Actin-related protein 2/3 complex subunit 5

Overview
NameActin-related protein 2/3 complex subunit 5
Smed IDSMED30026316
Length (bp)693
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin-related protein 2/3 complex subunit 5 (SMED30026316) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin-related protein 2/3 complex subunit 5 (SMED30026316) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin-related protein 2/3 complex subunit 5 (SMED30026316) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin-related protein 2/3 complex subunit 5 (SMED30026316) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026316

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30026316h1SMcG0022327 dd_Smed_v4_781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026316h1SMcG0022327 dd_Smed_v4_781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026316h1SMcG0022327 dd_Smed_v4_781_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026316h1SMcG0022327 dd_Smed_v4_781_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Human
Match: ARPC5L (actin related protein 2/3 complex subunit 5 like [Source:HGNC Symbol;Acc:HGNC:23366])

HSP 1 Score: 113.62 bits (283), Expect = 2.903e-31
Identity = 57/153 (37.25%), Postives = 91/153 (59.48%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEIS----DSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FR+VD+D F +N F D+Q E  +       +  EV  L+     L A    L  +P  + NQA+K++A  ++ +++ +FKS++I+  V+ L+   +D+L+KY+YK FE P ENS+ +LL WH+        G ++RVLT RK V
Sbjct:    1 MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV 153          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Human
Match: ARPC5L (actin related protein 2/3 complex subunit 5 like [Source:HGNC Symbol;Acc:HGNC:23366])

HSP 1 Score: 113.62 bits (283), Expect = 2.903e-31
Identity = 57/153 (37.25%), Postives = 91/153 (59.48%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEIS----DSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FR+VD+D F +N F D+Q E  +       +  EV  L+     L A    L  +P  + NQA+K++A  ++ +++ +FKS++I+  V+ L+   +D+L+KY+YK FE P ENS+ +LL WH+        G ++RVLT RK V
Sbjct:    1 MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV 153          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Human
Match: ARPC5 (actin related protein 2/3 complex subunit 5 [Source:HGNC Symbol;Acc:HGNC:708])

HSP 1 Score: 110.538 bits (275), Expect = 4.680e-30
Identity = 53/142 (37.32%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  138 KFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            +FRKVDVD + +N F D++   +     +E EV + +       AL+  L   P  + +QA+KD+A  I+ ++++SFK+N I+  V+ L++  +D+L+KY+YK FE P +NS+ +LL WH+        G ++RVLT RK V
Sbjct:   10 RFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV 151          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Human
Match: ARPC5 (actin related protein 2/3 complex subunit 5 [Source:HGNC Symbol;Acc:HGNC:708])

HSP 1 Score: 108.612 bits (270), Expect = 2.832e-29
Identity = 54/145 (37.24%), Postives = 92/145 (63.45%), Query Frame = 3
Query:  138 KFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLV--ALSKNL-EALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            +FRKVDVD + +N F D++   +     +E EV + +  +++ N+  AL+  L   P  + +QA+KD+A  I+ ++++SFK+N I+  V+ L++  +D+L+KY+YK FE P +NS+ +LL WH+        G ++RVLT RK V
Sbjct:   10 RFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRHSITGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKALAAGGVGSIVRVLTARKTV 154          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Human
Match: ARPC5 (actin related protein 2/3 complex subunit 5 [Source:HGNC Symbol;Acc:HGNC:708])

HSP 1 Score: 97.0561 bits (240), Expect = 4.673e-25
Identity = 45/123 (36.59%), Postives = 78/123 (63.41%), Query Frame = 3
Query:  138 KFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCI 503
            +FRKVDVD + +N F D++   +     +E EV + +       AL+  L   P  + +QA+KD+A  I+ ++++SFK+N I+  V+ L++  +D+L+KY+YK FE P +NS+ +LL WH+ +
Sbjct:   10 RFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHEKV 132          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Celegans
Match: arx-7 (Actin-related protein 2/3 complex subunit 5 [Source:UniProtKB/TrEMBL;Acc:O61861])

HSP 1 Score: 84.7297 bits (208), Expect = 1.503e-20
Identity = 48/154 (31.17%), Postives = 92/154 (59.74%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEISDSIN----EQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVL-LLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ N ++  +RK+DVD F    +  D+++E  D+      E+ V   ++ ++  +AL   L   P  + +Q +KD+A +++++++ SFK+ +I+ TV++L+  E DIL+KYVYK+ E   + +    LL WH  +  +  +G +MRV + R+R+
Sbjct:    1 MSKNMQNTSYRKLDVDSFDPEQY--DENDETVDTPGLGPDERAVQGFLSSNRLEDALHAALLSPPLKTKDQNVKDRATQLVTKVLQSFKNAEIEATVQKLSIEESDILMKYVYKSMEIGADAAVCQSLLAWHAQLVAKFGHGAIMRVFSGRQRL 152          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Celegans
Match: C46H11.3 (Probable actin-related protein 2/3 complex subunit 5 [Source:UniProtKB/Swiss-Prot;Acc:P91167])

HSP 1 Score: 83.1889 bits (204), Expect = 6.043e-20
Identity = 46/141 (32.62%), Postives = 82/141 (58.16%), Query Frame = 3
Query:  141 FRKVDVDLFSDNNFKDDQSEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVL-LLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            ++K +VD+F   +F+D Q E      N QEV   +  ++   AL+ VL   P   S Q LK++A  +++ +I +F+   I+ +V +L+    DIL+KY+YKA +   +++  L LL WH  +  +   G ++RVL++R+R+
Sbjct:    6 YKKYNVDIFHPAHFEDIQEESADCGPNVQEVRQFLESNRLEYALQSVLLNPPFGHSEQELKNRAVLLVAEVIHAFRQTDIEESVHKLSNENGDILMKYIYKAMQLCSDSATCLSLLLWHSQLVSKFGQGSIVRVLSNRQRL 146          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Fly
Match: Arpc5 (gene:FBgn0031437 transcript:FBtr0335170)

HSP 1 Score: 123.635 bits (309), Expect = 1.897e-35
Identity = 60/151 (39.74%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFK-DDQSEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETEL-DILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  N FRK+DVD ++++NF+ DD  E  +   +E E++ L+   K++EAL   L  AP    NQ +KD A  I  R+++S KS Q+   ++ L++ +L D+L+KY+Y+ FE P E S+  LL WH+  + +   GC++RVL+D  R 
Sbjct:    1 MAKNTSSNAFRKIDVDQYNEDNFREDDGVESAAAGPDESEITTLLTQGKSVEALLSALQNAPLRCKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLLQWHEKAFAKGGVGCIVRVLSDTNRA 151          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Fly
Match: Arpc5 (gene:FBgn0031437 transcript:FBtr0077694)

HSP 1 Score: 123.635 bits (309), Expect = 1.897e-35
Identity = 60/151 (39.74%), Postives = 94/151 (62.25%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFK-DDQSEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETEL-DILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  N FRK+DVD ++++NF+ DD  E  +   +E E++ L+   K++EAL   L  AP    NQ +KD A  I  R+++S KS Q+   ++ L++ +L D+L+KY+Y+ FE P E S+  LL WH+  + +   GC++RVL+D  R 
Sbjct:    1 MAKNTSSNAFRKIDVDQYNEDNFREDDGVESAAAGPDESEITTLLTQGKSVEALLSALQNAPLRCKNQNVKDHALNITLRVLLSIKSTQMDQAIDTLDQNDLIDVLMKYIYRGFEIPSEGSSGHLLQWHEKAFAKGGVGCIVRVLSDTNRA 151          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Zebrafish
Match: arpc5lb (actin related protein 2/3 complex, subunit 5-like, b [Source:ZFIN;Acc:ZDB-GENE-060531-161])

HSP 1 Score: 126.716 bits (317), Expect = 1.510e-36
Identity = 60/150 (40.00%), Postives = 93/150 (62.00%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEI-SDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FRKVD+D F +N F DD  E       +  EV NL+     + AL + L   P  S N A+K++A  ++ R++ SFKS+ I+  V+ L++  +D+L+KY+YK FE P +NS+ +LL WH+ ++     GC++RV+T RK V
Sbjct:    1 MAKNTLSSRFRKVDIDEFDENKFVDDHDEAADQQGPDALEVDNLLRQGDTMSALHIALRNPPIHSKNPAIKERAQTVVFRVLTSFKSSDIEPAVKSLDKNGVDLLMKYIYKGFERPTDNSSAILLQWHEKVFAAGGLGCIVRVMTARKSV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Zebrafish
Match: arpc5lb (actin related protein 2/3 complex, subunit 5-like, b [Source:ZFIN;Acc:ZDB-GENE-060531-161])

HSP 1 Score: 126.716 bits (317), Expect = 1.510e-36
Identity = 60/150 (40.00%), Postives = 93/150 (62.00%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEI-SDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FRKVD+D F +N F DD  E       +  EV NL+     + AL + L   P  S N A+K++A  ++ R++ SFKS+ I+  V+ L++  +D+L+KY+YK FE P +NS+ +LL WH+ ++     GC++RV+T RK V
Sbjct:    1 MAKNTLSSRFRKVDIDEFDENKFVDDHDEAADQQGPDALEVDNLLRQGDTMSALHIALRNPPIHSKNPAIKERAQTVVFRVLTSFKSSDIEPAVKSLDKNGVDLLMKYIYKGFERPTDNSSAILLQWHEKVFAAGGLGCIVRVMTARKSV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Zebrafish
Match: arpc5b (actin related protein 2/3 complex, subunit 5B [Source:ZFIN;Acc:ZDB-GENE-040120-7])

HSP 1 Score: 118.627 bits (296), Expect = 1.846e-33
Identity = 60/150 (40.00%), Postives = 93/150 (62.00%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ NT  ++FRKVDVD + +N F D++   E     +E EV +L+     + AL+ VL   P  + NQ +KD+A  ++ +++ SFKS  I+  V+ L++  +D+L+KY+YK FE P ENS+ +LL WH+        GC++RVLT RK V
Sbjct:    1 MSKNTVSDRFRKVDVDEYDENKFVDEEEGGENQLGPDEAEVDSLIRQGNLMGALQAVLKNPPINTKNQNVKDRAEGLVLKVLSSFKSTDIEKGVQSLDKNGVDLLMKYIYKGFERPSENSSAVLLQWHEKALSAGGVGCIVRVLTARKTV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Zebrafish
Match: arpc5b (actin related protein 2/3 complex, subunit 5B [Source:ZFIN;Acc:ZDB-GENE-040120-7])

HSP 1 Score: 118.627 bits (296), Expect = 1.846e-33
Identity = 60/150 (40.00%), Postives = 93/150 (62.00%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ NT  ++FRKVDVD + +N F D++   E     +E EV +L+     + AL+ VL   P  + NQ +KD+A  ++ +++ SFKS  I+  V+ L++  +D+L+KY+YK FE P ENS+ +LL WH+        GC++RVLT RK V
Sbjct:    1 MSKNTVSDRFRKVDVDEYDENKFVDEEEGGENQLGPDEAEVDSLIRQGNLMGALQAVLKNPPINTKNQNVKDRAEGLVLKVLSSFKSTDIEKGVQSLDKNGVDLLMKYIYKGFERPSENSSAVLLQWHEKALSAGGVGCIVRVLTARKTV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Zebrafish
Match: arpc5a (actin related protein 2/3 complex, subunit 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8448])

HSP 1 Score: 115.546 bits (288), Expect = 3.379e-32
Identity = 58/150 (38.67%), Postives = 94/150 (62.67%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ NT  ++FRKVDVD + +N F D++   E     +E EV +L+     + AL+ VL   P  + NQ +KD+A  ++ +++ SFK++ I+  V+ L++T +D+L+KY+YK FE P +NS+ +LL WH+        G ++RVLT RK V
Sbjct:    1 MSKNTVSDRFRKVDVDEYDENKFVDEEDGGENQLGPDEAEVDSLIRSGNLMGALQAVLKNPPIHTKNQNVKDRAEGLVLKVLSSFKASDIEKAVQSLDKTGVDLLMKYIYKGFERPSDNSSAILLQWHEKALSAGGVGSIVRVLTARKTV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Xenopus
Match: arpc5 (actin related protein 2/3 complex subunit 5 [Source:NCBI gene;Acc:549996])

HSP 1 Score: 117.087 bits (292), Expect = 1.079e-32
Identity = 57/150 (38.00%), Postives = 93/150 (62.00%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT   +FRKVDVD + +N F D++ + E     +E EV + +     + AL+  L   P  + NQ+ KD+A  ++ ++++SFK+N I+  V+ L++  +D+L+KY+YK FE P +NS+ +LL WH+     +  G ++RVLT RK V
Sbjct:    1 MAKNTVSARFRKVDVDEYDENKFVDEEEAGEGQQGPDEGEVDSAIRGGNMMGALQAALKNPPINTKNQSAKDRAEHLVLKVLISFKANDIEKAVQSLDKNNMDLLMKYIYKGFESPSDNSSAVLLQWHEKALAVAGVGSIVRVLTARKTV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Xenopus
Match: mknk1 (MAP kinase interacting serine/threonine kinase 1 [Source:Xenbase;Acc:XB-GENE-979969])

HSP 1 Score: 117.087 bits (292), Expect = 1.272e-32
Identity = 61/152 (40.13%), Postives = 90/152 (59.21%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEIS---DSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FRKVD+D + +N F DDQ +E        +E EV +L+     L A +  L  +P  S NQ +K++   I+ +++ SFKSN I+  V  L+   +D+L+KY+YK FE P ENS+ +LL WH+        G ++RVLT RK V
Sbjct:    1 MAKNTLSSRFRKVDIDEYDENKFVDDQLQEEPAEPQGPDEAEVDSLIRQGDLLRAFQSALRNSPVNSKNQVVKERTQAIVLKVLTSFKSNDIEKAVNTLDPNGIDLLMKYIYKGFEKPTENSSAILLQWHEKALVIGGLGSIVRVLTSRKTV 152          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Mouse
Match: Arpc5l (actin related protein 2/3 complex, subunit 5-like [Source:MGI Symbol;Acc:MGI:1921442])

HSP 1 Score: 110.538 bits (275), Expect = 3.948e-30
Identity = 56/153 (36.60%), Postives = 90/153 (58.82%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEISDSINEQ----EVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FR+VD+D F +N F D+  E  + +        EV  L+     L A    L  +P  + NQA+K++A  ++ +++ +FKS++I+  V+ L+   +D+L+KY+YK FE P ENS+ +LL WH+        G ++RVLT RK V
Sbjct:    1 MARNTLSSRFRRVDIDEFDENKFVDEHEEAAAAAGEPGPDPCEVDGLLRQGDMLRAFHAALRNSPINTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGIDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV 153          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Mouse
Match: Arpc5 (actin related protein 2/3 complex, subunit 5 [Source:MGI Symbol;Acc:MGI:1915021])

HSP 1 Score: 109.768 bits (273), Expect = 5.495e-30
Identity = 53/142 (37.32%), Postives = 87/142 (61.27%), Query Frame = 3
Query:  138 KFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            +FRKVDVD + +N F D++   +     +E EV + +       AL+  L   P  + +QA+KD+A  I+ ++++SFK+N I+  V+ L++  +D+L+KY+YK FE P +NS+ +LL WH+        G ++RVLT RK V
Sbjct:   10 RFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV 151          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q641B9|APC5C_XENLA (Actin-related protein 2/3 complex subunit 5-C OS=Xenopus laevis OX=8355 GN=arpc5-c PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 6.250e-34
Identity = 59/150 (39.33%), Postives = 95/150 (63.33%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT   +FRKVDVD + +N F D++ + E     +E EV + +     + AL+ VL   P  + NQ+ KDQA  ++ ++++SFK+N+I+  V+ L++  +D+L+KY+YK FE P +NS+ +LL WH+     +  G ++RVLT RK V
Sbjct:    1 MAKNTVSARFRKVDVDEYDENKFVDEEEAGEGQQGPDEGEVDSAIRGGNMMGALQAVLKNPPINTKNQSAKDQAEHLVLKVLISFKANEIEKAVQSLDKNSMDLLMKYIYKGFESPSDNSSAVLLQWHEKALAVAGVGSIVRVLTARKTV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q6DE18|APC5B_XENLA (Actin-related protein 2/3 complex subunit 5-B OS=Xenopus laevis OX=8355 GN=arpc5-b PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 5.247e-33
Identity = 62/152 (40.79%), Postives = 94/152 (61.84%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISD--SINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FRKVD+D + +N F DDQ  EE ++    +E EV +L+   + L A +  L  +P  S NQ  K++   I+ +++ SFKSN+I+  V  L+   +D+L+KY+YK FE P ENS+ +LL WH+  +     G ++RVLT RK V
Sbjct:    1 MAKNTLSSRFRKVDIDEYDENKFVDDQLQEEPAEPQGPDEAEVDSLIRQGELLRAFQSALRNSPVNSKNQVAKERTQAIVLKVLTSFKSNEIEKAVNTLDPNGIDLLMKYIYKGFEKPTENSSAILLQWHEKAFVIGGLGSIVRVLTSRKTV 152          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q68FI4|APC5A_XENLA (Actin-related protein 2/3 complex subunit 5-A OS=Xenopus laevis OX=8355 GN=arpc5-a PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 6.715e-32
Identity = 57/150 (38.00%), Postives = 93/150 (62.00%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT   +FRKVDVD + +N F D++ + E     +E EV + +     + AL+  L   P  + NQ+ KD+A  ++ ++++SFK+N+I+  V+ L++   D+L+KY+YK FE P +NS+ +LL WH+     +  G ++RVLT RK V
Sbjct:    1 MAKNTVSARFRKVDVDEYDENKFVDEEEAGEGQQGPDEGEVDSAIRGGNMMGALQAALKNPPINTKNQSAKDRAENLVLKVLISFKANEIEKAVQSLDKNSTDLLMKYIYKGFESPSDNSSAVLLQWHEKALAVAGVGSIVRVLTARKTV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. UniProt/SwissProt
Match: sp|A1L108|ARP5L_RAT (Actin-related protein 2/3 complex subunit 5-like protein OS=Rattus norvegicus OX=10116 GN=Arpc5l PE=1 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 2.033e-31
Identity = 58/153 (37.91%), Postives = 90/153 (58.82%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEISDSINEQ----EVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FR+VD+D F +N F D+  E  + S        EV  L+     L A    L  +P  + NQA+K++A  I+ +++ +FKS++I+  V+ L+   +D+L+KY+YK FE P ENS+ +LL WH+        G ++RVLT RK V
Sbjct:    1 MARNTLSSRFRRVDIDEFDENKFVDEHEEAAAASGEPGPDPCEVDGLLRQGDMLRAFHAALRNSPINTKNQAVKERAQGIVLKVLTNFKSSEIEQAVQSLDRNGIDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV 153          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. UniProt/SwissProt
Match: sp|Q5R4M1|ARP5L_PONAB (Actin-related protein 2/3 complex subunit 5-like protein OS=Pongo abelii OX=9601 GN=ARPC5L PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.394e-30
Identity = 57/153 (37.25%), Postives = 91/153 (59.48%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEIS----DSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FR+VD+D F +N F D+Q E  +       +  EV  L+     L A    L  +P  + NQA+K++A  ++ +++ +FKS++I+  V+ L+   +D+L+KY+YK FE P ENS+ +LL WH+        G ++RVLT RK V
Sbjct:    1 MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKNQAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV 153          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. TrEMBL
Match: A0A1S3HX18 (Actin-related protein 2/3 complex subunit 5 OS=Lingula unguis OX=7574 GN=LOC106158245 PE=3 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.234e-44
Identity = 71/150 (47.33%), Postives = 108/150 (72.00%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEISD-SINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ NT DNKFRK+DVD ++++N++D+ +++  D   NEQEVS+ ++  KNLEAL+ VLS  P  + NQA KD+A +++ R+++SFK   I   V  L+   LD+L+KY+Y+ FE+P E S+  LLTWH+ +++   YGC+MRVLT RK+V
Sbjct:    1 MSKNTADNKFRKIDVDQYNEDNYQDEVADDGQDMGPNEQEVSSFLSQGKNLEALQAVLSNPPVETKNQAAKDRALQLVMRVLLSFKVADIDKGVNALDSQTLDVLMKYIYRGFENPSEGSSAQLLTWHEKVFEIGGYGCIMRVLTQRKKV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. TrEMBL
Match: A0A1S3HUB2 (Actin-related protein 2/3 complex subunit 5 OS=Lingula unguis OX=7574 GN=LOC106158245 PE=3 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 6.366e-43
Identity = 70/150 (46.67%), Postives = 107/150 (71.33%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEISD-SINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ NT DNKFRK+DVD ++++N++D+ +++  D   NEQEVS+ ++  KNLEAL+ VLS  P  + NQA KD+A +++ R+++SFK   I   V  L+   LD+L+KY+Y+ FE+P E S+  LLTWH+  +++   GC++RVLTDRK V
Sbjct:    1 MSKNTADNKFRKIDVDQYNEDNYQDEVADDGQDMGPNEQEVSSFLSQGKNLEALQAVLSNPPVETKNQAAKDRALQLVMRVLLSFKVADIDKGVNALDSQTLDVLMKYIYRGFENPSEGSSAQLLTWHEKSFKKGGLGCIVRVLTDRKMV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. TrEMBL
Match: A0A183IXT8 (Actin-related protein 2/3 complex subunit 5 OS=Soboliphyme baturini OX=241478 GN=SBAD_LOCUS8436 PE=3 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 5.563e-41
Identity = 63/151 (41.72%), Postives = 110/151 (72.85%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEISDSI--NEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NTR   FRK+DVD ++++ +KD+  E+ + ++  +E+EV+ L+ +++N+EALK+ L   P  + NQALKD+A +++ R++ SF+   I++ V+ L++ ++D+++KY+YK FE P + S+ +LL WHD +YQ    GC++RVLTDR+R+
Sbjct:    1 MAKNTRSTAFRKIDVDAYNEDQYKDEDQEQDATTVGPDEEEVTKLLQMNRNVEALKMALKNPPLKTRNQALKDRATQLVVRVLCSFRQADIESAVQSLDKDQIDLIMKYIYKGFEFPQDGSSSVLLAWHDKVYQVGGNGCIVRVLTDRRRL 151          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. TrEMBL
Match: A0A0P6EM95 (Actin-related protein 2/3 complex subunit 5 OS=Daphnia magna OX=35525 PE=3 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 6.278e-39
Identity = 66/152 (43.42%), Postives = 104/152 (68.42%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDD---QSEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  + FRK+DVD ++++N+K+D   +S+      +E+E++N +   KN+EALK VL  AP +S NQ +KD A  ++ ++++S KS+QI+  V  L+   LDIL+KY+Y+ FE P E S+  LL WH+ ++  +  GC++RVLTD+KRV
Sbjct:    1 MAKNTSSSAFRKIDVDQYNEDNYKEDDCGESQSPPVGPDEKEITNFINQGKNIEALKTVLRNAPISSRNQMIKDAALNVVMQVLLSVKSSQIEEAVNALDRDHLDILMKYIYRGFETPSEGSSGQLLAWHEKVHAVAGVGCIVRVLTDKKRV 152          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. TrEMBL
Match: A0A4S2KHS1 (Actin-related protein 2/3 complex subunit 5 OS=Opisthorchis felineus OX=147828 GN=CRM22_010941 PE=3 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 8.523e-39
Identity = 68/151 (45.03%), Postives = 106/151 (70.20%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEISDS-INEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPEN-SNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT D KFRKVDVD ++++ F+D+Q+++ S + +NE +V  L+  +K  EAL LVL  AP  S +QALKD A++ + R++   K+  I   V  L+E ++D+L+KY+Y+ FE  P++ +N  LLTWH+ ++ R K GC++RVLTDR+R+
Sbjct:    1 MAKNTGDTKFRKVDVDQYTESAFQDEQADDSSATKLNEFDVRGLLEKAKFDEALALVLQNAPINSKDQALKDTAFRYVMRLLSQIKAQNIDEFVAGLDEPKIDLLMKYIYRGFEQQPQDTTNATLLTWHEKVHARGKSGCIIRVLTDRRRI 151          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Cavefish
Match: arpc5b (actin related protein 2/3 complex subunit 5 [Source:NCBI gene;Acc:103045524])

HSP 1 Score: 120.553 bits (301), Expect = 3.813e-34
Identity = 60/150 (40.00%), Postives = 95/150 (63.33%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ NT  ++FRKVDVD + +N F D++   E     +E EV +L+     +EAL+ VL   P  + NQ +KD+A  ++ +++ SFK++ I+  V+ L++  +D+L+KY+YK FE P ENS+ +LL WH+        GC++RVLT RK V
Sbjct:    1 MSKNTVSDRFRKVDVDEYDENKFVDEEDGGENQLGPDEAEVDSLIRQGNLMEALQAVLKNPPINTKNQNVKDRAEGLVLKVLSSFKASDIEKGVQSLDKNGVDLLMKYIYKGFERPSENSSAILLQWHEKALSAGGVGCIVRVLTARKTV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Cavefish
Match: arpc5la (actin-related protein 2/3 complex subunit 5-like protein [Source:NCBI gene;Acc:103043418])

HSP 1 Score: 111.309 bits (277), Expect = 1.182e-30
Identity = 54/150 (36.00%), Postives = 89/150 (59.33%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEI-SDSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FR +D+D + +N F D+Q E       +  EV  L+   + + A  + L   P  S N A+K++A  ++ R++ SFKS+ I+  V+ L+   +D+L+KY+Y+ FE P +NS+ +LL WH+  +     G ++RVLT RK V
Sbjct:    1 MARNTLPSRFRGLDIDEYDENRFVDEQDEAAEQQGPDGAEVDALLRRGEMITAFHIALRNPPINSKNPAVKERAQAVVLRVLTSFKSSDIEPAVKSLDRNGVDLLMKYIYRGFEKPSDNSSAILLQWHEKAFAVGGLGSIVRVLTARKSV 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Cavefish
Match: arpc5a (actin related protein 2/3 complex, subunit 5A [Source:ZFIN;Acc:ZDB-GENE-030131-8448])

HSP 1 Score: 104.375 bits (259), Expect = 6.130e-28
Identity = 58/152 (38.16%), Postives = 92/152 (60.53%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLEALK--LVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ NT  ++FRKVDVD + +N F D++   E     +E EV +L+        LK   VL   P  + NQ +KD+A  ++ +++ +FKS+ I+  V+ L++ ++D+L+KY+YK FE P ENS+ +LL WH+        G ++RVLT RK V
Sbjct:    1 MSKNTVSDRFRKVDVDEYDENKFVDEEDGGENQLGPDEAEVDSLI----RQYPLKHSAVLKNPPINTKNQNVKDRAEGLVLKVLTAFKSSDIEKAVQSLDKNKVDLLMKYIYKGFERPSENSSAVLLQWHEKALSAGGVGSIVRVLTARKTV 148          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Cavefish
Match: arpc5lb (actin related protein 2/3 complex, subunit 5-like, b [Source:ZFIN;Acc:ZDB-GENE-060531-161])

HSP 1 Score: 99.3673 bits (246), Expect = 5.650e-26
Identity = 53/158 (33.54%), Postives = 90/158 (56.96%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNN-FKDDQSEEIS-DSINEQEVSNLV-------ALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  ++FR+V+VD   +++ F ++Q E       +  EV +L+            + A  + L   P  S N A+K++A  ++ R++ SFKS+ I+  V+ ++   +D+L+KY+YK FE P ENS+ +LL WH+  +     G ++RV+T RK V
Sbjct:    1 MARNTLGSRFRRVEVDGLEESSRFVEEQDEAAELQGPDTAEVDSLLRQYPAAAVCGDMMSAFHVALRNPPINSKNPAIKEKAQAVVLRVLTSFKSSDIEPAVKSIDRNGIDLLMKYIYKGFEKPCENSSAILLQWHEKAFAVGGLGSIVRVMTSRKTV 158          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Sea Lamprey
Match: arpc5la (actin related protein 2/3 complex, subunit 5-like, a [Source:ZFIN;Acc:ZDB-GENE-040426-1453])

HSP 1 Score: 111.309 bits (277), Expect = 3.018e-31
Identity = 58/155 (37.42%), Postives = 90/155 (58.06%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEISDSINEQEVSNLVALSKN------LEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            MA NT  N+FRKVDVD + +N F D + EE ++     E     AL         + ALK  L   P  S +Q++K++A   + +++ +FK+  ++  V  L++  +D+L++YVYK FE P ENS+ +LL WH+ +      GC++RVLT RK V
Sbjct:    1 MAKNTMSNRFRKVDVDEYDENKFVD-EPEEAAEQQGPDEAEVDAALRTRASTGDMIAALKAALKNPPLNSKSQSVKERAEGTVLKVLTAFKAADMERGVRSLDQGSVDLLMQYVYKGFERPSENSSAVLLQWHEKVLAVGGLGCVVRVLTARKMV 154          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Yeast
Match: ARC15 (Subunit of the ARP2/3 complex; ARP2/3 is required for the motility and integrity of cortical actin patches; has mRNA binding activity [Source:SGD;Acc:S000001324])

HSP 1 Score: 52.7582 bits (125), Expect = 2.336e-9
Identity = 36/151 (23.84%), Postives = 74/151 (49.01%), Query Frame = 3
Query:  141 FRKVDVDLFSDNNFK---DDQSEEISDSINEQEVS-------NLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDP-PENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            +R++D+D F   + +    D       ++  QE+        +L     +L A++L L+  P  S++   K+Q +K +   +   +   I N ++ L++++ D+L+KY+YK    P  +    +LL W + I Q S    ++  ++DR+ V
Sbjct:    5 WRRIDIDAFDPESGRLTAADLVPPYETTVTLQELQPRMNQLRSLATSGDSLGAVQL-LTTDPPYSADAPTKEQYFKSVLEALTQVRQADIGNVIKNLSDSQRDVLVKYLYKGMSVPQGQKQGGVLLAWLERITQVSGVTPIVHYISDRRTV 154          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Nematostella
Match: EDO44235 (Actin-related protein 2/3 complex subunit 5 [Source:UniProtKB/TrEMBL;Acc:A7RWB9])

HSP 1 Score: 126.331 bits (316), Expect = 6.389e-37
Identity = 59/150 (39.33%), Postives = 100/150 (66.67%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEIS-DSINEQEVSNLVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ +++  +FRKVD+D   +N F D+Q +E      +E EV++L+   KN EALK VL+  P  S NQA+KD+A++++ +++ + +SN+I N ++ L ++E+DIL+KY+Y+ F  P ENS  +LL WH+ +      G ++R LT+RK +
Sbjct:    1 MSKSSQSTQFRKVDIDELDENRFDDEQVDEGGMTGPDEGEVNSLLMSKKNGEALKAVLANPPVLSKNQAVKDKAFQLVLKVLTTTRSNEIDNALKGLTKSEVDILMKYIYRGFAQPNENSCGILLNWHEKVLAAGGLGSIIRGLTERKSI 150          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Medaka
Match: arpc5b (actin related protein 2/3 complex subunit 5 [Source:NCBI gene;Acc:101173455])

HSP 1 Score: 105.145 bits (261), Expect = 3.697e-28
Identity = 57/154 (37.01%), Postives = 93/154 (60.39%), Query Frame = 3
Query:  114 MAVNTRDNKFRKVDVDLFSDNNFKDDQ-SEEISDSINEQEVSNLVALSKNLE----ALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            M+ NT   +FR+VDVD + +N F D++   E     +E EV +L+    + +    AL+ VL   P  + NQ +KD+A  ++ +++ +FKS+ I+  V+ L++  +D+L+KY+YK FE P ENS+ +LL WH+        G ++RVLT RK V
Sbjct:    1 MSKNTVSARFRRVDVDEYDENKFVDEEDGGENQIGPDEAEVDSLIRQYPSDDMLAYALQAVLKNPPINTKNQNVKDRAEGLVLKVLSAFKSSDIEKGVQSLDKNGVDLLMKYIYKGFERPSENSSAVLLQWHEKALAAGGVGSIVRVLTARKTV 154          
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Planmine SMEST
Match: SMESG000023170.1 (SMESG000023170.1)

HSP 1 Score: 214.927 bits (546), Expect = 6.299e-72
Identity = 103/107 (96.26%), Postives = 105/107 (98.13%), Query Frame = 3
Query:  240 LVALSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 560
            ++  SKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV
Sbjct:    1 MIVSSKNLEALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETELDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV 107          
The following BLAST results are available for this feature:
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARPC5L2.903e-3137.25actin related protein 2/3 complex subunit 5 like [... [more]
ARPC5L2.903e-3137.25actin related protein 2/3 complex subunit 5 like [... [more]
ARPC54.680e-3037.32actin related protein 2/3 complex subunit 5 [Sourc... [more]
ARPC52.832e-2937.24actin related protein 2/3 complex subunit 5 [Sourc... [more]
ARPC54.673e-2536.59actin related protein 2/3 complex subunit 5 [Sourc... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
arx-71.503e-2031.17Actin-related protein 2/3 complex subunit 5 [Sour... [more]
C46H11.36.043e-2032.62Probable actin-related protein 2/3 complex subunit... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Arpc51.897e-3539.74gene:FBgn0031437 transcript:FBtr0335170[more]
Arpc51.897e-3539.74gene:FBgn0031437 transcript:FBtr0077694[more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arpc5lb1.510e-3640.00actin related protein 2/3 complex, subunit 5-like,... [more]
arpc5lb1.510e-3640.00actin related protein 2/3 complex, subunit 5-like,... [more]
arpc5b1.846e-3340.00actin related protein 2/3 complex, subunit 5B [Sou... [more]
arpc5b1.846e-3340.00actin related protein 2/3 complex, subunit 5B [Sou... [more]
arpc5a3.379e-3238.67actin related protein 2/3 complex, subunit 5A [Sou... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
arpc51.079e-3238.00actin related protein 2/3 complex subunit 5 [Sourc... [more]
mknk11.272e-3240.13MAP kinase interacting serine/threonine kinase 1 [... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Arpc5l3.948e-3036.60actin related protein 2/3 complex, subunit 5-like ... [more]
Arpc55.495e-3037.32actin related protein 2/3 complex, subunit 5 [Sour... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q641B9|APC5C_XENLA6.250e-3439.33Actin-related protein 2/3 complex subunit 5-C OS=X... [more]
sp|Q6DE18|APC5B_XENLA5.247e-3340.79Actin-related protein 2/3 complex subunit 5-B OS=X... [more]
sp|Q68FI4|APC5A_XENLA6.715e-3238.00Actin-related protein 2/3 complex subunit 5-A OS=X... [more]
sp|A1L108|ARP5L_RAT2.033e-3137.91Actin-related protein 2/3 complex subunit 5-like p... [more]
sp|Q5R4M1|ARP5L_PONAB1.394e-3037.25Actin-related protein 2/3 complex subunit 5-like p... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HX181.234e-4447.33Actin-related protein 2/3 complex subunit 5 OS=Lin... [more]
A0A1S3HUB26.366e-4346.67Actin-related protein 2/3 complex subunit 5 OS=Lin... [more]
A0A183IXT85.563e-4141.72Actin-related protein 2/3 complex subunit 5 OS=Sob... [more]
A0A0P6EM956.278e-3943.42Actin-related protein 2/3 complex subunit 5 OS=Dap... [more]
A0A4S2KHS18.523e-3945.03Actin-related protein 2/3 complex subunit 5 OS=Opi... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
arpc5b3.813e-3440.00actin related protein 2/3 complex subunit 5 [Sourc... [more]
arpc5la1.182e-3036.00actin-related protein 2/3 complex subunit 5-like p... [more]
arpc5a6.130e-2838.16actin related protein 2/3 complex, subunit 5A [Sou... [more]
arpc5lb5.650e-2633.54actin related protein 2/3 complex, subunit 5-like,... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
arpc5la3.018e-3137.42actin related protein 2/3 complex, subunit 5-like,... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
ARC152.336e-923.84Subunit of the ARP2/3 complex; ARP2/3 is required ... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO442356.389e-3739.33Actin-related protein 2/3 complex subunit 5 [Sour... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
arpc5b3.697e-2837.01actin related protein 2/3 complex subunit 5 [Sourc... [more]
back to top
BLAST of Actin-related protein 2/3 complex subunit 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023170.16.299e-7296.26SMESG000023170.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026316 ID=SMED30026316|Name=Actin-related protein 2/3 complex subunit 5|organism=Schmidtea mediterranea sexual|type=transcript|length=693bp
CTTTTTTGTTTTAAAGATTGATTGGTATTTATAAGATTTCAAATTACAGG
AAAATATTATTCAATAATTAAATTTAATTTGTAAATCTAAATCAATTGTT
CAGTAATTTTTCTATGGCAGTCAATACAAGAGACAATAAATTTCGAAAGG
TTGATGTTGATTTATTCAGTGACAACAATTTTAAAGATGATCAATCGGAA
GAGATTTCTGATTCCATTAATGAACAGGAAGTTTCAAATCTAGTTGCACT
TTCTAAAAATTTAGAAGCTCTGAAATTAGTTCTTTCAAAGGCCCCAACTG
CATCAAGTAATCAAGCCCTGAAGGATCAAGCATATAAAATTATATCTAGA
ATAATCGTTTCATTTAAGTCCAACCAAATTAAAAATACAGTTGAAGAGCT
TAATGAAACAGAATTAGATATTTTATTGAAATACGTTTACAAAGCATTTG
AAGATCCGCCAGAAAATAGCAATGTACTGTTATTGACTTGGCACGATTGC
ATCTACCAAAGAAGCAAATACGGTTGTATGATGAGAGTCTTGACCGATAG
GAAACGAGTTTAAAACGATTTGCAAATAGAAAAACGAATACAAATTATAA
TTTCGTGTGATTTATAAAAATTCTTCATGCTGAAATTCTTCAATATCGAA
ATAAATAAAATTTAATTATTTATTATGTAATTTTAATTCTGGC
back to top

protein sequence of SMED30026316-orf-1

>SMED30026316-orf-1 ID=SMED30026316-orf-1|Name=SMED30026316-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=150bp
MAVNTRDNKFRKVDVDLFSDNNFKDDQSEEISDSINEQEVSNLVALSKNL
EALKLVLSKAPTASSNQALKDQAYKIISRIIVSFKSNQIKNTVEELNETE
LDILLKYVYKAFEDPPENSNVLLLTWHDCIYQRSKYGCMMRVLTDRKRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036743ARPC5_sf
IPR030075ARPC5L
IPR006789ARPC5
Vocabulary: cellular component
TermDefinition
GO:0005885Arp2/3 protein complex
GO:0015629actin cytoskeleton
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0034314Arp2/3 complex-mediated actin nucleation
GO:0030833regulation of actin filament polymerization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036743Actin-related protein 2/3 complex subunit 5 superfamilyGENE3DG3DSA:1.25.40.190coord: 1..149
e-value: 3.6E-42
score: 146.0
IPR036743Actin-related protein 2/3 complex subunit 5 superfamilySUPERFAMILYSSF69103Arp2/3 complex 16 kDa subunit ARPC5coord: 9..149
IPR006789Actin-related protein 2/3 complex subunit 5PFAMPF04699P16-Arccoord: 9..149
e-value: 1.3E-37
score: 129.6
IPR006789Actin-related protein 2/3 complex subunit 5PANTHERPTHR12644ARP2/3 COMPLEX 16 KD SUBUNIT P16-ARCcoord: 1..149
IPR030075Actin-related protein 2/3 complex subunit 5-like proteinPANTHERPTHR12644:SF2ACTIN-RELATED PROTEIN 2/3 COMPLEX SUBUNIT 5-LIKE PROTEINcoord: 1..149