cAMP-dependent protein kinase regulatory subunit

Overview
NamecAMP-dependent protein kinase regulatory subunit
Smed IDSMED30026280
Length (bp)2004
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase regulatory subunit (SMED30026280) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase regulatory subunit (SMED30026280) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026280

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026280SMESG000049490.1 SmedASXL_009396SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026280SMESG000049490.1 dd_Smed_v6_16204_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026280SMESG000049490.1 dd_Smed_v4_16204_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026280SMESG000049490.1 dd_Smed_v4_16204_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30026280SMESG000049490.1 dd_Smed_v4_16204_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30026280SMESG000049490.1 dd_Smed_v4_16204_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|23842707 (tr|V4B879|V4B879_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_238088 PE=4 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 3.083e-47
Identity = 134/445 (30.11%), Postives = 226/445 (50.79%), Query Frame = 2
Query:   80 PWFRIHGKGVLHQAADDVLIDVLRNCVLKSYKRNELIIMQGDFGDKFFXXXXXXXXXXXNDSMEPFLEK--SLTKKSVIIDSDSLT------------LFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPK--LVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYDKKLEIVRXXXXXXXXXXXXSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNFNLR 1366
            PW R     + H   ++VL D++RNC  +    +++I+ QG+ G+  FV++ G V VYV+ SM    E   S   +S   DS + +            +FGK +   + G SFGE AL+ E S R ASVI     D LV+ ++ +N SLK  ++N  +  + FI +HP F+ W+ R K LL +SL++   P+   +V QG   +G+YF+VKG   ++++P +H   +   +P +  V D    EF  L+  +   ++   E  A     P  ++++R     A+E     +   + ++   EIIGD+E   +LK+ + TVV     +   LD+   +R+  R N   + +  + +I  K+  R +      +PL+ +L  KL ++ L   + LP LK  K LP   +++Q+ L  F E +A L  P V G ++ +DLM +   +R
Sbjct:   40 PWLRKRTP-MFHNQQEEVLKDIIRNCEYQMASHDDVILCQGERGECMFVILRGSVSVYVDASMTGEDEGFPSPVPRSASKDSSNASPEIRLGRDLDRRVFGKFIIKMESGTSFGEVALISEDSTRNASVIVDTACDFLVVGKKLFNRSLKAYEENKYESTKNFIKSHPYFNQWSARFKRLLELSLRREIYPFNSTIVKQGGRVRGMYFIVKGEANVSVEPARHRHQYDHLWPFEAGV-DTYSIEFEWLRESRKNAILRRYENPATIPTKPDHVKIRRKEGCGAVERMKQEKLVSMNTVSDGEIIGDIELSMNLKTWMQTVVCTADTEVYFLDMKTYDRLVNRKNLSTVSKMKAHVI-DKLKTRMELIPNGHVPLLSYLHYKLTERSLPSAKKLPPLKATKSLPDTEVQFQYLLARFREGRAPLVLPRVPGAVYYKDLMAEKARIR 481          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|23493997 (tr|A0A210Q0A6|A0A210Q0A6_MIZYE 2-aminoethylphosphonate--pyruvate transaminase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT10559 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 5.493e-45
Identity = 136/449 (30.29%), Postives = 225/449 (50.11%), Query Frame = 2
Query:   80 PWFRIHGKGVLHQAADD-VLIDVLRNCVLKSYKRNELIIMQGDFGDKFFXXXXXXXXX--------XXNDSMEPFLEK--------------SLTKKSVIIDSDSL--TLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFP-----QFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYDKKLEIVRXXXXXXXXXXXXSDSLEWQHQLKMFIENKASLCKPFVKGGIFLR 1336
            PW R   K +L Q  D  +L DV+RNC  +   R++LII QG+ GD F++++ G+  V            S  P ++K              S  ++    +   L  + FGK +   +   SFGE AL+ E S+R A++IA +E DLLVISRE +N S+K  Q+   +E++ FIN  P F +W+P+ K LL MS++K   P+   +V QG+   GL F++ G  K+T++P  H   FP     +  P+  ++    Y +  +    KL  + T+           I+++R   YAA E  V+SR   LC I+S ++IGD+E +  L+ +  TV   E+   + LD  N +R+  + N   +++ L +    K+  R    K + +PL+  L+ KL +K   +          K   S S+  +  ++ F+++KA L +P V   ++ R
Sbjct:   29 PWLR--KKSLLLQDLDKAILTDVMRNCAYQKANRDDLIITQGELGDSFYIMLTGKTSVYITPIKVDDEQQSATPDMQKKGKDDEKTDDNDDSSQEEEENTDEKKPLDRSKFGKFIMHYEGSNSFGEVALMSEDSVRNATIIADEETDLLVISRELFNRSVKAKQEKEYEEKKDFINESPFFHNWSPKFKRLLEMSIRKEHYPFGSTIVRQGDSACGLVFLLSGQAKVTVNPSHHNGQFPLLTKQEINPIAKEIGRNSYNKIVK----KLDRNFTQ---------HHIQIRRKEGYAAAEKRVMSRTVELCCIESNDVIGDIEMVMELERSTCTVNCTENTTVMVLDTKNYDRLIAKKNIHTIRK-LCKTALQKVMCRASSGKGSQVPLLDILQKKLQEK---LPSKDENNCKAKIDRSKSVAMEQLIQFFLKDKAPLIEPCVPNSLYYR 458          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|23916562 (tr|K1RD11|K1RD11_CRAGI Uncharacterized protein OS=Crassostrea gigas OX=29159 GN=CGI_10008774 PE=4 SV=1)

HSP 1 Score: 178.333 bits (451), Expect = 3.677e-43
Identity = 114/373 (30.56%), Postives = 203/373 (54.42%), Query Frame = 2
Query:  278 LEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLD--FDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERL---KENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYDKKLEIVRXXXXXXXXXXXXSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNFNLRSKSIP 1381
            + K   KK  ++D    + FGK + S   G SFGE AL+  +S R AS+IA ++ DLLVI ++ ++ SLK   +    E   FI++HP FS    ++K LL MSL++ +  +   ++ QG   +GL+F++KG   + ++P KH+  +P  +P +   D+Y   ++   E +  + ++   E  AV     + + ++R   YAA+E Y+  R   LCSIQ +E++GD+E + +L + ++TV    + +   LD  N +RI  + NT  L   +E +   ++++MN ++ +     +P + FL  K+ ++ L   +PLP LK  K LP      Q  L+ F + K+++ +P+  G +F ++LM +    R  + P
Sbjct:  161 MRKPAPKKLAVLDR---SKFGKFIVSYGPGKSFGEVALVKRESFRNASIIADEDLDLLVIGQDLFDRSLKLDTEKEFAEISDFIDSHPFFSHMPTKLKKLLEMSLRRETFIFDTVLIKQGEPVQGLHFILKGQANVIVEPHKHQKQYPHLWPFEAGIDIYAVEFEHLREAR-RQAILRKYEDPAVWETKSEELVIRRTEGYAAVEKYMKERHVDLCSIQDREVLGDIEILNNLSTYMHTVKCTANTEVFILDTKNYDRIVGKKNTATLDIMREYVKAKLETRMNMKQGHL----VPFLQFLHFKMTEESLPQSKPLPPLKMSKTLPDRDTMLQQLLQWFKDGKSTIVEPYTAGAVFYKELMKEKAAARKDNPP 525          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|20319582 (tr|A0A1S3H798|A0A1S3H798_LINUN uncharacterized protein LOC106152061 OS=Lingula unguis OX=7574 GN=LOC106152061 PE=4 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 2.697e-42
Identity = 112/354 (31.64%), Postives = 181/354 (51.13%), Query Frame = 2
Query:  329 TLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLD--FDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYD------KKLEIVRXXXXXXXXXXXXSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNFNLR 1366
            +L+G  + S   G SFGE AL+ E +IR AS+I  +E D LVI R+ YN  LK   +   KE+  F+ NHP F  W P+M++LL MS++K S  +   +V QG    GL+F++ G  K  ++P KH+  +P   P     DVY   +   P+ K  +L     +     T+  + +R++R   YAA E  +  +   LC ++ +EIIGD+E   +L +   TV+   +  A  LDL   ER+  + N   + E L+   ++K+  R    + + +PL+  L  KL+       KK   +R   +L  ++ L    L+W      F+ ++A L +P V G +F +D+M +    R
Sbjct:  223 SLYGNYIVSFGSGKSFGEIALISEDNIRNASIITDEETDFLVIHRDLYNRCLKAAAELEFKEKNDFVENHPFFCTWTPKMQSLLKMSIRKESYSFDTPIVRQGEPVVGLHFMLNGQAKFVVEPGKHKGQYPDRHPFQDSADVYSGDW--MPKRK--RLDSSNNDDPNKSTVKQESVRVRRRDGYAAAEKKLHGKSMDLCFVRDREIIGDIEIAMNLDTYFATVICTTNTQAFLLDLKTYERLIIKKNKPTI-ETLTLHAETKLMSRVTSLQGSQVPLLRHLAFKLHHQEETQPKKTTPLRNSKELPDKEVLIHKLLQW------FVRDRAPLIEPMVPGAVFYKDIMEEKAKRR 565          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Match: gnl|BL_ORD_ID|20346027 (tr|A0A1S3K8T1|A0A1S3K8T1_LINUN uncharacterized protein LOC106179668 OS=Lingula unguis OX=7574 GN=LOC106179668 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 3.307e-42
Identity = 112/354 (31.64%), Postives = 181/354 (51.13%), Query Frame = 2
Query:  329 TLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLD--FDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLY------DKKLEIVRXXXXXXXXXXXXSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNFNLR 1366
            +L+G  + S   G SFGE AL+ E +IR AS+I  +E D LVI R+ YN  LK   +   KE+  F+ NHP F  W P+M++LL MS++K S  +   +V QG    GL+F++ G  K  ++P KH+  +P   P     DVY   +   P+ K  +L     +     T+  + +R++R   YAA E  +  +   LC ++ +EIIGD+E   +L +   TV+   +  A  LDL   ER+  + N   + E L+   ++K+  R    + + +PL+  L  KL+       KK   +R   +L  ++ L    L+W      F+ ++A L +P V G +F +D+M +    R
Sbjct:  213 SLYGNYIVSFGSGKSFGEIALISEDNIRNASIITDEETDFLVIHRDLYNRCLKAAAELEFKEKNDFVENHPFFCTWTPKMQSLLKMSIRKESYSFDTPIVRQGEPVVGLHFMLNGQAKFVVEPGKHKGQYPDRHPFQDSADVYSGDW--MPKRK--RLDSSNNDDPNKSTVKQESVRVRRRDGYAAAEKKLHGKSMDLCFVRDREIIGDIEIAMNLDTYFATVICTTNTQAFLLDLKTYERLIIKKNKPTI-ETLTLHAETKLMSRVTSLQGSQVPLLRHLAFKLHHQEETQPKKTTPLRNSKELPDKEVLIHKLLQW------FVRDRAPLIEPMVPGAVFYKDIMEEKAKRR 555          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Nematostella
Match: EDO49032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHT2])

HSP 1 Score: 56.9954 bits (136), Expect = 1.325e-9
Identity = 42/134 (31.34%), Postives = 72/134 (53.73%), Query Frame = 2
Query:   83 WFRIHGKGVLHQAADDVLIDVLRNCVLKSYKRNELIIMQGDFGDKFFXXXXXXXXXXXNDSMEPFLEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESL 484
            WFR     +     DD L+D+++N  L  Y+++ +I+ QG+ G+ F++++ G V VY     +     +  ++SV    + L LFG  ++S   G SFGE  ++DE+  R  +VIA +   L+ I  + Y  SL
Sbjct:   35 WFR-QRSPLFKLLEDDALLDIIKNVTLTRYRKDNIIMRQGEKGNCFYIILKGSVSVYAKQDGDGE-AATHHEQSVRSHKERLLLFGAELSSLRAGRSFGEMVMVDERKERNTTVIADEATMLISIDEKLYERSL 166          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000049490.1 (SMESG000049490.1)

HSP 1 Score: 1104.35 bits (2855), Expect = 0.000e+0
Identity = 571/592 (96.45%), Postives = 579/592 (97.80%), Query Frame = 2
Query:  170 YKRNELIIMQGDFGDKFFXXXXXXXXXXXNDSMEPFLEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYDKKLEIVRXXXXXXXXXXXXSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNFNLRSKSIPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQLLEMLYSEIYSRGPHKSTSNKNTLPDNNYKEKSHSIFFENNETLVSKPNSESMSINQDSFLENNSKQRKNFVTSAEYFALLQKSQIEFLNSLCSEKSCYEIKMENLTKTNEKNSKVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE 1945
            + + +L+ M     ++FFVVVYGEVHVYVNDSMEPFLEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKM+HREKYFKETPIPLMLFLKIKLYDKKLEIVRPLPKLKTEKKLPSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKN NLRSK IPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQLLEMLY+EIYSRGPHKSTSNKNTLPDNN KEKSHSIFFENNETLVSKPNSESMSINQDSFLENNSKQRKNFVTS EYFALLQKSQIEFLNSLCSEKSCYEIKMENLTKTNEKN KVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE
Sbjct:   15 FDKADLVNMVHGVPNQFFVVVYGEVHVYVNDSMEPFLEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMDHREKYFKETPIPLMLFLKIKLYDKKLEIVRPLPKLKTEKKLPSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNVNLRSKHIPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQLLEMLYNEIYSRGPHKSTSNKNTLPDNNNKEKSHSIFFENNETLVSKPNSESMSINQDSFLENNSKQRKNFVTSTEYFALLQKSQIEFLNSLCSEKSCYEIKMENLTKTNEKNIKVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE 606          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000049490.1 (SMESG000049490.1)

HSP 1 Score: 1094.34 bits (2829), Expect = 0.000e+0
Identity = 553/560 (98.75%), Postives = 555/560 (99.11%), Query Frame = 2
Query:  266 MEPFLEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYDKKLEIVRXXXXXXXXXXXXSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNFNLRSKSIPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQLLEMLYSEIYSRGPHKSTSNKNTLPDNNYKEKSHSIFFENNETLVSKPNSESMSINQDSFLENNSKQRKNFVTSAEYFALLQKSQIEFLNSLCSEKSCYEIKMENLTKTNEKNSKVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE 1945
            MEPFLEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKM+HREKYFKETPIPLMLFLKIKLYDKKLEIVRPLPKLKTEKKLPSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKN NLRSK IPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQLLEMLY+EIYSRGPHKSTSNKNTLPDNN KEKSHSIFFENNETLVSKPNSESMSINQDSFLENNSKQRKNFVTS EYFALLQKSQIEFLNSLCSEKSCYEIKMENLTKTNEKN KVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE
Sbjct:    1 MEPFLEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMDHREKYFKETPIPLMLFLKIKLYDKKLEIVRPLPKLKTEKKLPSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNVNLRSKHIPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQLLEMLYNEIYSRGPHKSTSNKNTLPDNNNKEKSHSIFFENNETLVSKPNSESMSINQDSFLENNSKQRKNFVTSTEYFALLQKSQIEFLNSLCSEKSCYEIKMENLTKTNEKNIKVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE 560          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000049490.1 (SMESG000049490.1)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 426/460 (92.61%), Postives = 436/460 (94.78%), Query Frame = 2
Query:  566 MKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYDKKLEIVRXXXXXXXXXXXXSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNFNLRSKSIPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQLLEMLYSEIYSRGPHKSTSNKNTLPDNNYKEKSHSIFFENNETLVSKPNSESMSINQDSFLENNSKQRKNFVTSAEYFALLQKSQIEFLNSLCSEKSCYEIKMENLTKTNEKNSKVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE 1945
            ++N +L S K+  +     ++ QG+      F  KGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKM+HREKYFKETPIPLMLFLKIKLYDKKLEIVRPLPKLKTEKKLPSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKN NLRSK IPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQLLEMLY+EIYSRGPHKSTSNKNTLPDNN KEKSHSIFFENNETLVSKPNSESMSINQDSFLENNSKQRKNFVTS EYFALLQKSQIEFLNSLCSEKSCYEIKMENLTKTNEKN KVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE
Sbjct:   49 LRNCVLKSYKRNEL-----IIMQGD------FGDKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMDHREKYFKETPIPLMLFLKIKLYDKKLEIVRPLPKLKTEKKLPSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNKNVNLRSKHIPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQLLEMLYNEIYSRGPHKSTSNKNTLPDNNNKEKSHSIFFENNETLVSKPNSESMSINQDSFLENNSKQRKNFVTSTEYFALLQKSQIEFLNSLCSEKSCYEIKMENLTKTNEKNIKVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE 497          

HSP 2 Score: 125.176 bits (313), Expect = 3.753e-30
Identity = 71/72 (98.61%), Postives = 71/72 (98.61%), Query Frame = 2
Query:    2 MKSAMLAYIGSKXXXXXXXXXXXXXXPWFRIHGKGVLHQAADDVLIDVLRNCVLKSYKRNELIIMQGDFGDK 217
            MKSAMLAYIGSKSP ERSVSELELLLPWFRIHGKGVLHQAADDVLIDVLRNCVLKSYKRNELIIMQGDFGDK
Sbjct:    1 MKSAMLAYIGSKSPGERSVSELELLLPWFRIHGKGVLHQAADDVLIDVLRNCVLKSYKRNELIIMQGDFGDK 72          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 148.673 bits (374), Expect = 2.027e-37
Identity = 107/384 (27.86%), Postives = 186/384 (48.44%), Query Frame = 2
Query:   80 PWFRIHGKGVLHQAADDVLIDVLRNCVLKSYKRNELIIMQGDFGDKFFXXXXXXXXXXXNDSMEP--------------FLEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYDKK 1189
            PW R     +     ++VL +++++C     +R+++II QGD GD F+V++ G V +++N    P              F ++ + KK +       + +G  +A  D G +FGE AL++   +R AS+IA +   LLV++RE YN S+K +Q     ER +F+ N  LF++W  + K  +  SL+K    +  N++TQG    GL F++ G  K+ ++ ++H + +P    L+  + ++      EL+    V DL ++   ET  P    L +   Y   E     R   +C ++  EIIGD+E    L +   +V+ IE  +   LD  N ER+       +    L +    K+ HR    +  PIP  + L   + D++
Sbjct:   23 PWLRKKA-ALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKEL-----DRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPW---LNATINNE------ELRLSD-VNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRLEFRPIPFYIRLNEMIADEE 390          
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Match: SMESG000078515.1 (SMESG000078515.1)

HSP 1 Score: 148.288 bits (373), Expect = 2.365e-37
Identity = 107/384 (27.86%), Postives = 186/384 (48.44%), Query Frame = 2
Query:   80 PWFRIHGKGVLHQAADDVLIDVLRNCVLKSYKRNELIIMQGDFGDKFFXXXXXXXXXXXNDSMEP--------------FLEKSLTKKSVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLLVISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKVSVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVYDKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVSRKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERISKRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYDKK 1189
            PW R     +     ++VL +++++C     +R+++II QGD GD F+V++ G V +++N    P              F ++ + KK +       + +G  +A  D G +FGE AL++   +R AS+IA +   LLV++RE YN S+K +Q     ER +F+ N  LF++W  + K  +  SL+K    +  N++TQG    GL F++ G  K+ ++ ++H + +P    L+  + ++      EL+    V DL ++   ET  P    L +   Y   E     R   +C ++  EIIGD+E    L +   +V+ IE  +   LD  N ER+       +    L +    K+ HR    +  PIP  + L   + D++
Sbjct:   26 PWLRKKA-ALFDSLKEEVLNEIIKSCSFSERRRDDIIIRQGDKGDCFYVMLAGRVSIFINTEAVPDNPEDANVVVTEDKFKDEGMAKKEL-----DRSRYGNFIAILDSGKAFGELALINTDCVRNASIIADELTHLLVVNRELYNRSIKEIQTQEFNERLSFVQNSALFTNWLSKYKRQVAFSLRKEKFGFNMNLITQGEPTNGLTFILNGHAKVVVNANQHVSQYPW---LNATINNE------ELRLSD-VNDLDKSVDFETKKPLHNSLSKRLPYIEAEQRQAQRNIEVCIVKGGEIIGDIEQGLELTTYASSVITIEATEVYILDAKNFERLCNPKKNPKTLNLLKKKAIYKIKHRGNRLEFRPIPFYIRLNEMIADEE 393          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|238427073.083e-4730.11tr|V4B879|V4B879_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|234939975.493e-4530.29tr|A0A210Q0A6|A0A210Q0A6_MIZYE 2-aminoethylphospho... [more]
gnl|BL_ORD_ID|239165623.677e-4330.56tr|K1RD11|K1RD11_CRAGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|203195822.697e-4231.64tr|A0A1S3H798|A0A1S3H798_LINUN uncharacterized pro... [more]
gnl|BL_ORD_ID|203460273.307e-4231.64tr|A0A1S3K8T1|A0A1S3K8T1_LINUN uncharacterized pro... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO490321.325e-931.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cAMP-dependent protein kinase regulatory subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049490.10.000e+096.45SMESG000049490.1[more]
SMESG000049490.10.000e+098.75SMESG000049490.1[more]
SMESG000049490.13.753e-3092.61SMESG000049490.1[more]
SMESG000078515.12.027e-3727.86SMESG000078515.1[more]
SMESG000078515.12.365e-3727.86SMESG000078515.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026280 ID=SMED30026280|Name=cAMP-dependent protein kinase regulatory subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=2004bp
AATGAAGTCTGCGATGCTTGCTTATATCGGTTCCAAATCACCGAGTGAAC
GGTCTGTTTCTGAATTGGAGTTGCTCCTCCCTTGGTTCCGAATCCATGGC
AAAGGGGTTTTGCACCAAGCTGCTGACGATGTCCTGATTGACGTCTTGAG
GAATTGCGTACTGAAATCGTACAAACGGAACGAGTTAATTATTATGCAAG
GAGATTTCGGTGACAAGTTCTTCGTTGTTGTGTATGGCGAAGTTCACGTT
TATGTCAACGATTCAATGGAACCATTTTTAGAGAAATCTTTAACCAAAAA
GTCTGTAATTATTGATAGCGATTCATTAACCTTGTTTGGAAAATGTGTCG
CCAGTGAAGATGAAGGTTATTCGTTCGGCGAATACGCTTTACTTGATGAA
AAAAGTATTAGAAAAGCATCAGTAATTGCAGCCAAGGAAGCCGATCTTTT
AGTTATTAGTCGAGAGACCTATAATGAGAGCTTGAAGAATCTCCAACAGA
ATATAATTAAAGAAAGAGAAACTTTTATAAATAATCATCCCCTGTTTTCT
GACTGGAATCCTCGAATGAAGAATTTACTATTAATGAGCCTAAAGAAAGT
ATCGGTTCCGTATCAGTTCAATATGGTTACGCAAGGAAATGAATGGAAAG
GACTTTATTTCGTCGTCAAAGGATCCGGTAAAATAACAATTGATCCAGAC
AAACACGAAACATCTTTTCCTCAATTTTTCCCCCTTGATTTCGATGTATA
CGATAAAAGGTATCAAGAGTTTCCAGAACTGAAACCTCCAAAATTAGTTG
TTGACTTAACAGAAGCGGAAGCTGTTGAAACATTAATGCCCAAACGAATT
CGGTTGAAACGCGCCGGTAATTACGCAGCCTTAGAAAGCTACGTGGTTAG
CAGAAAGAACTACCTTTGCTCTATTCAGTCAAAGGAAATAATCGGAGATT
TGGAATTTATTTTCAGCCTCAAGTCAAACCTCTACACGGTTGTTGCAATA
GAACATATCGACGCTTTACATTTGGATCTCGCAAATTTAGAGAGGATTTC
TAAACGTTTGAACACGGAGAGATTGAAGGAAAATCTATCTCAAATTATTA
AATCGAAAATGAATCACCGGGAGAAATACTTCAAAGAAACTCCTATTCCG
TTGATGTTGTTTTTAAAAATAAAACTTTACGATAAAAAACTTGAAATCGT
TCGACCATTGCCTAAGTTGAAAACAGAAAAGAAATTACCGTCCGACTCTC
TCGAATGGCAACATCAACTAAAAATGTTCATAGAAAATAAAGCTTCTCTA
TGCAAACCGTTTGTGAAAGGAGGAATATTTTTGCGAGATTTGATGAATAA
AAATTTCAATCTTCGATCTAAATCCATTCCGAAAAAGTTCGAAGAAATAG
CGGTAAAATCATCGAATGATACTTTCTCTACCATTTACTTCCCGGTGTCT
CATGACAGGGTTTCCGAATTGCAAAAAATCGCCTCTAGTCCCATGCAGTT
GTTGGAAATGTTGTACAGTGAAATTTATAGCCGAGGACCTCACAAATCCA
CAAGCAACAAAAATACATTGCCGGATAATAATTATAAGGAAAAATCCCAT
TCAATTTTTTTCGAAAATAATGAGACTTTAGTTTCTAAGCCGAATAGTGA
GTCCATGAGCATCAATCAAGACAGTTTTTTGGAAAACAATTCTAAACAGA
GGAAAAATTTCGTGACAAGTGCCGAATATTTTGCTCTTCTTCAAAAATCA
CAAATAGAATTCCTTAATTCTCTTTGCTCGGAAAAGAGTTGCTATGAAAT
TAAAATGGAGAATTTAACAAAAACAAACGAAAAAAATAGCAAAGTTCATT
TTCTTCCAAGCCTTCAGCCTATAAATCATAATCGGGATTACCCAATTCCA
AATAAAAGTCTCCAAGTGTTTATGAAGAAATATCAAAGGGAAGAATGAAA
CCAGCCAATCGAAATATTTAAAAAATTACGAAGACGCAAACAAATACAAT
TGTG
back to top

protein sequence of SMED30026280-orf-1

>SMED30026280-orf-1 ID=SMED30026280-orf-1|Name=SMED30026280-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=649bp
MKSAMLAYIGSKSPSERSVSELELLLPWFRIHGKGVLHQAADDVLIDVLR
NCVLKSYKRNELIIMQGDFGDKFFVVVYGEVHVYVNDSMEPFLEKSLTKK
SVIIDSDSLTLFGKCVASEDEGYSFGEYALLDEKSIRKASVIAAKEADLL
VISRETYNESLKNLQQNIIKERETFINNHPLFSDWNPRMKNLLLMSLKKV
SVPYQFNMVTQGNEWKGLYFVVKGSGKITIDPDKHETSFPQFFPLDFDVY
DKRYQEFPELKPPKLVVDLTEAEAVETLMPKRIRLKRAGNYAALESYVVS
RKNYLCSIQSKEIIGDLEFIFSLKSNLYTVVAIEHIDALHLDLANLERIS
KRLNTERLKENLSQIIKSKMNHREKYFKETPIPLMLFLKIKLYDKKLEIV
RPLPKLKTEKKLPSDSLEWQHQLKMFIENKASLCKPFVKGGIFLRDLMNK
NFNLRSKSIPKKFEEIAVKSSNDTFSTIYFPVSHDRVSELQKIASSPMQL
LEMLYSEIYSRGPHKSTSNKNTLPDNNYKEKSHSIFFENNETLVSKPNSE
SMSINQDSFLENNSKQRKNFVTSAEYFALLQKSQIEFLNSLCSEKSCYEI
KMENLTKTNEKNSKVHFLPSLQPINHNRDYPIPNKSLQVFMKKYQREE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR014710RmlC-like_jellyroll
IPR000595cNMP-bd_dom
IPR018488cNMP-bd_CS
IPR018490cNMP-bd-like
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 154..174
NoneNo IPR availableCOILSCoilCoilcoord: 336..356
NoneNo IPR availablePRINTSPR00103CAMPKINASEcoord: 136..147
score: 34.17
coord: 57..71
score: 45.33
coord: 72..86
score: 45.11
coord: 123..132
score: 58.33
NoneNo IPR availablePANTHERPTHR11635:SF152CAMP-DEPENDENT PROTEIN KINASE TYPE I REGULATORY SUBUNITcoord: 41..599
NoneNo IPR availablePANTHERPTHR11635CAMP-DEPENDENT PROTEIN KINASE REGULATORY CHAINcoord: 41..599
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 55..159
e-value: 1.9E-10
score: 40.6
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 36..178
score: 21.137
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 181..236
score: 7.188
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 36..166
e-value: 1.06324E-10
score: 57.3358
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 8..166
e-value: 1.1E-22
score: 82.1
IPR018488Cyclic nucleotide-binding, conserved sitePROSITEPS00888CNMP_BINDING_1coord: 63..79
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 37..163
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 168..352