PPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRP 1036
            KVI++V+DAL+++     +  N  +   Y N  +  +  LQ               P+ T+ R+K +TTG +  F D+  N  S EI  DNIID ++++    + F GD TW  L+P+RF++     SF + D   VDN + +++   + +  +W + + H+LG+DH GH  GP  E +  KL E+++ I  ++     ++  N + ++V GDHGM+  G HGG T +E     F  S +      D  S    + Q DL   +A + GVPIP ++ G++ + ++  +  P
Sbjct:   78 KVIVLVVDALKYEFGLYRA--NATDPLPYENKLVVLQELLQQNPDHARLMRFRADPPTTTLQRLKGLTTGSLPTFIDIGSNFASPEINEDNIIDQIVKN-DLPVVFLGDSTWTDLYPHRFKRSYSYPSFDIFDLDSVDNEILKHLPKELES-KDWQVLVAHFLGVDHCGHKHGPMHEEMARKLGEMNEVIRSVV-----AAMDNDTTLLVMGDHGMTASGDHGGDTDDETNALLFAYSKQHRFYGNDSGSDSEMLQQIDLVPTLATILGVPIPYSNLGLVNFNIVPDLRVP 359          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Match: PIG-N (gene:FBgn0033479 transcript:FBtr0088431)

HSP 1 Score: 50.8322 bits (120), Expect = 6.501e-6
Identity = 72/299 (24.08%), Postives = 120/299 (40.13%), Query Frame = 2
Query:  203 VDKVILIVIDALRFDMTEKYSSFNDLNTGVYSN---ISLRYKV----KLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFR----LNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEW------DMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISN--------KLNLKKF--DYRSPPT----IDQSDLSTIIAILTGVPIPSNSRGVIP 1006
             ++++LIV D  R D      SF + N     N   I LR  V    + + P+ T P   T+  G   +   ++   KS  I  D + +   +   +     LN F   +       RF   DL  S    D YE D  V + +  ++    E        +  +H LGLD  GHV  P +      L +  + +  I +E         +  ++T DHGM+D G HG  + +E T + F +          K   + F  +   P      ++Q+ L+ +++ L G+  P N+ G +P
Sbjct:   45 ANRLVLIVTDGFRAD------SFFEENCRYVPNLRKIFLREGVVGVSRTRVPTETRPGHITLIAGLYEDPSAVLRGWKSNPIDFDTVFNRSSQTYAWGANDVLNVFSHVSNGGEINLRFYNHDLDFSP-GYDAYEEDEWVFKRVKLLLQQKREALQRAQNVVFFLHLLGLDTAGHVHKPGAPKFRRTLEKTEKGVYAIYQEFERVFPDKRTAYLLTADHGMTDSGAHGSGSPHE-TDTPFMLWGAGASRAVPKPGGRTFMPNNEGPAMPLHELEQAQLTPLMSALLGLAPPMNNFGKLP 335          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Zebrafish
Match: PIGG (si:ch73-49o8.1 [Source:ZFIN;Acc:ZDB-GENE-141215-6])

HSP 1 Score: 207.223 bits (526), Expect = 8.047e-55
Identity = 113/274 (41.24%), Postives = 162/274 (59.12%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT-----EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEIL--HSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRG-VIP 1006
            +V++++IDALR D        ++  +      V    S  +  K + P+VTMPRIK +TTG I  F D+++NL S  +  DN+I       K R+ F+GDDTW +LFP  F + D T SFFV DY EVDNNVTR++   +    +WD+ I+HYLGLDHIGH+ GP S LI PKL E+   I +I   ++   S  +  +L++V GDHGMS+ G HGG++  E+ T+   IS     +K     P  ++Q DL+  +A+  G+PI  NS G +IP
Sbjct:   68 RVVIVLIDALREDFVFSSNGRRFMPYT--RHVVEKGSSHSFIAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPVLLEDNLIWQAKSAGK-RIIFYGDDTWVRLFPKHFMEQDGTTSFFVSDYTEVDNNVTRHLDSTLKR-DDWDILILHYLGLDHIGHISGPHSSLIGPKLMEMDDIIKKIHASLISKESEGTLPNLLVVCGDHGMSETGSHGGSSEQEINTALVLISPAFR-RKVGLERPAVVEQVDLAPTLALGLGLPISQNSVGRLIP 336          

HSP 2 Score: 58.151 bits (139), Expect = 4.687e-8
Identity = 58/197 (29.44%), Postives = 92/197 (46.70%), Query Frame = 1
Query: 2152 SRFKSVKLSNV---LLMLMIVICRPHNIVLLAG-FVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSD-----LSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLV 2715
             R KS  L  V   +++L+ ++ R HN+  LA   + +  M + IW     H +  +  +     G   F+ QGNS+++ TVDI  G+VG+  Y      IL  + T+ G L W    + +LS    SQ+D     L H S     +     V              +++ + +RYHLF+WSVF+P+LLY     L+
Sbjct:  775 GRLKSRGLWEVYSGVVLLVALLFRAHNLPTLACCLLVQTIMAQFIW--KKLHYDAAQTTIMHYWFGQAFFYFQGNSNNIGTVDISVGFVGLESYVEAPAIILTALSTYAGPLLWACHLLCYLS----SQTDRVVNGLGHGSYCFALLRSIPAV------------FYVVLVTALRYHLFIWSVFSPKLLYEAMHTLI 953          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Zebrafish
Match: pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:ZFIN;Acc:ZDB-GENE-091204-80])

HSP 1 Score: 165.622 bits (418), Expect = 2.478e-41
Identity = 121/406 (29.80%), Postives = 196/406 (48.28%), Query Frame = 2
Query:  209 KVILIVIDALRFDMTEKYSSFN-------------DLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFI--SNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVI-----PYQLLQLIDRPIDRSRALFSNFFHL-----------INLDLENLQSFSSEFETIRNK-IESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFV 1330
            + ++++IDAL+ D T +Y   N             D     +S+ +  Y  +   P+ TM RIK  TTG +  F D+  N  S  I  DN++  L +  K R+ F GDDTW  LFP +F +     SF VKD + VDN + +NI   M    +WD+ I H+LG+DH GH  GP    +  KL+++   I  ++K +      N +L++V GDHGM+D G HGG +  E T +A F+  S+ L         P  + Q+DL   +A+L GVPIP +S G +     P    +     + ++ AL+ N   +            ++  ++L    ++F  I ++ + ++H+     +K       L I  +N +  +R   +   A   +FN   M  G+L+L +S V
Sbjct:   64 RAVVLIIDALKADFT-RYDPENAAPKPFENKLPVLDEMASAHSSHARLYTFRADPPTTTMQRIKGFTTGSLPTFIDVGNNFASNAILEDNLVHQLGQVGK-RVVFMGDDTWVSLFPKKFHRSLPFPSFNVKDLHTVDNGILQNIYPTMEG-DDWDVLIAHFLGVDHCGHRFGPDHPAMAEKLSQMDGVIRSVIKRL-----KNDTLLVVMGDHGMTDTGDHGGESQKE-TDAALFLYSSSPLFPAPGSQVEPEVVPQTDLVPTLALLLGVPIPYSSVGQVLLPLFPQNGSRGAPTGLSQAEALWINVKQVNRFLETYSNMAKDIPPDSLSQLQADFSNISSQYLSAVHKGHLPPLK-------LVISMQNYLTAVRETCRASWA---RFNPFKMAAGLLILAVSCV 450          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:100487165])

HSP 1 Score: 222.631 bits (566), Expect = 8.027e-60
Identity = 133/338 (39.35%), Postives = 193/338 (57.10%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT-----EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIR-NKIESLHEICEKSIKPGNCTESL 1204
            KV++++IDALR D       +K+  +  L   V    +  +  K   P+VTMPRIK + TG I  F D+++NL S E+ +DN+I    +  K R+ F+GDDTW KLFP  F + D T SFFV DY EVDNNVTR++  ++   ++WDM I+HYLGLDHIGH+ GP S L+ PKL E+   + +I  E      S  SLI++ GDHGMS+ G HGG++  E+ T    IS+    K    + P  I Q+D++  +AI  G+PIP NS G++  Q ++      ++ R L  N   L  L  +NL+++  +    +  K E  H    K    GN +E+L
Sbjct:   67 KVVVLLIDALRQDFVYGPKGKKHMPY--LTQLVEKGTTHSFIAKAAAPTVTMPRIKALMTGSIPGFIDVVMNLNSHELLDDNVIWQGKQAGK-RIVFYGDDTWIKLFPKHFAEYDGTTSFFVSDYTEVDNNVTRHLDDILKR-NDWDMLILHYLGLDHIGHLTGPHSHLVGPKLLEMDTVLKKISVE---EDISVPSLIVLCGDHGMSETGSHGGSSEEEVQTPLVLISSAFEEKGGISKLPEIIQQTDIAPTLAISLGLPIPQNSLGILVPQTVEHKSMR-EQLRFLHLNGHQLCMLLRQNLEAYEKDAGVEQFKKAEKSHGNWIKLYLEGNTSETL 396          

HSP 2 Score: 53.1434 bits (126), Expect = 2.528e-6
Identity = 60/192 (31.25%), Postives = 99/192 (51.56%), Query Frame = 1
Query: 2188 LMLMIVICRPHNIVLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIH-TWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ 2760
            ++L  ++ RPHN+V+L   +  +  L  ++++NL   +  +  +     G   FF QGNS+++STVDI  G+VGM  Y   L  I LT+  T+ G L W I  + +LS      S+   VS+ +     A     ++ I +      +L+ +  RYHLF+WSVF+P+LLY     L+      + + +  NQ
Sbjct:  797 ILLAALLYRPHNLVVLVFCLLMQTTLS-MFIWNLLKHDAAQITIMHYWFGQAFFFFQGNSNTISTVDISAGFVGMENYVE-LPAIFLTMFITYSGPLLWAIHLLWYLS------SETHRVSTTV-----AHGCYCYAAIRSIPVTVYILVVTAFRYHLFIWSVFSPKLLYEAIHLLISAGVCVMFTAVDKNQ 975          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:100487165])

HSP 1 Score: 222.246 bits (565), Expect = 1.268e-59
Identity = 132/340 (38.82%), Postives = 194/340 (57.06%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT-----EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEIL--HSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIR-NKIESLHEICEKSIKPGNCTESL 1204
            KV++++IDALR D       +K+  +  L   V    +  +  K   P+VTMPRIK + TG I  F D+++NL S E+ +DN+I    +  K R+ F+GDDTW KLFP  F + D T SFFV DY EVDNNVTR++  ++   ++WDM I+HYLGLDHIGH+ GP S L+ PKL E+   + +I   ++      S  SLI++ GDHGMS+ G HGG++  E+ T    IS+    K    + P  I Q+D++  +AI  G+PIP NS G++  Q ++      ++ R L  N   L  L  +NL+++  +    +  K E  H    K    GN +E+L
Sbjct:   67 KVVVLLIDALRQDFVYGPKGKKHMPY--LTQLVEKGTTHSFIAKAAAPTVTMPRIKALMTGSIPGFIDVVMNLNSHELLDDNVIWQGKQAGK-RIVFYGDDTWIKLFPKHFAEYDGTTSFFVSDYTEVDNNVTRHLDDILKR-NDWDMLILHYLGLDHIGHLTGPHSHLVGPKLLEMDTVLKKISVALMSQEEDISVPSLIVLCGDHGMSETGSHGGSSEEEVQTPLVLISSAFEEKGGISKLPEIIQQTDIAPTLAISLGLPIPQNSLGILVPQTVEHKSMR-EQLRFLHLNGHQLCMLLRQNLEAYEKDAGVEQFKKAEKSHGNWIKLYLEGNTSETL 401          

HSP 2 Score: 53.1434 bits (126), Expect = 2.364e-6
Identity = 60/192 (31.25%), Postives = 99/192 (51.56%), Query Frame = 1
Query: 2188 LMLMIVICRPHNIVLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIH-TWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ 2760
            ++L  ++ RPHN+V+L   +  +  L  ++++NL   +  +  +     G   FF QGNS+++STVDI  G+VGM  Y   L  I LT+  T+ G L W I  + +LS      S+   VS+ +     A     ++ I +      +L+ +  RYHLF+WSVF+P+LLY     L+      + + +  NQ
Sbjct:  800 ILLAALLYRPHNLVVLVFCLLMQTTLS-MFIWNLLKHDAAQITIMHYWFGQAFFFFQGNSNTISTVDISAGFVGMENYVE-LPAIFLTMFITYSGPLLWAIHLLWYLS------SETHRVSTTV-----AHGCYCYAAIRSIPVTVYILVVTAFRYHLFIWSVFSPKLLYEAIHLLISAGVCVMFTAVDKNQ 978          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:100487165])

HSP 1 Score: 221.861 bits (564), Expect = 1.531e-59
Identity = 132/340 (38.82%), Postives = 194/340 (57.06%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT-----EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEIL--HSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIR-NKIESLHEICEKSIKPGNCTESL 1204
            KV++++IDALR D       +K+  +  L   V    +  +  K   P+VTMPRIK + TG I  F D+++NL S E+ +DN+I    +  K R+ F+GDDTW KLFP  F + D T SFFV DY EVDNNVTR++  ++   ++WDM I+HYLGLDHIGH+ GP S L+ PKL E+   + +I   ++      S  SLI++ GDHGMS+ G HGG++  E+ T    IS+    K    + P  I Q+D++  +AI  G+PIP NS G++  Q ++      ++ R L  N   L  L  +NL+++  +    +  K E  H    K    GN +E+L
Sbjct:   67 KVVVLLIDALRQDFVYGPKGKKHMPY--LTQLVEKGTTHSFIAKAAAPTVTMPRIKALMTGSIPGFIDVVMNLNSHELLDDNVIWQGKQAGK-RIVFYGDDTWIKLFPKHFAEYDGTTSFFVSDYTEVDNNVTRHLDDILKR-NDWDMLILHYLGLDHIGHLTGPHSHLVGPKLLEMDTVLKKISVALMSQEEDISVPSLIVLCGDHGMSETGSHGGSSEEEVQTPLVLISSAFEEKGGISKLPEIIQQTDIAPTLAISLGLPIPQNSLGILVPQTVEHKSMR-EQLRFLHLNGHQLCMLLRQNLEAYEKDAGVEQFKKAEKSHGNWIKLYLEGNTSETL 401          

HSP 2 Score: 53.1434 bits (126), Expect = 2.260e-6
Identity = 60/192 (31.25%), Postives = 99/192 (51.56%), Query Frame = 1
Query: 2188 LMLMIVICRPHNIVLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIH-TWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ 2760
            ++L  ++ RPHN+V+L   +  +  L  ++++NL   +  +  +     G   FF QGNS+++STVDI  G+VGM  Y   L  I LT+  T+ G L W I  + +LS      S+   VS+ +     A     ++ I +      +L+ +  RYHLF+WSVF+P+LLY     L+      + + +  NQ
Sbjct:  791 ILLAALLYRPHNLVVLVFCLLMQTTLS-MFIWNLLKHDAAQITIMHYWFGQAFFFFQGNSNTISTVDISAGFVGMENYVE-LPAIFLTMFITYSGPLLWAIHLLWYLS------SETHRVSTTV-----AHGCYCYAAIRSIPVTVYILVVTAFRYHLFIWSVFSPKLLYEAIHLLISAGVCVMFTAVDKNQ 969          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: PIGG (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:100487165])

HSP 1 Score: 178.333 bits (451), Expect = 2.248e-45
Identity = 118/338 (34.91%), Postives = 177/338 (52.37%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT-----EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIR-NKIESLHEICEKSIKPGNCTESL 1204
            KV++++IDALR D       +K+  +  L   V    +  +  K   P+VTMPRIK + TG I  F D+++NL S E+ +DN+I    +  K R+ F+GDDTW KLFP  F + D T SFFV DY EVDNNVTR++  ++   ++WDM I+HYLGLDHIGH+ GP S L+                ++  +  S S++              HGG++  E+ T    IS+    K    + P  I Q+D++  +AI  G+PIP NS G++  Q ++      ++ R L  N   L  L  +NL+++  +    +  K E  H    K    GN +E+L
Sbjct:   67 KVVVLLIDALRQDFVYGPKGKKHMPY--LTQLVEKGTTHSFIAKAAAPTVTMPRIKALMTGSIPGFIDVVMNLNSHELLDDNVIWQGKQAGK-RIVFYGDDTWIKLFPKHFAEYDGTTSFFVSDYTEVDNNVTRHLDDILKR-NDWDMLILHYLGLDHIGHLTGPHSHLV----------------DVFKNLISKSNIFC-----------SHGGSSEEEVQTPLVLISSAFEEKGGISKLPEIIQQTDIAPTLAISLGLPIPQNSLGILVPQTVEHKSMR-EQLRFLHLNGHQLCMLLRQNLEAYEKDAGVEQFKKAEKSHGNWIKLYLEGNTSETL 372          

HSP 2 Score: 53.5286 bits (127), Expect = 1.716e-6
Identity = 60/192 (31.25%), Postives = 99/192 (51.56%), Query Frame = 1
Query: 2188 LMLMIVICRPHNIVLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIH-TWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ 2760
            ++L  ++ RPHN+V+L   +  +  L  ++++NL   +  +  +     G   FF QGNS+++STVDI  G+VGM  Y   L  I LT+  T+ G L W I  + +LS      S+   VS+ +     A     ++ I +      +L+ +  RYHLF+WSVF+P+LLY     L+      + + +  NQ
Sbjct:  779 ILLAALLYRPHNLVVLVFCLLMQTTLS-MFIWNLLKHDAAQITIMHYWFGQAFFFFQGNSNTISTVDISAGFVGMENYVE-LPAIFLTMFITYSGPLLWAIHLLWYLS------SETHRVSTTV-----AHGCYCYAAIRSIPVTVYILVVTAFRYHLFIWSVFSPKLLYEAIHLLISAGVCVMFTAVDKNQ 957          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Match: pigo (phosphatidylinositol glycan anchor biosynthesis class O [Source:NCBI gene;Acc:100145458])

HSP 1 Score: 123.635 bits (309), Expect = 4.255e-28
Identity = 65/179 (36.31%), Postives = 100/179 (55.87%), Query Frame = 2
Query:  473 RLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIP-SNSRGVIP 1006
            R+ F GDDTWD LFP +F K     SF VKD + VDN + +++ Y   +  +WD+ I H+LG+DH GH  GP       KL +++Q I+ +++ +        +L++V GDHGM+D G HGG +  E+  + F  S          +   T+ Q +L   +++L G+PIP SN   V+P
Sbjct:   13 RVVFMGDDTWDGLFPKKFFKSYFFPSFNVKDLHTVDNGILQHL-YPTRDSGDWDVIIAHFLGVDHCGHKHGPDHPETANKLAQMNQVISSLVEHL-----DEETLLLVAGDHGMTDTGDHGGDSEKEVMAALFLYSKSPLFSHELSKEAETVPQVNLVPTLSLLLGLPIPYSNLGAVMP 185          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigg (phosphatidylinositol glycan anchor biosynthesis, class G [Source:MGI Symbol;Acc:MGI:3576484])

HSP 1 Score: 211.075 bits (536), Expect = 5.122e-56
Identity = 122/325 (37.54%), Postives = 182/325 (56.00%), Query Frame = 2
Query:  206 DKVILIVIDALRFDMTEKYSSFNDLNTGVY---SNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSN--SSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI-DRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLH 1156
             KV++++IDALR D          +    Y      S  +  + + P+VTMPRIK + TG +  F D+I NL S  +  DN++       K R+ F+GD+TW KLFP  F + D T SFFV DY EVD NVTR++  ++    +WD+ I+HYLGLDHIGH+ GP S LI  KL+E+   + +I   +L         SL+++ GDHGMS+ G HG ++  E++T    IS+    K  D R P  + Q+DL+  +AI  G+PIP +S G + + +++   +P+ ++ R L  N   L  L  EN+ S+  +  FE  +   E LH
Sbjct:   66 SKVVIVLIDALRDDFVFGSKGVKYMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPVLLEDNVLRQAKAAGK-RIIFYGDETWVKLFPKHFVEYDGTTSFFVSDYIEVDKNVTRHLDKVLKR-GDWDVLILHYLGLDHIGHISGPNSPLIGHKLSEMDSVLMKIHTSLLSKDRETLLPSLLVLCGDHGMSETGSHGASSTEEVSTPLLLISSAFERKPGDIRHPKHVQQTDLAATLAIGLGLPIPKDSVGSLLFPVIE--GKPMREQLRFLHLNTLQLSKLLQENVPSYEKDPGFEQFKMA-EKLH 385          

HSP 2 Score: 62.3882 bits (150), Expect = 2.886e-9
Identity = 51/168 (30.36%), Postives = 84/168 (50.00%), Query Frame = 1
Query: 2212 RPHNIVLLA-GFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVS------SRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLY 2694
            RPHN+ +LA   + +  M + IW   LRH +  E  +     G   F+ QGNS++++T+DI  G+VG+  Y  V    L    T+ G + W    + +LS    S+ + S +S      + I  + +A  +               ++ + +RYHLF+WSVF+P+LLY
Sbjct:  811 RPHNLPVLAFSLLIQTVMTKFIW-KPLRH-DAAEITVMHYWFGQAFFYFQGNSNNIATIDISAGFVGLDTYMEVPATFLTVFGTYVGPVLWASHLVYFLS----SEGNNSALSRSCFCYALICSVPVATYI---------------VLVTSLRYHLFIWSVFSPKLLY 957          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigg (phosphatidylinositol glycan anchor biosynthesis, class G [Source:MGI Symbol;Acc:MGI:3576484])

HSP 1 Score: 210.69 bits (535), Expect = 5.513e-56
Identity = 122/325 (37.54%), Postives = 182/325 (56.00%), Query Frame = 2
Query:  206 DKVILIVIDALRFDMTEKYSSFNDLNTGVY---SNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSN--SSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI-DRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLH 1156
             KV++++IDALR D          +    Y      S  +  + + P+VTMPRIK + TG +  F D+I NL S  +  DN++       K R+ F+GD+TW KLFP  F + D T SFFV DY EVD NVTR++  ++    +WD+ I+HYLGLDHIGH+ GP S LI  KL+E+   + +I   +L         SL+++ GDHGMS+ G HG ++  E++T    IS+    K  D R P  + Q+DL+  +AI  G+PIP +S G + + +++   +P+ ++ R L  N   L  L  EN+ S+  +  FE  +   E LH
Sbjct:   66 SKVVIVLIDALRDDFVFGSKGVKYMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPVLLEDNVLRQAKAAGK-RIIFYGDETWVKLFPKHFVEYDGTTSFFVSDYIEVDKNVTRHLDKVLKR-GDWDVLILHYLGLDHIGHISGPNSPLIGHKLSEMDSVLMKIHTSLLSKDRETLLPSLLVLCGDHGMSETGSHGASSTEEVSTPLLLISSAFERKPGDIRHPKHVQQTDLAATLAIGLGLPIPKDSVGSLLFPVIE--GKPMREQLRFLHLNTLQLSKLLQENVPSYEKDPGFEQFKMA-EKLH 385          

HSP 2 Score: 62.3882 bits (150), Expect = 2.734e-9
Identity = 51/168 (30.36%), Postives = 84/168 (50.00%), Query Frame = 1
Query: 2212 RPHNIVLLA-GFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVS------SRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLY 2694
            RPHN+ +LA   + +  M + IW   LRH +  E  +     G   F+ QGNS++++T+DI  G+VG+  Y  V    L    T+ G + W    + +LS    S+ + S +S      + I  + +A  +               ++ + +RYHLF+WSVF+P+LLY
Sbjct:  803 RPHNLPVLAFSLLIQTVMTKFIW-KPLRH-DAAEITVMHYWFGQAFFYFQGNSNNIATIDISAGFVGLDTYMEVPATFLTVFGTYVGPVLWASHLVYFLS----SEGNNSALSRSCFCYALICSVPVATYI---------------VLVTSLRYHLFIWSVFSPKLLY 949          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:MGI Symbol;Acc:MGI:1861452])

HSP 1 Score: 147.902 bits (372), Expect = 2.772e-36
Identity = 93/287 (32.40%), Postives = 142/287 (49.48%), Query Frame = 2
Query:  206 DKVILIVIDALRFDMTEKYSSFNDLNTGVYSNI-----SLR------------YKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQL 1015
             +V+L++IDALRFD  +   S       V         SL+            Y+ ++  P+ TM R+K +TTG +  F D   N  S  I  DN+I  L    + R+ F GDDTW  LFP  F +    +SF V+D + VDN +  ++ Y   +   WD+ I H+LG+DH GH  GP    +  KL+++ Q I  +++ +      N +L++V GDHGM+  G HGG +  E++ + F  S            P  I Q  L   +A+L G+PIP  + G +  +L
Sbjct:   71 SRVVLVLIDALRFDFAQPQRSHVPGEPPVSVPFLGKLGSLQRILESQPHHGRLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNVIQQLNSAGR-RVVFMGDDTWRDLFPGAFSQAFFFSSFNVRDLHTVDNGILEHL-YPTLDGGSWDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLIERL-----ENDTLLVVAGDHGMTMNGDHGGDSELEVSAALFLYSPTALFPSVPPEEPEVIPQVSLVPTLALLLGLPIPFGNTGEVMAEL 350          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:MGI Symbol;Acc:MGI:1861452])

HSP 1 Score: 147.132 bits (370), Expect = 1.721e-35
Identity = 92/283 (32.51%), Postives = 140/283 (49.47%), Query Frame = 2
Query:  206 DKVILIVIDALRFDMTEKYSSFNDLNTGVYSNI-----SLR------------YKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVI 1003
             +V+L++IDALRFD  +   S       V         SL+            Y+ ++  P+ TM R+K +TTG +  F D   N  S  I  DN+I  L    + R+ F GDDTW  LFP  F +    +SF V+D + VDN +  ++ Y   +   WD+ I H+LG+DH GH  GP    +  KL+++ Q I  +++ +      N +L++V GDHGM+  G HGG +  E++ + F  S            P  I Q  L   +A+L G+PIP  + G +
Sbjct:   68 SRVVLVLIDALRFDFAQPQRSHVPGEPPVSVPFLGKLGSLQRILESQPHHGRLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNVIQQLNSAGR-RVVFMGDDTWRDLFPGAFSQAFFFSSFNVRDLHTVDNGILEHL-YPTLDGGSWDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLIERL-----ENDTLLVVAGDHGMTMNGDHGGDSELEVSAALFLYSPTALFPSVPPEEPEVIPQVSLVPTLALLLGLPIPFGNTGEV 343          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Match: Pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:MGI Symbol;Acc:MGI:1861452])

HSP 1 Score: 147.132 bits (370), Expect = 1.728e-35
Identity = 92/283 (32.51%), Postives = 140/283 (49.47%), Query Frame = 2
Query:  206 DKVILIVIDALRFDMTEKYSSFNDLNTGVYSNI-----SLR------------YKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVI 1003
             +V+L++IDALRFD  +   S       V         SL+            Y+ ++  P+ TM R+K +TTG +  F D   N  S  I  DN+I  L    + R+ F GDDTW  LFP  F +    +SF V+D + VDN +  ++ Y   +   WD+ I H+LG+DH GH  GP    +  KL+++ Q I  +++ +      N +L++V GDHGM+  G HGG +  E++ + F  S            P  I Q  L   +A+L G+PIP  + G +
Sbjct:   76 SRVVLVLIDALRFDFAQPQRSHVPGEPPVSVPFLGKLGSLQRILESQPHHGRLYRSQVDPPTTTMQRLKALTTGSLPTFIDAGSNFASHAIVEDNVIQQLNSAGR-RVVFMGDDTWRDLFPGAFSQAFFFSSFNVRDLHTVDNGILEHL-YPTLDGGSWDVLIAHFLGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLIERL-----ENDTLLVVAGDHGMTMNGDHGGDSELEVSAALFLYSPTALFPSVPPEEPEVIPQVSLVPTLALLLGLPIPFGNTGEV 351          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|Q5H8A4|PIGG_HUMAN (GPI ethanolamine phosphate transferase 2 OS=Homo sapiens OX=9606 GN=PIGG PE=1 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 5.362e-55
Identity = 126/329 (38.30%), Postives = 186/329 (56.53%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT--EKYSSFNDLNTG-VYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNS-------SLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI-DRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLH 1156
            KV++++IDALR D     K   F    T  V    S  +  + + P+VTMPRIK + TG +  F D+I NL S  +  D++I       K R+ F+GD+TW KLFP  F + D T SFFV DY EVDNNVTR++  ++    +WD+ I+HYLGLDHIGH+ GP S LI  KL+E+   + +I     H+S  +        +L+++ GDHGMS+ G HG ++  E+ T    IS+    K  D R P  + Q+D++  +AI  G+PIP +S G + + +++   RP+ ++ R L  N   L  L  EN+ S+  +  FE  +   E LH
Sbjct:   67 KVVIVLIDALRDDFVFGSKGVKFMPYTTYLVEKGASHSFVAEAKPPTVTMPRIKALMTGSLPGFVDVIRNLNSPALLEDSVIRQAKAAGK-RIVFYGDETWVKLFPKHFVEYDGTTSFFVSDYTEVDNNVTRHLDKVLKR-GDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKI-----HTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVAATLAIALGLPIPKDSVGSLLFPVVE--GRPMREQLRFLHLNTVQLSKLLQENVPSYEKDPGFEQFKMS-ERLH 385          

HSP 2 Score: 69.707 bits (169), Expect = 1.159e-10
Identity = 57/184 (30.98%), Postives = 94/184 (51.09%), Query Frame = 1
Query: 2155 RFKSVKLSNV---LLMLMIVICRPHNIVLLA-GFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLY 2694
            + K+V L  +   L++L  ++ RPHN+ +LA   + +  M + IW   LRH +  E  +     G   F+ QGNS++++TVDI  G+VG+  Y  +   +L    T+ G + W    + +LS    S S LSH       I             +    + +++ + +RYHLF+WSVF+P+LLY
Sbjct:  788 KLKTVGLWEIYSGLVLLAALLFRPHNLPVLAFSLLIQTLMTKFIW-KPLRH-DAAEITVMHYWFGQAFFYFQGNSNNIATVDISAGFVGLDTYVEIPAVLLTAFGTYAGPVLWASHLVHFLSSETRSGSALSHACFCYALIC------------SIPVFTYIVLVTSLRYHLFIWSVFSPKLLY 957          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|Q6CLN2|GPI7_KLULA (GPI ethanolamine phosphate transferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=LAS21 PE=3 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 3.816e-54
Identity = 142/430 (33.02%), Postives = 212/430 (49.30%), Query Frame = 2
Query:  209 KVILIVIDALRFDM--TEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITN-----DNIIDILIEHRKFRLNFFGDDTWDKLFP-NRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKF------------------DYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPISKGTFPYCLRAFIHFIGLSVI 1420
            K++L+VIDALR D    +  S F  L+  + S  +  Y      P+VT+PR+K ITTG   NF D ILN+   + ++     D+++     H  +++NFFGDDTW KLFP   F + D TNSFFV D+ EVD NVTR++ Y M +   WD+ I+HYLGLDHIGH  G  S  +P K  E+   I +I ++I        +L++V GDHGM+DLG HGG++  E + +  F+S +  LKK+                  DY+    ++Q D+   +++L  +PIP NS GVI  +LLQL+   +   +    N+  L  L                              KPG   +  K     L+E +R IQ      +  +N  F+  G  L+ I  + +    F +S        + +I  +G SV+
Sbjct:   53 KLVLVVIDALRSDFLFQKDSSDFEFLHGLLNSGEAWGYTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDTSSNLKEQDSLLKQFHTHH-YKMNFFGDDTWLKLFPLEFFSEYDGTNSFFVSDFEEVDFNVTRHVPYQMEHQKNWDVLILHYLGLDHIGHKGGSKSHFMPSKHREMDSVIKQIYEKI-----DGDTLMVVLGDHGMNDLGNHGGSSSGETSAALAFLSKR--LKKYQSSDIQQSSNVPVEDAHPDYKYLKEVEQIDIVPTLSMLFNLPIPKNSMGVIIDELLQLLPSKLAAIKVQ-DNYLQLTKL------------------------------KPGYEAQLEKKSAGTLLEEMREIQSSLAMAATNYNYTFLTYGTTLMIIGTLIVTVWNFQLS--------QEYIEHVGTSVL 435          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|P40367|GPI7_YEAST (GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAS21 PE=1 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 7.567e-54
Identity = 126/350 (36.00%), Postives = 190/350 (54.29%), Query Frame = 2
Query:  209 KVILIVIDALRFDM--TEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITND-----NIIDILIEHRKFRLNFFGDDTWDKLFPNR-FQKVDLTNSFFVKDYYEVDNNVTRNI-AYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNL-----KKFDYRSP------------PTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEF--ETIRNKIESLHEICEKS 1174
            K++ ++IDALR D     + S FN+++  + +  +  Y      P+VT+PR+K+ITTG   +F DL+LN+     +ND     + +   I+H    + F GDDTW KLFP + F   D T+SFFV D+ +VDNNVTRN+   +    ++WD+ I+HYLGLDHIGH +GP S+ +  K  E+   +  I  E+L     + +LI V GDHGM++LG HGG++  E +    F+S KL        + +Y  P             T+ Q D+   IA L G+PIP NS G+I    LQL+    ++  ++  NF HL  L   + +    +F  E I  K+ ++ E   KS
Sbjct:   53 KLVFVIIDALRSDFLFDSQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLSEHDSWLQQFIQHNN-TIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQVDNNVTRNLPGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSIYDEVLEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTLPINASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLP---NKLASMKENFMHLWKLSDHHGEVALDDFTAEDIYTKMYTIQETLTKS 398          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|Q4WDM5|GPI7_ASPFU (GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=las21 PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 1.032e-53
Identity = 131/398 (32.91%), Postives = 201/398 (50.50%), Query Frame = 2
Query:  206 DKVILIVIDALRFDMT-EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLK----STEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSP----------PTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFP 1354
            D+VI +VIDALR D    K S F+   + + S  +L +     +P+VTMPR+K +TTG + +F D+ILN+     S+ +   +     I+ +  +L  +GDDTW KLFP  F + D T SFFV D+ EVD+NVTR++   ++   +W   IMH+LGLDHIGH  GP S  +  K  E+   +  I   +       S+L ++ GDHGM+D G HGG++  E++ +  FIS K   K     SP           T++Q D++  +A L G+PIP NS GV   + L + D           N  H I++ L N +   S  +     ++      E    P  C +           +LR  Q +  + + ++NT  + LG   LF++ + +L   FP
Sbjct:   55 DRVIFMVIDALRSDFVYSKTSGFSFTQSLIRSGAALPFTAHASSPTVTMPRLKAMTTGSVPSFLDVILNIAESDTSSTLAYQDTWLAQIKAQGGQLVMYGDDTWIKLFPGVFDRCDGTTSFFVSDFTEVDHNVTRHVPRELSE-RDWSAFIMHFLGLDHIGHKAGPKSRHMMTKQREMDSIVALIYAAMEEQEHLQSTLFVLCGDHGMNDAGNHGGSSPGEISPALLFISPKFQTKTTPEDSPVEAFSDLQYYRTVEQVDITPTLAGLLGLPIPLNSLGVFIPEFLMMWD-----------NDAHRIDILLRNAKQMLSAMKGTFPDLD-----VEAITPPHGCDK----------HVLRSAQDVMSSTASKYNTTRLYLG---LFVAALAVLLSFFP 422          
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Match: sp|Q758B8|GPI7_ASHGO (GPI ethanolamine phosphate transferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=LAS21 PE=3 SV=2)

HSP 1 Score: 199.134 bits (505), Expect = 7.508e-52
Identity = 120/319 (37.62%), Postives = 174/319 (54.55%), Query Frame = 2
Query:  200 SVDKVILIVIDALRFDM--TEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITN-----DNIIDILIEHRKFRLNFFGDDTWDKLFPNRF-QKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLN---------------LKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINL 1087
            + DK++L+VIDALR D    +  S F+ ++  +    +  +      P+VT+PR+K ITTG   NF D ILN+   + ++     D+ I    +H K +++FFGDDTW KLFP  F QK D TNSFFV D+ EVD NVTR++ + + +  +WD+ I+HYLGLDHIGH  G  S+ +PPK  E+   I +I  ++      N +L+ V GDHGM+DLG HGG++  E +    FIS  L+                   DY+    I Q D    IA L  +PIP NS GV   +   L+ +    +  +  N+  L+ L
Sbjct:   49 AFDKLVLVVIDALRADFLFQQNVSHFDFVHELLNRGEAWGFTAYSNPPTVTLPRLKGITTGSAPNFLDAILNVAEDDSSSNLKDQDSWISQFAKHGK-KIHFFGDDTWLKLFPEEFFQKHDGTNSFFVSDFEEVDTNVTRHLPHELQH-KDWDVLILHYLGLDHIGHKGGAASQFMPPKHREMDAVIRQIYDQV-----DNRTLLCVMGDHGMNDLGNHGGSSAGETSAGMVFISKMLSSYPRPAAQDGVSSPVTAAEDYQFFTRIQQVDFVPTIASLFNIPIPKNSLGVFVREFSSLLGQ--HATTKIIENYHQLMQL 358          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: T1JP07 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 8.686e-65
Identity = 129/310 (41.61%), Postives = 193/310 (62.26%), Query Frame = 2
Query:  170 KNTSQYFQKLSVDKVILIVIDALRFDMT---EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLID-RPIDRSRALFSNFFHLINL 1087
            K++++     S++ ++LIVIDALR D     +  ++F  LN  +    ++ +  K   P+VT+PRIK IT+G I  F D++ N  S+E   DNI+   + + K  L F+GD TW +LFP+ F++ + T SFFV DY EVDNNVT N+   +  L +WD  I+HYLGLDHIGH EGPFS L+PPKL E+ + I R+ +E+ H     SS+I++ GDHGMSD G HGGA+  E +    FI N    K+F  RS   ++Q  ++  +++L  +P+P N+ GVI   +  LID +P ++  A+F+NF+ +  L
Sbjct:   29 KDSTEIPYAFSLNNLVLIVIDALRTDFVTNNKSETNFPYLNKMLDEKKAISFNAKAHHPTVTLPRIKAITSGGIPGFMDVVFNFHSSEFEEDNIVTQSVLNGKNVL-FYGDGTWLRLFPHHFKRSEGTTSFFVSDYTEVDNNVTTNLNNELKRL-DWDFLILHYLGLDHIGHKEGPFSALVPPKLREMDEVIERLHRELEHR--DGSSMIVICGDHGMSDNGNHGGASKEETSIPLIFIHNH---KRFVNRSVVNVNQISITPTLSVLLNLPLPKNNLGVILSDV--LIDLKPREKLYAMFANFYQMSKL 329          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: A0A183AXB3 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS11598 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.134e-63
Identity = 142/411 (34.55%), Postives = 214/411 (52.07%), Query Frame = 2
Query:  200 SVDKVILIVIDALRFDM---TEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEI--LHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPT-IDQSDLSTIIAILTGVPIPSNSRGVI-PYQLLQLIDRPIDRSRALFSNFFH------------------LINLDLENLQSFSSEFETI-RNKIESLHEICEKSIKPGNCTESLKI----------QHENLI-ELLRRIQQLKLANSFQFNTLFMELGVLLLFI 1321
            +V + + +++D LR D+    +   S+  L   +  +  +R    +Q P+VTMPRIK IT+G +  F D++ NL +  +  D  +  L+  +++ L F+GDDTW KLFP+ F++ D TNSFFV DYYEVD NVTR++  +    SEW+  I+HYLGLDHIGHVEGP    +P KL+E+    + I+ ++  + SS  +S L ++TGDHGMSD GGHGG++  E+ T    +S+     + D   P T   Q DL++ + ++TG  IP +S G+I P         P DR RAL     H                  L  +DL     F +  E I  N +    E+    +  G  T                HE  I +LLR+IQ   L+ +   + + M  G LL+++
Sbjct:   41 AVTRFVFMIVDGLRSDLLLSPQHAPSWRKLAAHLDRHAFIRANSYIQPPTVTMPRIKAITSGRVPKFVDVLRNLDTAAMHGDTWLSRLVHQKQWSLEFYGDDTWIKLFPDLFKRFDGTNSFFVNDYYEVDRNVTRHLKDLFQRPSEWNGVILHYLGLDHIGHVEGPRGSSLPSKLSEMDTVADSIITQLNEIKSSKGDSWLFVLTGDHGMSDQGGHGGSSFGEVNTGLLLVSST---PRSDQTVPLTETQQVDLASFMGLVTGAGIPKSSLGLIHPKWFDTFWPEPFDRLRALAKLLRHYALLSGCMSRYSEAQWDELPTIDLTCPSKFITRDEIIFYNTLVKQMELKYIYLHQGGSTSRANYSMSDSKNNPDSHEGQIYQLLRKIQSRALSGAHHLDDMSMVAGALLMWL 448          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: A0A5K3EVM8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 233.032 bits (593), Expect = 1.225e-63
Identity = 145/390 (37.18%), Postives = 213/390 (54.62%), Query Frame = 2
Query:  212 VILIVIDALRFDM---TEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKK------------FDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLI-DRPIDRSRALFSNFFHL--------INLDLENL-QSFSSEFETIRNKIESLHEIC--EKSIKPGNC------TESLKIQHENLIELLRRIQQLKLANSFQFN 1282
            VIL+V+DALR DM   T+ Y ++ +L   +   I       L TPSVT PRIK I TG I  F D++ NL +  +   + +  ++++ K R+  +GDDTW KLFP+ F++ D T+SFFV D+YEVD NVTR++   ++   +WD+ I+HYLGLDHIGHV+GP  + +  KL E+ Q + +++ E +  S     LII+TGDHGMSD G HGG + +EL TS   IS K    +            F+ +S    DQ+D++T+I +LTG  +P+ S GV P ++LQ     P+ R   L     HL         N + E L  S  S+   + ++I SL ++C    S+ P  C       E + +Q  NL+   +R   L   N    N
Sbjct:   55 VILMVVDALRPDMIGSTKYYRNWPNLRAVIEKGIVDCSTASLATPSVTGPRIKAIATGRIPGFIDILYNLNTVGVKQPSWVQYMVQNNK-RIELYGDDTWLKLFPDAFKRSDGTSSFFVTDFYEVDTNVTRHLESRLSVPDDWDLMILHYLGLDHIGHVQGPNGDAVSSKLWEMDQVVGKLVNE-MEKSGKGDWLIILTGDHGMSDQGSHGGGSYSELRTSLVLISPKFQTIRQSGSACTIEKGVFEAKS----DQTDIATLIGLLTGDGVPAGSIGVPPVRVLQAFWPNPLSRYGVLLEVLEHLRRLTKCFDTNCNHELLVTSEISKLNQLYSEISSLVQMCSPSSSVHP-TCNRMLTDVEGMTVQVVNLLTTFQRRTLLHANNKLNVN 437          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: A0A068WKL6 (Transferase OS=Echinococcus granulosus OX=6210 GN=EgrG_000429900 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 7.489e-62
Identity = 144/403 (35.73%), Postives = 225/403 (55.83%), Query Frame = 2
Query:  203 VDKVILIVIDALRFDM--TEKYS-SFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKK----------FDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQ-LIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFET---------IRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFME----LGVLLLFISFV 1330
            V  +IL+V+DALR +M  ++ YS ++ +L   +       +   L +PSVT PRIK + TG+I  F D++ NL+ + +   + + ++  + + RL  +GDDTW +LFP  F++ D T SF+V D++EVD+NVTR++   +  L +WD+ I+HYLGLDHIGHV+GP  + +P K+ E+   + +I+  +L+SS +N  L+++TGDHGMSD G HGG++  ELTTS   IS K   +K          F+ +S    DQ+DL+T++ +LTGV IP+ S GV P ++LQ    +P  R   L     HL  L      +   EF T         + ++I SL  +C  ++ P    + +  + E +       Q + L  +FQ  TL        G L+ FI  V
Sbjct:   58 VSNIILMVVDALRSNMISSKNYSKNWPNLYAIIEEGAGQCFTAYLTSPSVTSPRIKAMATGNIPGFIDILYNLEDSSVEQPSWVQLMAANNR-RLELYGDDTWLRLFPGAFKRSDGTTSFYVTDFFEVDDNVTRHLDGRLAALHDWDLLILHYLGLDHIGHVQGPHGDAMPTKIREMDIVLGKIV-SVLNSS-TNDWLLVLTGDHGMSDQGSHGGSSFPELTTSMILISPKFKNQKTSMCTIDGEVFEAKS----DQTDLATMMGLLTGVGIPAGSIGVPPLRVLQTFWPQPFHRYAILLELLEHLRKLTKCTDAACDHEFLTSSDVVKLDQLHSEISSLVRLCSATVPPHPACDRMATEMEKVTA-----QVVNLLTAFQRRTLLHTNNKIAGGLVGFICLV 448          

HSP 2 Score: 61.6178 bits (148), Expect = 9.765e-6
Identity = 55/204 (26.96%), Postives = 99/204 (48.53%), Query Frame = 1
Query: 2179 NVLLMLMIVICRPHNIVLLAGFVCKRAMLRRIW-----LYNLRHRNVIEQLLFFN-----MIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFW-IIVWIEWLSDGYI------SQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVL 2739
            + L +L  ++ R  +++L  G + K  +L R++                +L++F      M G  +FFQQGNS+  STVD+  GYVG+  +  +L  I++  +T+ G LFW + ++  ++ +  I      S++  SHV + +   SL  L          +     ++C     HLF+WSVF P+L +   +  V +P Y ++
Sbjct:  707 HTLALLACLLGRTTSVLLWTGVMIKEILLARVFHTEFAALGSSSPQARSKLIYFIVMLYWMEGWATFFQQGNSNKFSTVDMAAGYVGLSGHSHILSTIMVLFYTYAGPLFWQLSLYFRYILNYGINKRVLGSETRRSHVRNSVVTFSLGFLT--------LATTVSAVVCLFFHSHLFIWSVFAPKLFFMAAYCCVSIPVYILM 902          
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Match: A0A068Y1U7 (Transferase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000429900 PE=4 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 8.073e-62
Identity = 143/403 (35.48%), Postives = 226/403 (56.08%), Query Frame = 2
Query:  203 VDKVILIVIDALRFDM--TEKYS-SFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKK----------FDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQ-LIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFET---------IRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFME----LGVLLLFISFV 1330
            +  +IL+V+DALR +M  ++ YS ++ +L   +       +   L +PSVT PRIK + TG+I  F D++ NL+ + +   + + ++  + + RL  +GDDTW +LFP  F++ D T SF+V D++EVD+NVTR++   +  L +WD+ I+HYLGLDHIGHV+GP  + +P K+ E+   + +I+  +L+SS ++  L+++TGDHGMSD G HGG++  ELTTS   IS K   +K          F+ +S    DQ+DL+T++ +LTGV IP+ S GV P ++LQ    +P  R   LF    HL  L      +   EF T         + ++I SL  +C  ++ P    + +  + E +       Q + L  +FQ  TL        G L+ FI  V
Sbjct:   58 ISNIILMVVDALRSNMISSKNYSKNWPNLYAIIEEGAGQCFTAYLTSPSVTSPRIKAMATGNIPGFIDILYNLEDSSLEQSSWVQLMAANNR-RLELYGDDTWLRLFPGAFKRSDGTTSFYVTDFFEVDDNVTRHLDGRLAALHDWDLLILHYLGLDHIGHVQGPHGDAMPTKIREMDIVLGKIV-SVLNSS-TDDWLLVLTGDHGMSDQGSHGGSSFPELTTSMILISPKFKNQKTSMCTIDGEVFEAKS----DQTDLATMLGLLTGVGIPAGSIGVPPLRVLQTFWPQPFHRYAILFELLEHLRKLTKCTDAACEHEFLTSSDVVKLNQLHSEISSLVRLCSATVPPHPVCDRMATEMEKVTA-----QVVNLLTAFQRRTLLHTNNKIAGGLVGFICLV 448          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:103031697])

HSP 1 Score: 206.068 bits (523), Expect = 1.272e-54
Identity = 135/369 (36.59%), Postives = 197/369 (53.39%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT-----EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEIL--HSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRG-VIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLHEICEKSIKPGNCTESLK-IQHENLIELLRRIQQLKLANSFQFN 1282
            +V++++IDALR D       +++  +      V    S  +  K + P+VTMPRIK +TTG I  F D+++NL S  +  DN+I       K R+ F+GDDTW +LFP  F + D T SFFV DY EVDNNVTR++   +    +WDM I+HYLGLDHIGH+ GP S LI PKL E+   I +I   ++   S  S  +L+++ GDHGMS+ G HGG++  E++T     S     +K     P  ++Q DL   +A+   +PI  NS G +IP    +   R  ++ R L  N   L +L  ++  +F  E  +E  R   E  H    K    GN +E L  +  + L + L  +Q +  A S Q  
Sbjct:   68 RVVIVLIDALREDFVFGPNGKRFMPYT--RHIVERGSSHSFIAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALLEDNLIWQAKNAGK-RIIFYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKR-DDWDMLILHYLGLDHIGHISGPHSSLIGPKLLEMDDVIKKIHASLITRESEGSLPNLLVLCGDHGMSETGSHGGSSEPEVSTPLVLFSPAFQ-RKAGLEQPVVVEQVDLPPTLALALALPISQNSVGRLIPAMFEEASLR--EQLRFLHINGHQLSSLLRDSNPNFHKEDGYEQFRVA-EKAHGNWMKLYMEGNASEVLGNMGKKVLKQYLEALQAMSAALSKQLG 428          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:103031697])

HSP 1 Score: 206.068 bits (523), Expect = 1.734e-54
Identity = 135/369 (36.59%), Postives = 197/369 (53.39%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT-----EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEIL--HSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRG-VIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLHEICEKSIKPGNCTESLK-IQHENLIELLRRIQQLKLANSFQFN 1282
            +V++++IDALR D       +++  +      V    S  +  K + P+VTMPRIK +TTG I  F D+++NL S  +  DN+I       K R+ F+GDDTW +LFP  F + D T SFFV DY EVDNNVTR++   +    +WDM I+HYLGLDHIGH+ GP S LI PKL E+   I +I   ++   S  S  +L+++ GDHGMS+ G HGG++  E++T     S     +K     P  ++Q DL   +A+   +PI  NS G +IP    +   R  ++ R L  N   L +L  ++  +F  E  +E  R   E  H    K    GN +E L  +  + L + L  +Q +  A S Q  
Sbjct:   68 RVVIVLIDALREDFVFGPNGKRFMPYT--RHIVERGSSHSFIAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALLEDNLIWQAKNAGK-RIIFYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKR-DDWDMLILHYLGLDHIGHISGPHSSLIGPKLLEMDDVIKKIHASLITRESEGSLPNLLVLCGDHGMSETGSHGGSSEPEVSTPLVLFSPAFQ-RKAGLEQPVVVEQVDLPPTLALALALPISQNSVGRLIPAMFEEASLR--EQLRFLHINGHQLSSLLRDSNPNFHKEDGYEQFRVA-EKAHGNWMKLYMEGNASEVLGNMGKKVLKQYLEALQAMSAALSKQLG 428          

HSP 2 Score: 53.1434 bits (126), Expect = 1.476e-6
Identity = 50/170 (29.41%), Postives = 87/170 (51.18%), Query Frame = 1
Query: 2185 LLMLMIVICRPHNIVLLAG-FVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLL 2691
            +++L+ ++ R HN+  LA   + +  M + IW     H +  +  +     G   F+ QGNS++++TVDI  G+VG+  Y       L    T+ G L W    + +LS    S+ D + V       SL      F+L+ +   +  +++ + +RYHLF+WSVF+P+LL
Sbjct:  793 VVLLVALLFRAHNLPTLACCLLIQTLMAQFIW--KKLHYDAAQTTIMHYWFGQAFFYFQGNSNNIATVDISVGFVGLESYVEAPAVFLTAFSTYAGPLLWACHLVCYLS----SERDRAAV-------SLGHGSYCFALLRSIPAVFYVVLVTALRYHLFIWSVFSPKLL 949          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:103031697])

HSP 1 Score: 205.682 bits (522), Expect = 2.032e-54
Identity = 136/369 (36.86%), Postives = 197/369 (53.39%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT-----EKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEIL--HSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRG-VIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSE--FETIRNKIESLHEICEKSIKPGNCTESLK-IQHENLIELLRRIQQLKLANSFQFN 1282
            +V++++IDALR D       +++  +      V    S  +  K + P+VTMPRIK +TTG I  F D+++NL S  +  DN+I       K R+ F+GDDTW +LFP  F + D T SFFV DY EVDNNVTR++   +    +WDM I+HYLGLDHIGH+ GP S LI PKL E+   I +I   ++   S  S  +L+++ GDHGMS+ G HGG++  E++T     S     K  D   P  ++Q DL   +A+   +PI  NS G +IP    +   R  ++ R L  N   L +L  ++  +F  E  +E  R   E  H    K    GN +E L  +  + L + L  +Q +  A S Q  
Sbjct:   68 RVVIVLIDALREDFVFGPNGKRFMPYT--RHIVERGSSHSFIAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALLEDNLIWQAKNAGK-RIIFYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKR-DDWDMLILHYLGLDHIGHISGPHSSLIGPKLLEMDDVIKKIHASLITRESEGSLPNLLVLCGDHGMSETGSHGGSSEPEVSTPLVLFSPAFQRK--DCSHPVVVEQVDLPPTLALALALPISQNSVGRLIPAMFEEASLR--EQLRFLHINGHQLSSLLRDSNPNFHKEDGYEQFRVA-EKAHGNWMKLYMEGNASEVLGNMGKKVLKQYLEALQAMSAALSKQLG 427          

HSP 2 Score: 52.7582 bits (125), Expect = 1.648e-6
Identity = 50/170 (29.41%), Postives = 87/170 (51.18%), Query Frame = 1
Query: 2185 LLMLMIVICRPHNIVLLAG-FVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLL 2691
            +++L+ ++ R HN+  LA   + +  M + IW     H +  +  +     G   F+ QGNS++++TVDI  G+VG+  Y       L    T+ G L W    + +LS    S+ D + V       SL      F+L+ +   +  +++ + +RYHLF+WSVF+P+LL
Sbjct:  792 VVLLVALLFRAHNLPTLACCLLIQTLMAQFIW--KKLHYDAAQTTIMHYWFGQAFFYFQGNSNNIATVDISVGFVGLESYVEAPAVFLTAFSTYAGPLLWACHLVCYLS----SERDRAAV-------SLGHGSYCFALLRSIPAVFYVVLVTALRYHLFIWSVFSPKLL 948          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:ZFIN;Acc:ZDB-GENE-091204-80])

HSP 1 Score: 159.458 bits (402), Expect = 1.842e-39
Identity = 101/296 (34.12%), Postives = 151/296 (51.01%), Query Frame = 2
Query:  209 KVILIVIDALRFDMTE-------------KYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFIS-NKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRA 1054
            + ++++IDAL+ D                K    +++ +   S   L Y  +   P+ TM RIK  TTG +  F D+  N  S+ +  DN++  L +  K R+ F GDDTW  LFP +F +     SF VKD + VDN + +NI   M    +WD+ I H+LG+DH GH  GP    +  KLT++   I  ++  +      N +L++V GDHGM+D G HGG ++ E   + F  S + L         P  + Q+DL   +A+L GVPIP +S G +   LL L   P + SRA
Sbjct:   65 RAVVLIIDALKSDFARYDPENTSPRAFENKLPVLDEMASSRPSQSRL-YTFRADPPTTTMQRIKGFTTGSLPTFIDVGNNFASSAVLEDNLVHQLGQAGK-RVVFMGDDTWVSLFPRKFHRSLPFPSFNVKDLHTVDNGILQNIFPTMEG-DDWDVLIAHFLGVDHCGHRFGPDHPAMAEKLTQMDGVIRSVINRL-----QNDTLLVVMGDHGMTDTGDHGGESLKETDAALFLYSGSPLFPAPSSQVEPEVVPQTDLVPTLALLLGVPIPYSSVGQV---LLPLF--PHNNSRA 347          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Match: pign (phosphatidylinositol glycan anchor biosynthesis class N [Source:NCBI gene;Acc:103038036])

HSP 1 Score: 53.5286 bits (127), Expect = 1.029e-6
Identity = 40/166 (24.10%), Postives = 72/166 (43.37%), Query Frame = 2
Query:  581 NNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSN--SSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLN----------------LKKFDYRSPPTID--QSDLSTIIAILTGVPIPSNSRGVIPYQLL 1018
            N+  +N   +     E ++  +H LG+D  GH   P S      +  +   +  ++  +    F N   +  + T DHGM++ G HG +  +E  T        +                 LK++   +   +D  Q+D++ +++ L GVP+P NS GV+P Q L
Sbjct:  189 NSAKQNETLLSKLHEEQNVFFLHLLGIDTNGHAHRPMSTEYLDNIGLVDAGVAEMV-SVFEEFFGNDGKTAYVFTADHGMTNWGSHGASHPSETLTPLVAWGAGVQTAQKATSTSQNYDDDFLKEWGLETYRRVDVNQADIAALMSSLIGVPVPLNSVGVLPLQYL 353          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:HGNC Symbol;Acc:HGNC:25985])

HSP 1 Score: 207.223 bits (526), Expect = 4.139e-57
Identity = 120/329 (36.47%), Postives = 180/329 (54.71%), Query Frame = 2
Query:  209 KVILIVIDALRFDMTEKYSSFNDL---NTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNII-DILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNS--SLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTID----QSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI-DRSRALFSNFFHLINLDLENLQSFSSEFETI-RNKIESLHE 1159
            +V+L+++DALR D         ++   +   +   +LRY  +   P+VTMPRIK +T+G I  F DL++NL++    +D  +   L   R  RL F+GDDTW +LFP  F + + T SFFV D+ EVD NVTR++   + +  +W + ++HYLGLDHIGH  GP S L+P KL E+   +  +   +L    S S  +L+++ GDHGMS+ G HGG++  EL +     S+   L       P T+     Q DL+  +++  G P+P NS G +    L+   RPI ++ RAL +N   L  L      S+SSE   + R   E  HE
Sbjct:   61 RVVLVLVDALRADFVFGAHGATNMPYTHAQAHGGHALRYTARAHPPTVTMPRIKALTSGSIPGFLDLLMNLEAVAAGDDTFLWQALAAGR--RLRFYGDDTWLRLFPGTFHQAEGTTSFFVTDHTEVDTNVTRHVPAALAS-RDWQLLVLHYLGLDHIGHTHGPASALVPHKLREMDAVVRAVHTALLREDESPSLPALLVLCGDHGMSNAGSHGGSSEEELLSPLLLFSSAFPLAGERRTDPETVPAEVLQVDLAATLSLGMGRPVPLNSMGHVITAALE--HRPIREQLRALQANAHQLAALLRAGTASYSSEPGYLHRENAERWHE 384          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Match: pigo (phosphatidylinositol glycan anchor biosynthesis, class O [Source:ZFIN;Acc:ZDB-GENE-091204-80])

HSP 1 Score: 166.007 bits (419), Expect = 3.438e-42
Identity = 94/294 (31.97%), Postives = 156/294 (53.06%), Query Frame = 2
Query:  173 NTSQYFQKLSVDKVILIVIDALRFDMTEKYSSFNDLNTGVYSNISLRYKVKLQT--------------PSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNL-KKFDYRSPPTIDQSDLSTIIAILTGVPIP-SNSRGVIP 1006
            N S +       + +L+VIDALR D     ++ ++     Y N        LQ               P+ TM R+K + TG +  F D+  N  S  +  DN++  L+   +++L F GDDTW  LFP  F +     S  V+D + VD+ + +++   +   S+WD+ I H+LG+DH+GH  GP    +  KL+++++ ++ +L+E+        ++++V GDHGM++ G HGG +  E T++A F+ + + + K    R P T+ Q+DL   +A+L GVPIP SN   VIP
Sbjct:   68 NRSCWAVPARYRRAVLVVIDALRLDFATYDAARSEPKP--YENRLPALHAALQATPRHARLFRFRADPPTTTMQRLKALATGGLPTFIDVSSNFASARVEEDNLVGQLVSVGQWKLVFLGDDTWMGLFPTHFHRAFPFPSLNVRDLHSVDDGILQHLHSEVAK-SDWDVIIAHFLGVDHVGHRLGPLHPAMSDKLSQMNEVLSNLLREL-----PEDAVLLVMGDHGMTETGDHGGESERE-TSAALFVYSPIPVFKGAQPREPRTVFQTDLVPSLALLLGVPIPYSNLGQVIP 352          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Match: pign (phosphatidylinositol glycan anchor biosynthesis, class N [Source:ZFIN;Acc:ZDB-GENE-080204-114])

HSP 1 Score: 56.225 bits (134), Expect = 3.609e-8
Identity = 40/148 (27.03%), Postives = 60/148 (40.54%), Query Frame = 2
Query:  644 MHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSN--SSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPT---------------------IDQSDLSTIIAILTGVPIPSNSRGVIPYQLL 1018
            +H LGLD  GH   P S      +  +   I  I+  I+   F N   +  + T DHGM+D G HG   ++E  T        +N        PP                      ++Q+D++ ++  L G+P P NS GV+P   L
Sbjct:  208 LHLLGLDTNGHAHRPASREYLDNIASVDHGIGEIV-SIIEDYFGNDKKTAYVFTSDHGMTDWGSHGAGHLSETLTPLIAWGAGVNRPH-----PPGGQIHTDTYSQDWGLGHLNRMDVNQADVAPLMTSLLGIPFPLNSVGVLPLGYL 349          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Match: pign (phosphatidylinositol glycan anchor biosynthesis, class N [Source:ZFIN;Acc:ZDB-GENE-080204-114])

HSP 1 Score: 55.8398 bits (133), Expect = 3.825e-8
Identity = 39/144 (27.08%), Postives = 59/144 (40.97%), Query Frame = 2
Query:  644 MHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSN--SSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPT---------------------IDQSDLSTIIAILTGVPIPSNSRGVIP 1006
            +H LGLD  GH   P S      +  +   I  I+  I+   F N   +  + T DHGM+D G HG   ++E  T        +N        PP                      ++Q+D++ ++  L G+P P NS GV+P
Sbjct:  208 LHLLGLDTNGHAHRPASREYLDNIASVDHGIGEIV-SIIEDYFGNDKKTAYVFTSDHGMTDWGSHGAGHLSETLTPLIAWGAGVNRPH-----PPGGQIHTDTYSQDWGLGHLNRMDVNQADVAPLMTSLLGIPFPLNSVGVLP 345          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Yeast
Match: LAS21 (Integral plasma membrane protein; involved in the synthesis of the glycosylphosphatidylinositol (GPI) core structure; mutations affect cell wall integrity [Source:SGD;Acc:S000003598])

HSP 1 Score: 205.682 bits (522), Expect = 1.090e-55
Identity = 126/350 (36.00%), Postives = 190/350 (54.29%), Query Frame = 2
Query:  209 KVILIVIDALRFDM--TEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITND-----NIIDILIEHRKFRLNFFGDDTWDKLFPNR-FQKVDLTNSFFVKDYYEVDNNVTRNI-AYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNL-----KKFDYRSP------------PTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEF--ETIRNKIESLHEICEKS 1174
            K++ ++IDALR D     + S FN+++  + +  +  Y      P+VT+PR+K+ITTG   +F DL+LN+     +ND     + +   I+H    + F GDDTW KLFP + F   D T+SFFV D+ +VDNNVTRN+   +    ++WD+ I+HYLGLDHIGH +GP S+ +  K  E+   +  I  E+L     + +LI V GDHGM++LG HGG++  E +    F+S KL        + +Y  P             T+ Q D+   IA L G+PIP NS G+I    LQL+    ++  ++  NF HL  L   + +    +F  E I  K+ ++ E   KS
Sbjct:   53 KLVFVIIDALRSDFLFDSQISHFNNVHQWLNTGEAWGYTSFANPPTVTLPRLKSITTGSTPSFIDLLLNVAQDIDSNDLSEHDSWLQQFIQHNN-TIRFMGDDTWLKLFPQQWFDFADPTHSFFVSDFTQVDNNVTRNLPGKLFQEWAQWDVAILHYLGLDHIGHKDGPHSKFMAAKHQEMDSILKSIYDEVLEHEDDDDTLICVLGDHGMNELGNHGGSSAGETSAGLLFLSPKLAQFARPESQVNYTLPINASPDWNFQYLETVQQIDIVPTIAALFGMPIPMNSVGIIIPDFLQLLP---NKLASMKENFMHLWKLSDHHGEVALDDFTAEDIYTKMYTIQETLTKS 398          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Yeast
Match: GPI13 (ER membrane localized phosphoryltransferase; adds phosphoethanolamine onto the third mannose residue of the glycosylphosphatidylinositol (GPI) anchor precursor; similar to human PIG-O protein [Source:SGD;Acc:S000003954])

HSP 1 Score: 131.339 bits (329), Expect = 1.380e-31
Identity = 101/296 (34.12%), Postives = 144/296 (48.65%), Query Frame = 2
Query:  206 DKVILIVIDALRFD----MTEKYSSFNDLNTGVYSNI--------------SLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLF-PNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKF-------------DYRSPPTIDQSDLSTIIAILTGVPIPSNSRG 997
            +K +++VIDALRFD    + E +S++N LN   ++NI              SL  K     P+ T+ R+K +TTG +  F D   N   T I  DN +  L    K  + F GDDTW  LF P          S  V D   VDN V       +    EWD+ I H LG+DH+GH  GP    +  K  ++ Q I+ ILK I      + +L+++ GDHGM   G HGG +++EL ++ F  S K ++ +              DYRS   + Q DL + +A+L G PIP N+ G
Sbjct:   81 NKAVILVIDALRFDFAIPVNESHSNYN-LN--YHNNILSLYDSFASDKDASSLLLKFIADPPTTTLQRLKGLTTGSLPTFIDAGSNFDGTVIEEDNFLKQLHLANK-TVKFAGDDTWMALFHPFLSNDSFPLESLNVWDLDTVDNGVMDYFHDHLQQDKEWDVMIGHMLGIDHVGHKYGPDHFTMREKQIQVDQFIDWILKSI-----DDDTLLVILGDHGMDHTGNHGGDSIDELESTLFLYSKKPDMWRLKETSNYNIDNLGHDYRS---VRQIDLVSSLALLMGQPIPFNNLG 364          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Yeast
Match: MCD4 (Protein involved in GPI anchor synthesis; multimembrane-spanning protein that localizes to the endoplasmic reticulum; highly conserved among eukaryotes; GPI stands for glycosylphosphatidylinositol [Source:SGD;Acc:S000001648])

HSP 1 Score: 53.1434 bits (126), Expect = 1.927e-7
Identity = 72/322 (22.36%), Postives = 128/322 (39.75%), Query Frame = 2
Query:  494 DTW--DKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHG--------------GATVNELTTSAFFISNKL-------NLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFF-----HLINLD-LENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPISKGTF 1372
            DTW  D  F +  Q     ++F  +   ++ +N T N         + ++  +H LG D  GH   P+S      +  +   I  ++ ++      + +  I T DHGMS  G HG              GA +N+   + F +S+         ++K+ D      + Q+D++++++ L GV  P NS G +P   +    +  D+  AL++N       +L+  D + + Q F  E+     K  S H + E        +E      +  I L   + Q+ L       T        ++   FVG +F  F I   +F
Sbjct:  166 DTWMYDHTFEDFTQSSIELDAFVFRHLDQLFHNSTLNSTLDYEIRQDGNVFFLHLLGCDTAGHSYRPYSAEYYDNVKYIDDQIPILIDKVNKFFADDKTAFIFTADHGMSAFGSHGDGHPNNTRTPLVAWGAGLNKPVHNPFPVSDNYTENWELSSIKRND------VKQADIASLMSYLIGVNYPKNSVGELPIAYID--GKESDKLAALYNNARSILEQYLVKQDEVIDSQFFYKEYFKFVEKSHS-HYLEEIETLIQRISEGENYLEQEAITLTEELMQITLEGLHYLTTYNWRFIRTIVTFGFVGWIFFSFIIFLKSF 478          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Match: EDO45110 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTY0])

HSP 1 Score: 205.297 bits (521), Expect = 1.127e-59
Identity = 107/233 (45.92%), Postives = 149/233 (63.95%), Query Frame = 2
Query:  203 VDKVILIVIDALRFD-MTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILH--SSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLN 892
            +D++++++IDALR D +         LN  V +N SL +  K   P+VTMPRIK + TG I  F D++LN  STE+  DN++  L    K ++ FFGDDTW KLFP  F + D TNSFFV DY EVD+NVTR++   +++  +WD+ I+HYLGLDHIGH+ GP S LI PKL E+   +  I + ++H        S I++ GDHGMSD G HGGA++ E  T   F+S++L 
Sbjct:   60 LDRLVIVLIDALRADFVLPGDGRMKYLNELVRNNESLSFLAKAHPPTVTMPRIKALMTGGIPGFIDVLLNSLSTELQEDNLLAQLTAAGK-KIVFFGDDTWIKLFPGNFMRSDGTNSFFVSDYTEVDDNVTRHLGKELSS-KDWDVMILHYLGLDHIGHLAGPSSPLIGPKLQEMDDILRDIHRNLIHWDQEMGTHSAIVLCGDHGMSDSGSHGGASLPETLTPLVFLSSRLK 290          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Match: EDO47657 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLT5])

HSP 1 Score: 172.94 bits (437), Expect = 4.074e-44
Identity = 99/291 (34.02%), Postives = 155/291 (53.26%), Query Frame = 2
Query:  209 KVILIVIDALRFDMTE--------KYSSFNDLNTGVYS------NISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPI 1039
            K +++VIDALR+D           K  S+ +  T ++       N +  Y+ K   P+ TM R+K +TTG +  F D   N  + +I  DNII  L+EH K ++ F GDDTW  LFP+ F K     SF VKD + VDN V +++   +    +WD+ I H+LG+DH GH  GP+   +  KL ++ + I  +++E+      + S++ V GDHGM+  G HGG + +EL  + F  S K      D +   TI Q DL   ++++ G+P+P  + G +   L   +DR +
Sbjct:   80 KAVILVIDALRYDFVHFEDNVEENKTLSYQNKLTSIHKVLKSEPNRAWLYRFKADPPTTTMQRLKGLTTGSLPTFVDAGSNFATYDIKEDNIIRKLVEHGK-KITFMGDDTWTDLFPDAFHKSYPFPSFNVKDLHTVDNGVIKHLIPELRQ-KDWDVLIGHFLGVDHCGHRYGPYHAAMADKLRQMDKVIRSVMEEL-----DDESVLFVLGDHGMTRTGDHGGDSDDELDAALFVYSKKPLDIAHDLKEENTIAQVDLVPTLSLMLGIPVPFGNLGKVIADLFTQVDRHV 363          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Match: EDO45111 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTY1])

HSP 1 Score: 70.0922 bits (170), Expect = 9.345e-13
Identity = 53/182 (29.12%), Postives = 88/182 (48.35%), Query Frame = 1
Query: 2212 RPHNIVLLAGFVCKRAMLRRIWLYNLRHRN--VIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIY 2751
            R HN+VLLA F     +    ++    H N       L +  +G  ++F  GNS+SLSTVDI  GY+GMR +  ++  IL+++ T+   + W+   I++             V +   + ++ +   +  + +         +    RYHLFVWSVF+P+LLY     LV+  C +   LI+
Sbjct:  165 RTHNVVLLALFY---GVTYHTYMPFFLHSNNPTWRLALLYYWLGQATYFALGNSNSLSTVDIAAGYIGMRAHDGLVALILMSLATYASPVLWLTALIKY------------QVKNATSYTTMYRACVTMVVPNALLLCVYCTLVYAQRYHLFVWSVFSPKLLYETMRALVMF-CAYATVLIF 330          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Match: EDO47599 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLF9])

HSP 1 Score: 52.7582 bits (125), Expect = 6.595e-7
Identity = 40/159 (25.16%), Postives = 71/159 (44.65%), Query Frame = 2
Query:  644 MHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSN--SSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKL----------------NLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSN 1066
            +H LG+D  GH   P S      +  + + I + + +++   F N  S+  ++T DHGM++ G HG    +E  T        +                +L K  +     ++Q+D++ ++  L GVP P NS G++P   L   + P   +  LF+N
Sbjct:  217 LHLLGIDTNGHAHRPSSLEYLNNIAFVDKGIKKTV-QLIDDFFGNDASTAFVLTSDHGMTNWGSHGAGHAHETLTPLVAWGAGIRGPITSDGTGSQDGLSSLWKLTHLQRNDVNQADIAPLMTSLIGVPYPLNSVGILPTAYLN--NTPHYLAENLFTN 372          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:101158779])

HSP 1 Score: 202.601 bits (514), Expect = 2.286e-53
Identity = 112/272 (41.18%), Postives = 160/272 (58.82%), Query Frame = 2
Query:  209 KVILIVIDALRFDMT--EKYSSFNDLNTGVYS-NISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNS--SLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRG-VIP 1006
            +V+++++DALR D         F      V     SL +  K + P+VTMPRIK +TTG I  F D+++NL S  ++ DN+I       K ++ F+GDDTW +LFP  F + D T SFFV DY EVDNNVTR++   +    +WD+ I+HYLGLDHIGH+ GP S LI PKL E+   + +I   ++      S   L+++ GDHGMS+ G HGG++  E+ T    IS     +K +   P  ++Q DL+  +A+  G+PI  NS G VIP
Sbjct:   67 RVVVMLVDALREDFVFGPNGPMFLPYTRHVIERGSSLSFVAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALSEDNLIWQAKTAGK-KIIFYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKR-DDWDILILHYLGLDHIGHISGPHSSLIQPKLLEMDDILKKIHGSLVSKEADGSLPYLLVLCGDHGMSETGSHGGSSEPEINTPLVLISPIFK-RKAEMEKPGVVEQVDLTPTLALGLGLPISQNSVGHVIP 335          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Match: si:ch73-49o8.1 (phosphatidylinositol glycan anchor biosynthesis class G [Source:NCBI gene;Acc:101158779])

HSP 1 Score: 201.06 bits (510), Expect = 3.931e-53
Identity = 104/237 (43.88%), Postives = 146/237 (61.60%), Query Frame = 2
Query:  305 SLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNS--SLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRG-VIP 1006
            SL +  K + P+VTMPRIK +TTG I  F D+++NL S  ++ DN+I       K ++ F+GDDTW +LFP  F + D T SFFV DY EVDNNVTR++   +    +WD+ I+HYLGLDHIGH+ GP S LI PKL E+   + +I   ++      S   L+++ GDHGMS+ G HGG++  E+ T    IS     +K +   P  ++Q DL+  +A+  G+PI  NS G VIP
Sbjct:   32 SLSFVAKARPPTVTMPRIKALTTGSIPGFIDVVMNLNSPALSEDNLIWQAKTAGK-KIIFYGDDTWVRLFPKHFMEYDGTTSFFVSDYTEVDNNVTRHLDSTLKR-DDWDILILHYLGLDHIGHISGPHSSLIQPKLLEMDDILKKIHGSLVSKEADGSLPYLLVLCGDHGMSETGSHGGSSEPEINTPLVLISPIFK-RKAEMEKPGVVEQVDLTPTLALGLGLPISQNSVGHVIP 265          

HSP 2 Score: 58.151 bits (139), Expect = 3.943e-8
Identity = 50/162 (30.86%), Postives = 81/162 (50.00%), Query Frame = 1
Query: 2212 RPHNI-VLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLY 2694
            R HN+ VL    + +  M + IW     H +  +  +     G   F+ QGNS++++TVDI  G+VG+  Y       L  + T+ G L W    + +LS    S+ D S V+       LA L        +    + +++ +++RYHLF+WSVF+P+LLY
Sbjct:  720 RAHNLPVLCCCLLIQTLMAQFIW--KKLHYDAAQTTIMHYWFGQAFFYFQGNSNNIATVDISVGFVGLESYVEAPAVFLTALSTYAGPLLWACHLVCYLS----SERDRSPVAVGHGCYCLALL-------RSVPAAAYIVLVTVLRYHLFIWSVFSPKLLY 868          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Match: pigo (phosphatidylinositol glycan anchor biosynthesis class O [Source:NCBI gene;Acc:101156144])

HSP 1 Score: 152.14 bits (383), Expect = 3.567e-37
Identity = 95/288 (32.99%), Postives = 151/288 (52.43%), Query Frame = 2
Query:  209 KVILIVIDALRFDMTEKYSSFNDLNTGV--YSN--------ISLR------YKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPP-TIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQ 1021
            + I+++IDAL+ D    ++ F+   T    Y N        +S R      Y  +   P+ TM RIK  TTG +  F D+  N  S+ I  DN+I  L +  +  + F GDDTW+ LFP +F +     SF VKD + VDN + +++   M    +WD+ + H+LG+DH GH  GP    +  KLT++   I  +++ +      N +L++V GDHGM+D G HGG ++ E   + F  S      + + ++ P  + Q+DL   +A+L G+PIP +S G +   L Q
Sbjct:   63 RAIILIIDALKID----FARFDSSKTTPRHYENKLPVLEEVVSSRPSQGRLYPFRADPPTTTMQRIKGFTTGSLPTFVDVGNNFASSAILEDNLIHQLGQTGR-HVVFMGDDTWESLFPKKFFRSLPFPSFNVKDLHTVDNGILQHLYTTMVG-DDWDVLVAHFLGVDHCGHRFGPDHPSMADKLTQMDGVIRSVIEHL-----QNDTLLVVMGDHGMTDTGDHGGESLKETDAALFLYSPTPVFAESNSQNEPNVVPQTDLVPTLALLLGIPIPYSSVGQVLLPLFQ 339          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Match: pign (phosphatidylinositol glycan anchor biosynthesis class N [Source:NCBI gene;Acc:101163532])

HSP 1 Score: 58.9214 bits (141), Expect = 2.656e-8
Identity = 44/175 (25.14%), Postives = 75/175 (42.86%), Query Frame = 2
Query:  557 VKDYYE-VDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSE-------LIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLK-----------------KFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIP 1006
            VK  +E   +N T   + +M+     ++  +H LG+D  GH   P SE       L+   + EL   +         +++      + T DHGM++ G HG    +E  T        +N+                  K ++     ++Q+D++ ++A L GVPIP NS GV+P
Sbjct:  184 VKSLFESAKSNSTLKASLLMDK----NIFFLHLLGIDTNGHAHRPMSEEYLNNIGLVDKGIAELVPVMEEFFGHDGRTAY------VFTSDHGMTNWGSHGAGHPSETLTPLVVWGAGVNVAQRVTEPQSYEDHFLQEWKLEHIRRVDVNQADIAPLMASLVGVPIPVNSVGVLP 348          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000000707.1 (SMESG000000707.1)

HSP 1 Score: 1080.47 bits (2793), Expect = 0.000e+0
Identity = 600/619 (96.93%), Postives = 601/619 (97.09%), Query Frame = 2
Query:   74 MSYKYXXXXXXXXXXXXXXXXXXXQFSASQTFKNTS--------------QYFQKLSVDKVILIVIDALRFDMTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPISKGTFPYCLRAFIHFIGLSVITATFSQNRCEYPXXXXXXXXXXXXXXXXXXXXXNRLDNAAKEFMELFCQIADKVKNRFLIIPVLXXXXXXXXXXXXXXXXXWYFMSTSFFLYLTLYSTKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLM 1888
            MSYKYFIKLILPFFGIILFIFGFIQFS SQTFKNTS              QYFQK SVDKVILIVIDALRFDMTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTW+KLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPIS GTFPYCLRAFIHFIGLSVITATFSQNRCEY LFYFLKIFIIFVIFVHILLQLNRLDNAAKEFMELFCQIADKVKNRFLIIPVLHFISQFSSSFIEEEHQFWYFMSTSFFLYLTLYSTKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLM
Sbjct:    1 MSYKYFIKLILPFFGIILFIFGFIQFSTSQTFKNTSRFIEKNCFIYFNLGQYFQKSSVDKVILIVIDALRFDMTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWNKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPISNGTFPYCLRAFIHFIGLSVITATFSQNRCEYQLFYFLKIFIIFVIFVHILLQLNRLDNAAKEFMELFCQIADKVKNRFLIIPVLHFISQFSSSFIEEEHQFWYFMSTSFFLYLTLYSTKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLM 619          

HSP 2 Score: 519.235 bits (1336), Expect = 3.123e-170
Identity = 278/279 (99.64%), Postives = 279/279 (100.00%), Query Frame = 1
Query: 1924 CLSGTSSGTNFVIFSFLIVNFTYRFVGLYKYHAEIYEFLIYISYLMIAQQIAAFIYCRLYRRFQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ 2760
            CLSGTSSGTNFVIFSFLIVNFTYRFVGLYKYHAEIYEFLIYISYLMIAQQIAAFIYCRLYRRFQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRA+LRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGSFSLISTSSCLSLMLICSLMRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ
Sbjct:  632 CLSGTSSGTNFVIFSFLIVNFTYRFVGLYKYHAEIYEFLIYISYLMIAQQIAAFIYCRLYRRFQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRAILRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGSFSLISTSSCLSLMLICSLMRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ 910          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000000707.1 (SMESG000000707.1)

HSP 1 Score: 1027.31 bits (2655), Expect = 0.000e+0
Identity = 544/547 (99.45%), Postives = 545/547 (99.63%), Query Frame = 2
Query:  248 MTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPISKGTFPYCLRAFIHFIGLSVITATFSQNRCEYPXXXXXXXXXXXXXXXXXXXXXNRLDNAAKEFMELFCQIADKVKNRFLIIPVLXXXXXXXXXXXXXXXXXWYFMSTSFFLYLTLYSTKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLM 1888
            MTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTW+KLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPIS GTFPYCLRAFIHFIGLSVITATFSQNRCEY LFYFLKIFIIFVIFVHILLQLNRLDNAAKEFMELFCQIADKVKNRFLIIPVLHFISQFSSSFIEEEHQFWYFMSTSFFLYLTLYSTKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLM
Sbjct:    1 MTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWNKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMELGVLLLFISFVGLLFDGFPISNGTFPYCLRAFIHFIGLSVITATFSQNRCEYQLFYFLKIFIIFVIFVHILLQLNRLDNAAKEFMELFCQIADKVKNRFLIIPVLHFISQFSSSFIEEEHQFWYFMSTSFFLYLTLYSTKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLM 547          

HSP 2 Score: 519.62 bits (1337), Expect = 3.369e-171
Identity = 278/279 (99.64%), Postives = 279/279 (100.00%), Query Frame = 1
Query: 1924 CLSGTSSGTNFVIFSFLIVNFTYRFVGLYKYHAEIYEFLIYISYLMIAQQIAAFIYCRLYRRFQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ 2760
            CLSGTSSGTNFVIFSFLIVNFTYRFVGLYKYHAEIYEFLIYISYLMIAQQIAAFIYCRLYRRFQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRA+LRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGSFSLISTSSCLSLMLICSLMRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ
Sbjct:  560 CLSGTSSGTNFVIFSFLIVNFTYRFVGLYKYHAEIYEFLIYISYLMIAQQIAAFIYCRLYRRFQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRAILRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGYISQSDLSHVSSRIQFISLAQLVGSFSLISTSSCLSLMLICSLMRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ 838          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000000653.1 (SMESG000000653.1)

HSP 1 Score: 286.189 bits (731), Expect = 8.421e-83
Identity = 169/409 (41.32%), Postives = 251/409 (61.37%), Query Frame = 2
Query:  185 YFQKLSVDKVILIVIDALRFDMT-EKYSSFNDL-----NTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMEL-------------GVLLL----FISFVGLLF 1342
            +FQK ++DKV+LIVID+LR DM  EK S + +L      T VYS      +  +Q PS+++ +IK+I TG +  F D+I N  S +I  DN+IDIL  +R F +NF+GD TW KLFP++F   D T  FFV+DY++VD NV+RNI  +++N   WDM IMHYLG+DHIGH EGPF+  I  KL+E+      +++ +     +N +L I+T DHGMSDLGGHGG++ NE+     F + K + K F +    ++ Q+D++  +++L GVPIP+++ GVIP ++L LID P+D+++AL SN+  L  L   N    +S F +I + I S+H  C       NCT +L  QH+ LI L+++I ++      Q N + +E+             G+LL+    FIS  G+LF
Sbjct:   22 FFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYST-----RANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNNAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFS-KTFTW-DLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIASSFSSINSSIFSIHRNCSFPYLL-NCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLF 422          

HSP 2 Score: 119.398 bits (298), Expect = 3.801e-27
Identity = 84/245 (34.29%), Postives = 127/245 (51.84%), Query Frame = 1
Query: 2110 FQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDG------------------------------YISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYF 2754
            FQ+ ++L  +  F  +FK   +S+++     +ICR  NI+L      KR   R+IWL  +RH  +I Q L FNMIGM+SFFQQGNS+SL+T+D+Q G+VGM  + P +I  ++ IHT+ G+ +WI +WIEWL+                                 I++ D   + S  Q    A +  SF  I++   L + L   L +  +  WSV+ P+LLY  F    L+  Y V+  +YF
Sbjct:  649 FQILFNLT-MKKFNQKFK---ISSIIFFTSFIICRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLIKSFEQKTHFAIIFNSFIFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYF 889          

HSP 3 Score: 59.3066 bits (142), Expect = 1.385e-8
Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 2
Query: 1712 TKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLM 1888
            T  +S+  S + F   +I IS    DRFLRT+N+TG+ W+++PD GDWL R  N NYLM
Sbjct:  535 TDAISVVKS-TYFATFIILIS----DRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLM 588          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000000653.1 (SMESG000000653.1)

HSP 1 Score: 286.574 bits (732), Expect = 9.733e-83
Identity = 169/409 (41.32%), Postives = 251/409 (61.37%), Query Frame = 2
Query:  185 YFQKLSVDKVILIVIDALRFDMT-EKYSSFNDL-----NTGVYSNISLRYKVKLQTPSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSFQFNTLFMEL-------------GVLLL----FISFVGLLF 1342
            +FQK ++DKV+LIVID+LR DM  EK S + +L      T VYS      +  +Q PS+++ +IK+I TG +  F D+I N  S +I  DN+IDIL  +R F +NF+GD TW KLFP++F   D T  FFV+DY++VD NV+RNI  +++N   WDM IMHYLG+DHIGH EGPF+  I  KL+E+      +++ +     +N +L I+T DHGMSDLGGHGG++ NE+     F + K + K F +    ++ Q+D++  +++L GVPIP+++ GVIP ++L LID P+D+++AL SN+  L  L   N    +S F +I + I S+H  C       NCT +L  QH+ LI L+++I ++      Q N + +E+             G+LL+    FIS  G+LF
Sbjct:   39 FFQKQTIDKVVLIVIDSLRPDMIFEKRSLWPNLMGIINKTWVYST-----RANIQPPSMSLAKIKSIITGAVVGFIDVIFNTDSGKIKQDNLIDILKSYRNFVINFYGDITWMKLFPDQFNVRDPTTPFFVRDYFQVDYNVSRNIPNILSNYKLWDMVIMHYLGIDHIGHAEGPFNNAIEEKLSEMDNKTMTLIQALFKKDKTNKTLFILTADHGMSDLGGHGGSSKNEVNVPLLFFNKKFS-KTFTW-DLDSLSQNDIAPSLSVLLGVPIPADNIGVIPLRILSLIDNPMDQTQALLSNYDQLSKLMGHNSVDIASSFSSINSSIFSIHRNCSFPYLL-NCTGNLSNQHKKLINLMKQITEVLKFRFIQHNFVILEIAHFLVILSSLVSFGILLMESGIFISVAGVLF 439          

HSP 2 Score: 119.398 bits (298), Expect = 3.394e-27
Identity = 84/245 (34.29%), Postives = 127/245 (51.84%), Query Frame = 1
Query: 2110 FQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVICRPHNIVLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQGNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLSDGY------------------------------ISQSDLSHVSSRIQFISLAQLVGXXXXXXXXXXXXXXXXXXXXRYHLFVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYF 2754
            FQ+ ++L  +  F  +FK   +S+++     +ICR  NI+L      KR   R+IWL  +RH  +I Q L FNMIGM+SFFQQGNS+SL+T+D+Q G+VGM  + P +I  ++ IHT+ G+ +WI +WIEWL+                                 I++ D   + S  Q    A +  SF  I++   L + L   L +  +  WSV+ P+LLY  F    L+  Y V+  +YF
Sbjct:  666 FQILFNLT-MKKFNQKFK---ISSIIFFTSFIICRNQNILLWTVIEIKRLFYRKIWLEEIRHLPLIFQYLIFNMIGMVSFFQQGNSNSLTTLDVQPGFVGMTSFVPQIIFPVVAIHTFAGNFYWIFIWIEWLAGDRLKIQYKLVVNQEANLKNSLEKTTDSTAIIPITEPDKPLIKSFEQKTHFAIIFNSFIFITSLFLLMIYLFAILHKNQITAWSVYAPKLLYMSFQGGFLLIIYSVVGRLYF 906          

HSP 3 Score: 59.3066 bits (142), Expect = 1.348e-8
Identity = 29/59 (49.15%), Postives = 39/59 (66.10%), Query Frame = 2
Query: 1712 TKKVSIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPENVNYLM 1888
            T  +S+  S + F   +I IS    DRFLRT+N+TG+ W+++PD GDWL R  N NYLM
Sbjct:  552 TDAISVVKS-TYFATFIILIS----DRFLRTLNRTGELWSHIPDFGDWLVRKSNTNYLM 605          
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Match: SMESG000064847.1 (SMESG000064847.1)

HSP 1 Score: 133.265 bits (334), Expect = 1.765e-31
Identity = 98/305 (32.13%), Postives = 159/305 (52.13%), Query Frame = 2
Query:  335 PSVTMPRIKTITTGDISNFFDLILNLKSTEITNDNIIDILIEHRK-FRLNFFGDDTWDKLFPNRFQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLS-----EWDMTIMHYLGLDHIGHVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDLGGHGGATVNELTTSAFFISNK-LNL-KKFDYRSPPTIDQSDLSTIIAILTGVPIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLD--LENLQSFSSEFETIRNKIESLHEICEKSIKPGNCTESLKIQHE 1219
            P+ T+ RIK +TTG +  F D+  N  S+E+  DNII+    HR  F L F GDDTW  LFPN+F       SF +KD   VD  V   +   + N +     + ++ + H LG+DH GH  G     +  KL EL++ I +I++ +        +L ++ GDHGM+  G HGG ++ E+    F +S K LN+  K   ++   + Q DL   ++ +TGV IP ++ GV+  +LL         SRA   +F+  +N+   ++ + S+ S+F  +    +S+ +  + SI   N  E+L+  H+
Sbjct:  102 PTTTLQRIKGMTTGSLPTFIDISSNFGSSELLEDNIINQW--HRSGFGLKFVGDDTWMDLFPNKFNISAPYPSFNIKDLDSVDKKVEEFVLNSLKNTTIGKYNKPEIILGHMLGIDHCGHTYGKNHRQMKRKLMELNEFIKKIVEFV-----DKDTLFVMLGDHGMTTSGDHGGDSIEEIDAGFFLMSGKPLNVYNKNSKQTENYLSQIDLVPTLSAITGVAIPFSNLGVLKPELLT------SNSRA---HFYTDLNIQQIIKYINSYESKFGNLGFP-QSIKKFLDNSINTNNTEENLRNLHQ 389          
The following BLAST results are available for this feature:
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIGG1.912e-5838.30phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG1.766e-5639.01phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG9.047e-5638.30phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG1.117e-5538.30phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG1.352e-5538.46phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F28C6.49.666e-4436.11pep chromosome:WBcel235:II:8596322:8599308:-1 gene... [more]
F28C6.49.666e-4436.11pep chromosome:WBcel235:II:8596322:8599317:-1 gene... [more]
F28C6.49.666e-4436.11pep chromosome:WBcel235:II:8596322:8600265:-1 gene... [more]
F28C6.41.482e-4336.11pep chromosome:WBcel235:II:8596300:8599308:-1 gene... [more]
F28C6.41.482e-4336.11pep chromosome:WBcel235:II:8596286:8599317:-1 gene... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PIG-G9.395e-4634.04gene:FBgn0033187 transcript:FBtr0088904[more]
PIG-O3.486e-3330.24gene:FBgn0034346 transcript:FBtr0086691[more]
PIG-N6.501e-624.08gene:FBgn0033479 transcript:FBtr0088431[more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
PIGG8.047e-5541.24si:ch73-49o8.1 [Source:ZFIN;Acc:ZDB-GENE-141215-6][more]
pigo2.478e-4129.80phosphatidylinositol glycan anchor biosynthesis, c... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIGG8.027e-6039.35phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG1.268e-5938.82phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG1.531e-5938.82phosphatidylinositol glycan anchor biosynthesis cl... [more]
PIGG2.248e-4534.91phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigo4.255e-2836.31phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pigg5.122e-5637.54phosphatidylinositol glycan anchor biosynthesis, c... [more]
Pigg5.513e-5637.54phosphatidylinositol glycan anchor biosynthesis, c... [more]
Pigo2.772e-3632.40phosphatidylinositol glycan anchor biosynthesis, c... [more]
Pigo1.721e-3532.51phosphatidylinositol glycan anchor biosynthesis, c... [more]
Pigo1.728e-3532.51phosphatidylinositol glycan anchor biosynthesis, c... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5H8A4|PIGG_HUMAN5.362e-5538.30GPI ethanolamine phosphate transferase 2 OS=Homo s... [more]
sp|Q6CLN2|GPI7_KLULA3.816e-5433.02GPI ethanolamine phosphate transferase 2 OS=Kluyve... [more]
sp|P40367|GPI7_YEAST7.567e-5436.00GPI ethanolamine phosphate transferase 2 OS=Saccha... [more]
sp|Q4WDM5|GPI7_ASPFU1.032e-5332.91GPI ethanolamine phosphate transferase 2 OS=Neosar... [more]
sp|Q758B8|GPI7_ASHGO7.508e-5237.62GPI ethanolamine phosphate transferase 2 OS=Ashbya... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1JP078.686e-6541.61Uncharacterized protein OS=Strigamia maritima OX=1... [more]
A0A183AXB31.134e-6334.55Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A5K3EVM81.225e-6337.18Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068WKL67.489e-6235.73Transferase OS=Echinococcus granulosus OX=6210 GN=... [more]
A0A068Y1U78.073e-6235.48Transferase OS=Echinococcus multilocularis OX=6211... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-49o8.11.272e-5436.59phosphatidylinositol glycan anchor biosynthesis cl... [more]
si:ch73-49o8.11.734e-5436.59phosphatidylinositol glycan anchor biosynthesis cl... [more]
si:ch73-49o8.12.032e-5436.86phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigo1.842e-3934.12phosphatidylinositol glycan anchor biosynthesis, c... [more]
pign1.029e-624.10phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch73-49o8.14.139e-5736.47phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigo3.438e-4231.97phosphatidylinositol glycan anchor biosynthesis, c... [more]
pign3.609e-827.03phosphatidylinositol glycan anchor biosynthesis, c... [more]
pign3.825e-827.08phosphatidylinositol glycan anchor biosynthesis, c... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
LAS211.090e-5536.00Integral plasma membrane protein; involved in the ... [more]
GPI131.380e-3134.12ER membrane localized phosphoryltransferase; adds ... [more]
MCD41.927e-722.36Protein involved in GPI anchor synthesis; multimem... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO451101.127e-5945.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476574.074e-4434.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451119.345e-1329.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475996.595e-725.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
si:ch73-49o8.12.286e-5341.18phosphatidylinositol glycan anchor biosynthesis cl... [more]
si:ch73-49o8.13.931e-5343.88phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigo3.567e-3732.99phosphatidylinositol glycan anchor biosynthesis cl... [more]
pign2.656e-825.14phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of GPI ethanolamine phosphate transferase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000707.13.123e-17096.93SMESG000000707.1[more]
SMESG000000707.13.369e-17199.45SMESG000000707.1[more]
SMESG000000653.18.421e-8341.32SMESG000000653.1[more]
SMESG000000653.19.733e-8341.32SMESG000000653.1[more]
SMESG000064847.11.765e-3132.13SMESG000064847.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026317 ID=SMED30026317|Name=GPI ethanolamine phosphate transferase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2762bp
ATTTAAAAGTTCATAATTGTCTTGATATTATTTTATTTAATAACTTTAAA
ATAAGAGTTATTTAATTTACTTTATGTCATATAAATATTTTATTAAATTA
ATATTGCCATTCTTTGGAATTATTCTTTTTATCTTTGGATTTATACAATT
TTCTGCCTCTCAAACATTCAAAAACACTAGTCAGTATTTTCAAAAATTAT
CTGTTGATAAGGTAATTCTAATTGTAATCGATGCATTGCGATTTGACATG
ACTGAAAAATATAGTAGCTTTAATGATTTAAATACTGGAGTGTATTCGAA
CATTTCACTTAGATATAAAGTTAAATTGCAAACTCCAAGTGTGACAATGC
CAAGAATAAAAACTATCACTACCGGAGACATTAGTAATTTTTTTGATCTT
ATCTTGAATCTCAAATCAACCGAAATCACAAATGATAACATTATAGACAT
TTTAATTGAACATCGAAAGTTTCGATTAAACTTTTTTGGAGATGATACTT
GGGATAAATTATTTCCAAATCGTTTTCAAAAAGTTGATTTGACAAATTCG
TTTTTCGTTAAAGATTACTATGAAGTCGATAATAATGTTACGAGAAATAT
TGCTTATATGATGAACAATTTAAGTGAATGGGACATGACGATAATGCATT
ATCTTGGTTTGGATCACATTGGGCATGTTGAAGGGCCATTTAGTGAATTA
ATTCCACCGAAACTCACAGAACTATCCCAAGCAATAAATCGAATTTTAAA
AGAGATTTTACATTCCAGTTTTTCTAATTCCAGCCTGATTATTGTCACTG
GAGATCACGGAATGAGTGATCTCGGTGGACACGGTGGCGCAACTGTTAAT
GAACTGACAACTTCGGCGTTTTTTATCAGCAATAAATTAAATTTAAAGAA
ATTCGATTATCGATCTCCTCCAACAATAGATCAAAGCGACCTGTCAACCA
TTATTGCGATATTAACCGGTGTCCCAATTCCTAGCAACAGTAGGGGGGTT
ATCCCTTATCAATTACTGCAATTGATTGACAGACCAATCGATCGATCTCG
AGCTCTGTTTAGCAACTTTTTTCATCTTATCAATCTTGACCTAGAAAACC
TCCAATCATTTTCCTCGGAATTCGAAACGATTCGCAATAAAATCGAATCA
TTGCATGAGATATGTGAAAAATCGATTAAACCAGGAAATTGCACCGAATC
TTTGAAAATTCAACACGAAAATCTCATTGAATTACTCAGGCGAATCCAGC
AATTAAAACTTGCCAACTCTTTCCAATTCAACACACTCTTTATGGAATTG
GGAGTTCTGTTACTTTTCATTAGTTTTGTCGGGCTTCTTTTCGATGGTTT
CCCAATTTCCAAGGGAACATTTCCTTATTGCTTGAGGGCTTTTATTCATT
TTATAGGCTTATCTGTAATCACCGCGACTTTCTCGCAAAATCGTTGTGAA
TATCCGTTGTTCTATTTTCTGAAGATTTTTATTATATTTGTTATTTTTGT
ACATATTTTGCTGCAACTCAATCGATTGGATAATGCTGCCAAGGAATTCA
TGGAGCTGTTTTGTCAGATAGCAGACAAGGTTAAAAACCGATTTTTAATT
ATACCAGTCTTGCATTTTATCAGTCAGTTTTCCAGTAGTTTCATTGAAGA
AGAACACCAATTTTGGTATTTTATGTCGACTTCTTTTTTTCTTTACCTTA
CATTATATTCAACTAAAAAAGTGTCAATTTATAACTCATTTTCGATGTTT
ACTGAATGTATGATTTATATCTCTGTTCCCATATTGGATAGATTTCTTCG
AACGGTAAATCAAACCGGTGACAAATGGGCTTATTTACCAGATTTAGGAG
ATTGGTTGAATAGGCCCGAAAATGTGAATTATTTAATGATATTGCTGCTC
ATTTCAATATTTTTGATTTTTTCTGTTTGTCTGGCACATCTTCCGGAACG
AATTTTGTTATTTTCTCATTTTTAATCGTTAATTTCACATATCGTTTCGT
CGGATTGTATAAGTACCATGCTGAAATCTATGAATTCTTGATTTACATTA
GTTATTTGATGATTGCTCAACAAATTGCGGCATTCATCTACTGTCGACTC
TACCGGAGATTTCAACTTAAATATTCTTTGTATTTTCTTTCTTCATTTAT
GAGTCGATTCAAAAGCGTAAAATTGTCAAACGTCCTTCTAATGCTGATGA
TTGTGATATGTCGTCCACATAACATTGTCTTGTTGGCGGGATTCGTATGT
AAGCGCGCAATGCTACGGAGGATTTGGTTGTACAATTTGCGCCATAGAAA
TGTAATTGAACAATTATTATTCTTTAACATGATTGGAATGATGTCATTTT
TCCAACAGGGAAATTCACACAGCCTTTCAACAGTTGATATACAAACCGGT
TATGTCGGCATGAGAATTTATCAACCGGTACTCATTGGGATTCTGTTAAC
CATTCACACTTGGTTCGGACATCTCTTTTGGATTATTGTCTGGATCGAGT
GGCTTTCAGATGGATATATTTCCCAATCAGATTTATCGCATGTTTCCAGT
CGAATCCAATTCATATCATTAGCACAATTAGTTGGCAGTTTCTCATTAAT
TAGTACGAGCTCTTGTCTGTCGTTGATGCTGATTTGTAGCTTGATGAGAT
ATCATTTGTTTGTTTGGTCGGTTTTTACTCCTCGGCTGCTTTACTGTTGT
TTTTTTTATCTGGTTCTCATGCCTTGCTATTTTGTACTTTCTTTAATATA
TTTTAACCAATG
back to top

protein sequence of SMED30026317-orf-1

>SMED30026317-orf-1 ID=SMED30026317-orf-1|Name=SMED30026317-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MIAQQIAAFIYCRLYRRFQLKYSLYFLSSFMSRFKSVKLSNVLLMLMIVI
CRPHNIVLLAGFVCKRAMLRRIWLYNLRHRNVIEQLLFFNMIGMMSFFQQ
GNSHSLSTVDIQTGYVGMRIYQPVLIGILLTIHTWFGHLFWIIVWIEWLS
DGYISQSDLSHVSSRIQFISLAQLVGSFSLISTSSCLSLMLICSLMRYHL
FVWSVFTPRLLYCCFFYLVLMPCYFVLSLIYFNQ
back to top

protein sequence of SMED30026317-orf-2

>SMED30026317-orf-2 ID=SMED30026317-orf-2|Name=SMED30026317-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=634bp
MSYKYFIKLILPFFGIILFIFGFIQFSASQTFKNTSQYFQKLSVDKVILI
VIDALRFDMTEKYSSFNDLNTGVYSNISLRYKVKLQTPSVTMPRIKTITT
GDISNFFDLILNLKSTEITNDNIIDILIEHRKFRLNFFGDDTWDKLFPNR
FQKVDLTNSFFVKDYYEVDNNVTRNIAYMMNNLSEWDMTIMHYLGLDHIG
HVEGPFSELIPPKLTELSQAINRILKEILHSSFSNSSLIIVTGDHGMSDL
GGHGGATVNELTTSAFFISNKLNLKKFDYRSPPTIDQSDLSTIIAILTGV
PIPSNSRGVIPYQLLQLIDRPIDRSRALFSNFFHLINLDLENLQSFSSEF
ETIRNKIESLHEICEKSIKPGNCTESLKIQHENLIELLRRIQQLKLANSF
QFNTLFMELGVLLLFISFVGLLFDGFPISKGTFPYCLRAFIHFIGLSVIT
ATFSQNRCEYPLFYFLKIFIIFVIFVHILLQLNRLDNAAKEFMELFCQIA
DKVKNRFLIIPVLHFISQFSSSFIEEEHQFWYFMSTSFFLYLTLYSTKKV
SIYNSFSMFTECMIYISVPILDRFLRTVNQTGDKWAYLPDLGDWLNRPEN
VNYLMILLLISIFLIFSVCLAHLPERILLFSHF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006506GPI anchor biosynthetic process
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0051377mannose-ethanolamine phosphotransferase activity
GO:0003824catalytic activity
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039527PIGG/GPI7
IPR017849Alkaline_Pase-like_a/b/a
IPR002591Phosphodiest/P_Trfase
IPR017850Alkaline_phosphatase_core_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017850Alkaline-phosphatase-like, core domain superfamilyGENE3DG3DSA:3.40.720.10coord: 45..320
e-value: 1.1E-35
score: 125.5
IPR017850Alkaline-phosphatase-like, core domain superfamilySUPERFAMILYSSF53649Alkaline phosphatase-likecoord: 45..309
IPR002591Type I phosphodiesterase/nucleotide pyrophosphatase/phosphate transferasePFAMPF01663Phosphodiestcoord: 180..260
e-value: 1.2E-9
score: 38.2
IPR039527GPI ethanolamine phosphate transferase 2PANTHERPTHR23072PHOSPHATIDYLINOSITOL GLYCAN-RELATEDcoord: 7..624
NoneNo IPR availableTMHMMTMhelixcoord: 431..453
NoneNo IPR availableTMHMMTMhelixcoord: 399..421
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 460..482
NoneNo IPR availableTMHMMTMhelixcoord: 601..623
NoneNo IPR availableTMHMMTMhelixcoord: 552..571
NoneNo IPR availableTMHMMTMhelixcoord: 528..545