Si:ch211-194c3.5

Overview
NameSi:ch211-194c3.5
Smed IDSMED30026263
Length (bp)3749
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch211-194c3.5 (SMED30026263) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch211-194c3.5 (SMED30026263) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch211-194c3.5 (SMED30026263) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch211-194c3.5 (SMED30026263) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026263

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026263SMESG000044256.1 SmedASXL_017613SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30026263SMESG000044256.1 dd_Smed_v4_10121_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026263SMESG000044256.1 dd_Smed_v6_10121_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026263SMESG000044256.1 dd_Smed_v4_10121_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30026263SMESG000044256.1 dd_Smed_v4_10121_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026263SMESG000044256.1 dd_Smed_v4_10121_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30026263SMESG000044256.1 dd_Smed_v4_10121_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch211-194c3.5 vs. Ensembl Human
Match: C20orf194 (chromosome 20 open reading frame 194 [Source:HGNC Symbol;Acc:HGNC:17721])

HSP 1 Score: 270.011 bits (689), Expect = 1.028e-73
Identity = 301/1236 (24.35%), Postives = 535/1236 (43.28%), Query Frame = 3
Query:  150 SSFLSCQRLHKIQRLI---NYKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTN-TRQSVLMTRLGKSSDSEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVA--KPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSLNKMRY--------SDCSFRIITIG--------DTNNSQGFLMIIQSVVFDIVNEDRGEN-LGSVIFADTFVVTSTPVNKEDNL----TSVLRLGKKVPLFSYW-TNNNLSKLHQTINEIYE-----LEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGAIILYPD---SVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYSLIHRKSCVRVFAQLMVMNYSLRYYD-NVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPG----------------SGQEFLTRKIM---KIIH-DDFDWLLVTPISIQDVTCATENILKDFENINENKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKT--TTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPL-----PNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKE-SFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAF 3632
            S  +SC RL ++Q ++   +  + DG+L I+GID R+N G  EL NYL F +++  T D +++   +++ DDV++ I  D VH+YCN  N+  LLPY+A W  L  HC++E E ED E  E+FKI +F +M R C +I +   ++G +   + FD  VVE WPI+Q++A +  G         GFFT+ +++ D+S ++  ++ ++DP+ LE++    L   E    + F   D++     LE+ E    EP +SYF+H   +  +        P  L G + TR+++       +  SEG L        S  KHM+ QCVS    +  +RT F  G ++V       ++      +  LS  Y A++      I+    + ++   +  A+  L   L+            S  +F I  +         D+ +S  F+      V+DI +   G   LGSV+F+++F+ +   V ++D      TS + L   VP F  W   +N  KL +   +        L    T      L   + Q +  ++    FF   +L  + +  +II+  D   S+   +G+S    T+ ++      S   +   + +   + L +     SK+ ++  S V   WK+             N  I+ K IQ   ++ +      S+Q +   +S+   +                R S   + A+L  +++ L+++  +    E +  +H  +    QQ  +           N  +++    E   ++++++ GLPG                 G+  + R+IM   +  H   F   L + +  Q    A ++           K  R+L++    +   ++V+ L+       +    IG IT C+ P + Y+++R +  P  LD C++G V+ ++ T   +         L  ++RA N      L     VT+  +++ ILS+ +F       +R L     ++   G  N   +     +I      PL K   +   + +  ++  +PF  NIY I G +    D +R   +   +L   L I P+     P  +++     +S  Q  Y+ +++                LKE S    LR   +Q P +K   T   +T Q++  IH +RHLE LP G+FYNG  +V+  G ++D HP +  F+ D++   N EIE  N  L+     D F
Sbjct:   24 SPSVSCSRLRQVQSILTQSSKSRPDGILCILGIDSRYNEGCRELANYLLFGLYNQNTSDFEKTGFSEEVLDDVIILIKSDSVHLYCNPVNFRYLLPYVAHWRNLHFHCMTENEYEDEEAAEEFKITSFVDMVRDCSRIGIPYSSQGHL---QIFDMFVVEKWPIVQAFALEGIGG-------DGFFTMKYELQDVSLNLWNVYSKMDPMSLESLLSDDLVAFEHQWTSFFANFDTE-IPFLLELSESQAGEPFRSYFSHGMISSHITENSPNRQPFVLFGNHSTRENLNAGNF--NFPSEGHLVRSTGPGGSFAKHMVAQCVSPKGPLACSRTYFF-GATHVPYLGGDSKLPKKTEQIRLLSQIYAAVIEAVLAGIACYAKTSSLTKAKEVAEQTLGSGLDSFELIPFKAALRSKMTFHIHAVNNQGRIVPLDSEDSLSFVKTACMAVYDIPDLLGGNGCLGSVVFSESFLTSQILVKEKDGTVTTETSSVVLTAAVPRFCSWLVEDNEVKLSEKTQQAVRGDESFLGTYLTGGEGAYLYSSNLQ-SWPEEGNVHFFSSGLLFSHCRHRSIIISKDHMNSISFYDGDSTS--TVAALLIDFKSSLLPHLPVHFHGSSNFLMIALFPKSKIYQAFYSEVFSLWKQ-----------QDNSGISLKVIQEDGLSVEQKRLHSSAQKLFSALSQPAGEK---------------RSSLKLLSAKLPELDWFLQHFAISSISQEPVMRTHLPVL--LQQAEI-----------NTTHRI----ESDKVIISIVTGLPGCHASELCAFLVTLHKECGRWMVYRQIMDSSECFHAAHFQRYLSSALEAQQNRSARQSAYI-------RKKTRLLVVLQGYTDVIDVVQALQTHPDSNVKASFTIGAITACVEPMSCYMEHR-FLFPKCLDQCSQGLVSNVVFTSHTTEQRHPLLVQLQSLIRAANPAAAFILAENGIVTRNEDIELILSENSFSSPEMLRSRYLMYPGWYE---GKLNAGSVYPLMVQICVWFGRPLEKTRFVAKCKAIQSSIKPSPFSGNIYHILGKVKF-SDSERTMEVCYNTLANSLSIMPVLEGPTPPPDSKSVSQDSSGQQECYL-VFIGC-------------SLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQEYHDLF 1173          
BLAST of Si:ch211-194c3.5 vs. Ensembl Zebrafish
Match: si:ch211-194c3.5 (si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-63])

HSP 1 Score: 264.233 bits (674), Expect = 4.918e-72
Identity = 287/1221 (23.51%), Postives = 547/1221 (44.80%), Query Frame = 3
Query:  135 KQHLFSSFLSCQRLHKIQRLIN---YKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLD--DDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDLRDKFVSN--PKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVST--ADFVISKLKSSKNIVLDEVEAKNQL---KYSLNKMRYSDCSFRIITIGDTNNSQG----------FLMIIQS-VVFDIVNEDRGENLGSVIFADTFVVTSTPVNKEDNLTS----VLRLGKKVPLFSYWTNNNLS-KLHQTINEIYELEPLATEMADIILTDRHFQ-----ETTVQQLCCTFFPDRVLLFNKKVGAIIL---YPDSVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYSLIHRKSCVRVFAQLMVMNYSLRYYDNVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDF-------ENINENKNLRILLIAPPLSFPSEIVRRLKA-----VASRIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKTTTLH--RILRARNELCTIYLTPKADV---TKELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAF 3632
            K  + ++ +SC RL ++Q L+        DG+L  +GID R+N G  EL +YLF  +++    D+++   D  +++ DDV++ I  + VH+YCN  NY  LLPY++ W  L+LHCL+E E ED E+ E+FKI +F  M + C  I +   + G +++   FD  ++E WPIIQ++A +  G          FFT+ +K+ D+S  +  ++  +DPV L+ +  + L   E     +F  ++ +S     E+ E    EP ++Y++H   +  +  +     P  L G+++ +  L +           +R+   S    KHM++QCV+    +  ART F          +        D+  LS  Y+A + +  A      + SS +   D  +   QL    + L + + +  S  + +I   NN             FL+   S +V+DI +   G NLGSV+F+++F+ +S  + + D   S       L   +P +  W  +    ++ +    + + E        I + D  +       +T ++    FF + +L  +   G+I L   + +S+++ +G S  D ++  I  Q S      +  + ++    + L+    +K  KS  S V+P W+++        +                +N+QLS  EH S              +L+K+H +      HR      + QL   +  L+++               I  S  +  +C   +  T F +   + +    +  +V+T+I GLPGS +E L   +M++  +   W +  P +++     + + L+ F       +   +  + R++L+ P  +   ++++ + A     V S+  + +G ++ C+NP  +++ +R    P LL+ C++G V+ ++ TG           H  +++RA N L T +++ +      T++L  IL+  +F Q     AR L      +  F V     +S   + + +    PL +   ++  + +  +L  +PF  NIY I G +   ++ +++  +   S++  + + P     ++G +     T + Y+  +              +   +E     LR+  +Q  +KK K     +T +++  IH +RHL+ LP G+FYNG  +V   G + + HP +  FI +++   N EIE  N  +DL    D F
Sbjct:   17 KSSIMTAAVSCSRLRQVQALLRDDVNTAPDGILCSLGIDSRYNEGCSELASYLFCGLYNHNHFDMEQIPEDFPEEVLDDVIILIKAECVHLYCNPVNYGYLLPYVSHWRNLQLHCLTETEYEDEEVAEEFKISSFVSMVQDCHCIGIPYSSHGHVQK---FDMFMLEKWPIIQAFALEGIGA-------GLFFTMKYKLKDVSQRLWQVYSRLDPVSLDCLLNEDLQLFERQWSCLFSSMEIESALSMQELSEAQVAEPFRTYYSHGLISSNITDKSKSRQPFVLFGSHSTKEDLESYCFTFPSEGHQVRNTGPSGGVAKHMLLQCVAPKGPLACARTYFFGNTHVPYLGNNNTQQRRTDLQVLSHIYSAAIQSVLAGIKCFSINSSASKAKDVADQTFQLALESFGLIQYKGALRSKAVFSIQAVNNKGSIVPLSDEDSHFLVKTASMMVYDIPDLQCGGNLGSVVFSESFLESSVYIQQRDGALSSDSCFTVLTSSIPRYVSWLVDEAEVRMSEQAQHLLKAEDSTCLGIPITVRDSAYMFSNSLLSTPEEGKLVFFSEGILFVHPHHGSITLSMSHINSIKLYDGASLSDISMLFIEYQTSLLPHLPFPLHSSDFSLAVALL--PRTKSYKSFYSQVLPAWRKSESGLRVQHV----------------LNDQLS-PEHKSMYF-----------RLLKLHETHAVPANHRVVLRTAYPQLPEQDRFLQHF--------------AISSSVDEESVCSDHLS-TVFSDTIPESTKPEPKKKVVLTIIAGLPGSHKENLCDFLMEVNQNSSRWEVFCP-ALEGSGEFSASHLQRFLSSLLAKQRETDMNSFRVVLLIPGYTDIMDVIQAITAHPDPQVHSQ--VTVGAVSACVNPLTSFIKHR-LLFPKLLEQCSQGIVSNVVFTGLTMEQKHPLLQHMQQLIRAAN-LSTAFISAEKGAVRRTEDLRLILNDSSFSQPHMVNARYLLYPGWWEGRF-VSGSGSLSMSQHRVEFS--RPLERALFLQRCKALKSSLKPSPFTGNIYHISGKVLFSDNDRQMV-VNCNSISGNVTVAP-----DQGTHHGLWTTNNCYLMFH-------------GVGLTQEGLKDWLRHCAKQKIVKKVKKNQRTLTTEEIKYIHLKRHLDPLPPGYFYNGHHFVSFFGEKQNFHPLMDRFIDEYVQDANKEIERFNREVDLQPHADLF 1155          
BLAST of Si:ch211-194c3.5 vs. Ensembl Zebrafish
Match: si:ch211-194c3.5 (si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-63])

HSP 1 Score: 119.398 bits (298), Expect = 1.846e-28
Identity = 100/335 (29.85%), Postives = 165/335 (49.25%), Query Frame = 3
Query:  165 CQRLHKIQRLIN---YKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLD--DDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMEN----IFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDLRDKFVSN--PKHMIIQCVSLHTGIVIARTIFL 1130
            C RL ++Q L+        DG+L  +GID R+N G  EL +YLF  +++    D+++   D  +++ DDV++ I  + VH+YCN  NY  LLPY++ W  L+LHCL+E E ED E+ E+FKI +F  M + C  I +   + G +++   FD  ++E WPIIQ++A +  G          FFT+ +KV                  + N    +L Q   L E     +F  ++ +S     E+ E    EP ++Y++H   +  +  +     P  L G+++ +  L +           +R+   S    KHM++QCV+    +  ART F 
Sbjct:    8 CSRLQQVQALLRDDVNTAPDGILCSLGIDSRYNEGCSELASYLFCGLYNHNHFDMEQIPEDFPEEVLDDVIILIKAECVHLYCNPVNYGYLLPYVSHWRNLQLHCLTETEYEDEEVAEEFKISSFVSMVQDCHCIGIPYSSHGHVQK---FDMFMLEKWPIIQAFALEGIGA-------GLFFTMKYKVF-----------------IHNFGCDILSQDLQLFERQWSCLFSSMEIESALSMQELSEAQVAEPFRTYYSHGLISSNITDKSKSRQPFVLFGSHSTKEDLESYCFTFPSEGHQVRNTGPSGGVAKHMLLQCVAPKGPLACARTYFF 315          
BLAST of Si:ch211-194c3.5 vs. Ensembl Zebrafish
Match: CR788322.3 (pep chromosome:GRCz11:CHR_ALT_CTG13_1_13:13661778:13668274:1 gene:ENSDARG00000111627.1 transcript:ENSDART00000191500.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR788322.3)

HSP 1 Score: 119.013 bits (297), Expect = 2.400e-28
Identity = 100/335 (29.85%), Postives = 165/335 (49.25%), Query Frame = 3
Query:  165 CQRLHKIQRLIN---YKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLD--DDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMEN----IFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDLRDKFVSN--PKHMIIQCVSLHTGIVIARTIFL 1130
            C RL ++Q L+        DG+L  +GID R+N G  EL +YLF  +++    D+++   D  +++ DDV++ I  + VH+YCN  NY  LLPY++ W  L+LHCL+E E ED E+ E+FKI +F  M + C  I +   + G +++   FD  ++E WPIIQ++A +  G          FFT+ +KV                  + N    +L Q   L E     +F  ++ +S     E+ E    EP ++Y++H   +  +  +     P  L G+++ +  L +           +R+   S    KHM++QCV+    +  ART F 
Sbjct:    8 CSRLRQVQALLRDDVNTAPDGILCSLGIDSRYNEGCSELASYLFCGLYNHNHFDMEQIPEDFPEEVLDDVIILIKAECVHLYCNPVNYGYLLPYVSHWRNLQLHCLTETEYEDEEVAEEFKISSFVSMVQDCHCIGIPYSSHGHVQK---FDMFMLEKWPIIQAFALEGIGA-------GLFFTMKYKVF-----------------IHNFGCDILSQDLQLFERQWSCLFSSMEIESALSMQELSEAQVAEPFRTYYSHGLISSNITDKSKSRQPFVLFGSHSTKEDLESYCFTFPSEGHQVRNTGPSGGVAKHMLLQCVAPKGPLACARTYFF 315          
BLAST of Si:ch211-194c3.5 vs. Ensembl Zebrafish
Match: CR788322.3 (pep chromosome:GRCz11:CHR_ALT_CTG13_1_13:13661778:13668901:1 gene:ENSDARG00000111627.1 transcript:ENSDART00000179973.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR788322.3)

HSP 1 Score: 109.768 bits (273), Expect = 2.213e-26
Identity = 77/213 (36.15%), Postives = 123/213 (57.75%), Query Frame = 3
Query:  165 CQRLHKIQRLIN---YKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLD--DDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKV 788
            C RL ++Q L+        DG+L  +GID R+N G  EL +YLF  +++    D+++   D  +++ DDV++ I  + VH+YCN  NY  LLPY++ W  L+LHCL+E E ED E+ E+FKI +F  M + C  I  +   S    + FD  ++E WPIIQ++A +  G          FFT+ +K+ D+S  +  ++  +DPV L+ +  +V
Sbjct:    8 CSRLRQVQALLRDDVNTAPDGILCSLGIDSRYNEGCSELASYLFCGLYNHNHFDMEQIPEDFPEEVLDDVIILIKAECVHLYCNPVNYGYLLPYVSHWRNLQLHCLTETEYEDEEVAEEFKISSFVSMVQDCHCIG-IPYSSHGHVQKFDMFMLEKWPIIQAFALEGIGA-------GLFFTMKYKLKDVSQRLWQVYSRLDPVSLDCLLNEV 212          
BLAST of Si:ch211-194c3.5 vs. Ensembl Zebrafish
Match: si:ch211-194c3.5 (si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-63])

HSP 1 Score: 78.5666 bits (192), Expect = 4.119e-16
Identity = 56/138 (40.58%), Postives = 85/138 (61.59%), Query Frame = 3
Query:  162 SCQRLHKIQRLIN---YKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLD--DDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV 560
            SC RL ++Q L+        DG+L  +GID R+N G  EL +YLF  +++    D+++   D  +++ DDV++ I  + VH+YCN  NY  LLPY++ W  L+LHCL+E E ED E+ E+FKI +F  M + C  I +
Sbjct:    7 SCSRLQQVQALLRDDVNTAPDGILCSLGIDSRYNEGCSELASYLFCGLYNHNHFDMEQIPEDFPEEVLDDVIILIKAECVHLYCNPVNYGYLLPYVSHWRNLQLHCLTETEYEDEEVAEEFKISSFVSMVQDCHCIGI 144          
BLAST of Si:ch211-194c3.5 vs. Ensembl Xenopus
Match: C20orf194 (chromosome 20 open reading frame 194 [Source:NCBI gene;Acc:100486685])

HSP 1 Score: 195.282 bits (495), Expect = 4.816e-50
Identity = 144/456 (31.58%), Postives = 223/456 (48.90%), Query Frame = 3
Query:  246 RFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNH--LKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSD----SEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKS-SKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDRGEN-LGSVIFADTFVVTSTPVNKEDNLTSV----LRLGKKVPLFSYW 1562
            R+N G  EL NYL FD++S R  D +R+   +++ DDV++ I  D VH+YCN  NY  LLP + CW  L  HC+S     D E  E++KI +F  M R C +I +    +G +   + FD  +VE WPI+Q++A +  G         GFFT+ H+++D+S  +  ++ ++DPV LE++  + L   E    N+F   +++     LE+ E    EP +SYF+H  L S+    S C Q  P  L GT++ +  L     K  +    SEG L        S  KHM+ QCVS    +  +RT F  G +++      +         LS  Y A+V     V++ + S +K++   +V A   L    NK       F II     N   GF++     V+DI +   G   LGSV+F+++F+ +   V ++D   S       L   +P F  W
Sbjct:   26 RYNEGCKELANYLLFDLYSQRNTDFERTAFPEEVLDDVIILIKLDSVHLYCNPVNYTYLLPLVGCWRNLHFHCMS-----DGEAAEEYKIASFVNMVRDCGQIGIPYSCRGHL---QTFDMFIVEKWPIVQAFALEGIGG-------GGFFTMKHELMDVSELLWKVYSDMDPVLLESLIMEDLTTFEHQWTNLFSHFETE-IPFVLELSECQAGEPFRSYFSHGMLSSHIAEPSPCRQ--PFVLFGTHSTRENL-----KPGNFIFPSEGHLVRNTGPGGSTAKHMVAQCVSPKGPLACSRTYFF-GSTHIPYLGLLILFLLFPSTLLSQIYAAVVEA---VLAGIASYAKSLSPSKVRAVTSLFVWKNK-------FCII-----NTFIGFILQASMAVYDIPDVQNGRGCLGSVVFSESFLKSQINVKEKDGTVSTDNSFTILTAAIPRFLSW 442          

HSP 2 Score: 122.479 bits (306), Expect = 1.862e-27
Identity = 109/453 (24.06%), Postives = 199/453 (43.93%), Query Frame = 3
Query: 2358 NEQSSIVVTVICGLPGSGQEFLTRKIMKII--HDDFDWLLVTPISIQDVTCATENILKDFENINE-------------NKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTG--PDSNSIKTTTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHF----GVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            NE+ S+ +T++ GLPGS    L   ++ +   +  F W +    S      A+ +  +   N+ E              +N+R+L++    S   ++V+ L+  +    R    IG +  C+NP + ++++R +T P  L+ C++G V+++++T    +        L +++RA N      L  K  VT+  +++ I+S  +F   +   AR L      +  F          +I  RF         PL K   +   + +  ++   PF  N+Y I G +   +  +R+  +   +L   L + P+ +  +     +    ++    + V          S K  D+K+     LR   +Q P KK   T   +T Q+M  IH   HL+ LP+G+FYNG  +V+  G + D HP +  FI D+++  N EIE  N  L+     D F +
Sbjct:  633 NEKVSMTITIVSGLPGSYCNELCVSLVSLQTEYGSFRWNVYRQPSDSMEDFASVHFQRHLSNVLEVKRKHGVHKAAFFRRNIRMLVVLDGYSDVLDVVQALQTHSDPEVRSSYIIGAVAACVNPLSCFMEHR-FTFPKFLEQCSQGIVSSVVITSLTTEQRHPNFVLLQKLIRAANPGAAFILAEKGMVTRNEDIELIMSDSSFSNPQMLRARYLMYPGWFEGQFSSGAAFPKMDQICVRFSR-------PLEKARFMTRCKAIKSSIKTFPFSGNLYHIVGRVLFSDAEQRM-EVCHDTLVNSLRLAPVEDGPSPPPDPKRDQRETNQPCMLVFT------GCSLKEEDIKD----WLRQCAKQKPQKKLLRTRGTLTLQEMRGIHARHHLDPLPQGYFYNGTQFVNFLGEKMDYHPLMDQFIYDYLHEANQEIEKYNKELEAQEYFDIFGQ 1066          
BLAST of Si:ch211-194c3.5 vs. Ensembl Xenopus
Match: C20orf194 (chromosome 20 open reading frame 194 [Source:NCBI gene;Acc:100486685])

HSP 1 Score: 191.815 bits (486), Expect = 5.938e-49
Identity = 139/423 (32.86%), Postives = 218/423 (51.54%), Query Frame = 3
Query:  246 RFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNH--LKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKS-SDSEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMD--DTCADVMKLSTAYNAIVSTADFVISKLKS-SKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDRGEN-LGSVIFADTFV 1478
            R+N G  EL NYL FD++S R  D +R+   +++ DDV++ I  D VH+YCN  NY  LLP + CW  L  HC+S     D E  E++KI +F  M R C +I +    +G +   + FD  +VE WPI+Q++A +  G         GFFT+ H+++D+S  +  ++ ++DPV LE++  + L   E    N+F   +++     LE+ E    EP +SYF+H  L S+    S C Q  P  L GT++ +  L  + G     SEG L        S  KHM+ QCVS    +  +RT F  G +++    K+ D       +  LS  Y A+V     V++ + S +K++   +V A   L    NK   S  +F+I  +    NS G  ++    V+DI +   G   LGSV+F+++F+
Sbjct:   58 RYNEGCKELANYLLFDLYSQRNTDFERTAFPEEVLDDVIILIKLDSVHLYCNPVNYTYLLPLVGCWRNLHFHCMS-----DGEAAEEYKIASFVNMVRDCGQIGIPYSCRGHL---QTFDMFIVEKWPIVQAFALEGIGG-------GGFFTMKHELMDVSELLWKVYSDMDPVLLESLIMEDLTTFEHQWTNLFSHFETE-IPFVLELSECQAGEPFRSYFSHGMLSSHIAEPSPCRQ--PFVLFGTHSTRENL--KPGNFIFPSEGHLVRNTGPGGSTAKHMVAQCVSPKGPLACSRTYFF-GSTHIPYLGKDNDVQKKNEHITLLSQIYAAVVEA---VLAGIASYAKSLSPSKVRAVTSLFVWKNKC-VSKVTFQIEAV----NSLGRYVLSFMAVYDIPDVQNGRGCLGSVVFSESFL 451          

HSP 2 Score: 111.309 bits (277), Expect = 5.222e-24
Identity = 109/454 (24.01%), Postives = 200/454 (44.05%), Query Frame = 3
Query: 2358 NEQSSIVVTVICGLPGSGQEFLTRKIMKII--HDDFDWLLVTPISIQDVTCATENILKDFENINE-------------NKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTG--PDSNSIKTTTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPL-----PNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            NE+ S+ +T++ GLPGS    L   ++ +   +  F W +    S      A+ +  +   N+ E              +N+R+L++    S   ++V+ L+  +    R    IG +  C+NP + ++++R +T P  L+ C++G V+++++T    +        L +++RA N      L  K  VT+  +++ I+S  +F        ++L  L    T   +   K +      +F+ +         I++S + F      PF  N+Y I G +   +  +R+  +   +L   L + P+     P  + + D      T    + ++           S K  D+K+     LR   +Q P KK   T   +T Q+M  IH   HL+ LP+G+FYNG  +V+  G + D HP +  FI D+++  N EIE  N  L+     D F +
Sbjct:  678 NEKVSMTITIVSGLPGSYCNELCVSLVSLQTEYGSFRWNVYRQPSDSMEDFASVHFQRHLSNVLEVKRKHGVHKAAFFRRNIRMLVVLDGYSDVLDVVQALQTHSDPEVRSSYIIGAVAACVNPLSCFMEHR-FTFPKFLEQCSQGIVSSVVITSLTTEQRHPNFVLLQKLIRAANPGAAFILAEKGMVTRNEDIELIMSDSSFSN-----PQMLRALPAFYTDLYI--LKSVC-----VFFCL-------TAIKSSIKTF------PFSGNLYHIVGRVLFSDAEQRM-EVCHDTLVNSLRLAPVEDGPSPPPDPKRDQRE---TNQPCMLVFTGC--------SLKEEDIKD----WLRQCAKQKPQKKLLRTRGTLTLQEMRGIHARHHLDPLPQGYFYNGTQFVNFLGEKMDYHPLMDQFIYDYLHEANQEIEKYNKELEAQEYFDIFGQ 1089          
BLAST of Si:ch211-194c3.5 vs. Ensembl Xenopus
Match: C20orf194 (chromosome 20 open reading frame 194 [Source:NCBI gene;Acc:100486685])

HSP 1 Score: 191.045 bits (484), Expect = 1.531e-48
Identity = 193/673 (28.68%), Postives = 312/673 (46.36%), Query Frame = 3
Query:   90 PLTKVRRPKYERHDIKQHLFSSFLSCQRLHKIQRLINYKKXX---XXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNH--LKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSD----SEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMD--DTCADVMKLSTAYNAIVSTADFVISKLKSS------KNIVLDEVEAKNQLKYSLN---KMRYSDCSFRIITIGDTNNSQGFLMIIQS----------VVFDIVNEDRGEN-LGSVIFADTFVVTSTPVNKEDNLTSV----LRLGKKVPLFSYW--TNNNLSKLHQTINEIYE----LEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGAIIL---YPDSVEVVEGESYCDWTIFSITCQVSKSKFTNWI-WNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKE 1958
            PL+  R  +Y+R    +       SC RL KIQ ++N K      G+L I+GID R+N G  EL NYL FD++S R  D +R+   +++ DDV++ I  D VH+YCN  NY  LLP + CW  L  HC+S+ E ED E  E++KI +F  M R C +I +    +G +   + FD  +VE WPI+Q++A +  G         GFFT+ H+++D+S  +  ++ ++DPV LE++  + L   E    N+F   +++     LE+ E    EP +SYF+H  L S+    S C Q  P  L GT++ +  L     K  +    SEG L        S  KHM+ QCVS    +  +RT F  G +++    K+ D       +  LS  Y A+V      I+    S      K +    + AK  L   L+    +R S  +F+I  +    NS G ++ +             V+DI +   G   LGSV+F+++F+ +   V ++D   S       L   +P F  W   +N +    +  + + E    L    +      +     Q    +   C FF D +L  +   G++ +   + +S+++ +G S    T+ +      KS  T  +  + N     L       SK  ++  S V+P W++
Sbjct:    6 PLSVGRSRRYQRCSPAE-------SCSRLRKIQEILNKKSKSIPDGILCILGIDSRYNEGCKELANYLLFDLYSQRNTDFERTAFPEEVLDDVIILIKLDSVHLYCNPVNYTYLLPLVGCWRNLHFHCMSDGEYEDEEAAEEYKIASFVNMVRDCGQIGIPYSCRGHL---QTFDMFIVEKWPIVQAFALEGIGG-------GGFFTMKHELMDVSELLWKVYSDMDPVLLESLIMEDLTTFEHQWTNLFSHFETE-IPFVLELSECQAGEPFRSYFSHGMLSSHIAEPSPCRQ--PFVLFGTHSTRENL-----KPGNFIFPSEGHLVRNTGPGGSTAKHMVAQCVSPKGPLACSRTYFF-GSTHIPYLGKDNDVQKKNEHITLLSQIYAAVVEAVLAGIASYAKSLSPSKAKEVAEQTLWAKLDLVNLLHIKSSLR-SKVTFQIEAV----NSLGRIVPLDDGLHLVNTASMAVYDIPDVQNGRGCLGSVVFSESFLKSQINVKEKDGTVSTDNSFTILTAAIPRFLSWLVEDNEVKLSEKAFSTVKEEKSFLGSFISSGDGTYMCPGSLQIGPEEGKLC-FFSDGILFLHPYHGSVTISRNHVNSIKLYDGNSS---TVAAALIVEYKSSLTPHLPIHFNVASGFLTFALMPKSKSYRTFYSQVLPVWQK 643          

HSP 2 Score: 119.013 bits (297), Expect = 2.565e-26
Identity = 107/455 (23.52%), Postives = 198/455 (43.52%), Query Frame = 3
Query: 2352 NINEQSSIVVTVICGLPGSGQEFLTRKIMKII--HDDFDWLLVTPISIQDVTCATENILKDFENINE-------------NKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTG--PDSNSIKTTTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHF----GVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            N  E   + +T++ GLPGS    L   ++ +   +  F W +    S      A+ +  +   N+ E              +N+R+L++    S   ++V+ L+  +    R    IG +  C+NP + ++++R +T P  L+ C++G V+++++T    +        L +++RA N      L  K  VT+  +++ I+S  +F   +   AR L      +  F          +I  RF         PL K   +   + +  ++   PF  N+Y I G +   +  +R+  +   +L   L + P+ +  +     +    ++    + V    ++      K  D+K+     LR   +Q P KK   T   +T Q+M  IH   HL+ LP+G+FYNG  +V+  G + D HP +  FI D+++  N EIE  N  L+     D F +
Sbjct:  734 NNPENEKMTITIVSGLPGSYCNELCVSLVSLQTEYGSFRWNVYRQPSDSMEDFASVHFQRHLSNVLEVKRKHGVHKAAFFRRNIRMLVVLDGYSDVLDVVQALQTHSDPEVRSSYIIGAVAACVNPLSCFMEHR-FTFPKFLEQCSQGIVSSVVITSLTTEQRHPNFVLLQKLIRAANPGAAFILAEKGMVTRNEDIELIMSDSSFSNPQMLRARYLMYPGWFEGQFSSGAAFPKMDQICVRFSR-------PLEKARFMTRCKAIKSSIKTFPFSGNLYHIVGRVLFSDAEQRM-EVCHDTLVNSLRLAPVEDGPSPPPDPKRDQRETNQPCMLVFTGCSL------KEEDIKD----WLRQCAKQKPQKKLLRTRGTLTLQEMRGIHARHHLDPLPQGYFYNGTQFVNFLGEKMDYHPLMDQFIYDYLHEANQEIEKYNKELEAQEYFDIFGQ 1169          
BLAST of Si:ch211-194c3.5 vs. Ensembl Xenopus
Match: C20orf194 (chromosome 20 open reading frame 194 [Source:NCBI gene;Acc:100486685])

HSP 1 Score: 189.119 bits (479), Expect = 2.868e-48
Identity = 142/437 (32.49%), Postives = 225/437 (51.49%), Query Frame = 3
Query:  246 RFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNH--LKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKS-SDSEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKS-SKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDRGEN-LGSVIFADTFVVTSTPVNKEDNLTSVL 1526
            R+N G  EL NYL FD++S R  D +R+   +++ DDV++ I  D VH+YCN  NY  LLP + CW  L  HC+S     D E  E++KI +F  M R C +I +    +G +   + FD  +VE WPI+Q++A +  G         GFFT+ H+++D+S  +  ++ ++DPV LE++  + L   E    N+F   +++     LE+ E    EP +SYF+H  L S+    S C Q  P  L GT++ +  L  + G     SEG L        S  KHM+ QCVS    +  +RT F  G +++      + DT      LS  Y A+V     V++ + S +K++   +V A   L    NK   S  +F+I  +    NS G  ++    V+DI +   G   LGSV+F+++F+   + +N ++  T +L
Sbjct:   58 RYNEGCKELANYLLFDLYSQRNTDFERTAFPEEVLDDVIILIKLDSVHLYCNPVNYTYLLPLVGCWRNLHFHCMS-----DGEAAEEYKIASFVNMVRDCGQIGIPYSCRGHL---QTFDMFIVEKWPIVQAFALEGIGG-------GGFFTMKHELMDVSELLWKVYSDMDPVLLESLIMEDLTTFEHQWTNLFSHFETE-IPFVLELSECQAGEPFRSYFSHGMLSSHIAEPSPCRQ--PFVLFGTHSTRENL--KPGNFIFPSEGHLVRNTGPGGSTAKHMVAQCVSPKGPLACSRTYFF-GSTHIPY----LGDTL-----LSQIYAAVVEA---VLAGIASYAKSLSPSKVRAVTSLFVWKNKC-VSKVTFQIEAV----NSLGRYVLSFMAVYDIPDVQNGRGCLGSVVFSESFL--KSQINVKEKGTHLL 454          

HSP 2 Score: 98.2117 bits (243), Expect = 5.960e-20
Identity = 98/430 (22.79%), Postives = 178/430 (41.40%), Query Frame = 3
Query: 2418 FLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINE-------------NKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTG--PDSNSIKTTTLHRILRARNELCTIYLTPKADVTKELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPL-----PNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            F++ + + + H  F W +    S      A+ +  +   N+ E              +N+R+L++    S   ++V+ L+  +    R    IG +  C+NP + ++++R +T P  L+ C++G V+++++T    +        L +++RA N      L  K  VT      L   AF  + + L  +                         +F+ +         I++S + F      PF  N+Y I G +   +  +R+  +   +L   L + P+     P  + + D      T    + ++           S K  D+K+     LR   +Q P KK   T   +T Q+M  IH   HL+ LP+G+FYNG  +V+  G + D HP +  FI D+++  N EIE  N  L+     D F +
Sbjct:  601 FISPETLFLCHGSFRWNVYRQPSDSMEDFASVHFQRHLSNVLEVKRKHGVHKAAFFRRNIRMLVVLDGYSDVLDVVQALQTHSDPEVRSSYIIGAVAACVNPLSCFMEHR-FTFPKFLEQCSQGIVSSVVITSLTTEQRHPNFVLLQKLIRAANPGAAFILAEKGMVTS-YSVRLGLPAFYTDLYILKSVC------------------------VFFCL-------TAIKSSIKTF------PFSGNLYHIVGRVLFSDAEQRM-EVCHDTLVNSLRLAPVEDGPSPPPDPKRDQRE---TNQPCMLVFTGC--------SLKEEDIKD----WLRQCAKQKPQKKLLRTRGTLTLQEMRGIHARHHLDPLPQGYFYNGTQFVNFLGEKMDYHPLMDQFIYDYLHEANQEIEKYNKELEAQEYFDIFGQ 975          
BLAST of Si:ch211-194c3.5 vs. Ensembl Xenopus
Match: C20orf194 (chromosome 20 open reading frame 194 [Source:NCBI gene;Acc:100486685])

HSP 1 Score: 189.119 bits (479), Expect = 3.892e-48
Identity = 142/437 (32.49%), Postives = 225/437 (51.49%), Query Frame = 3
Query:  246 RFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNH--LKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKS-SDSEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKS-SKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDRGEN-LGSVIFADTFVVTSTPVNKEDNLTSVL 1526
            R+N G  EL NYL FD++S R  D +R+   +++ DDV++ I  D VH+YCN  NY  LLP + CW  L  HC+S     D E  E++KI +F  M R C +I +    +G +   + FD  +VE WPI+Q++A +  G         GFFT+ H+++D+S  +  ++ ++DPV LE++  + L   E    N+F   +++     LE+ E    EP +SYF+H  L S+    S C Q  P  L GT++ +  L  + G     SEG L        S  KHM+ QCVS    +  +RT F  G +++      + DT      LS  Y A+V     V++ + S +K++   +V A   L    NK   S  +F+I  +    NS G  ++    V+DI +   G   LGSV+F+++F+   + +N ++  T +L
Sbjct:   26 RYNEGCKELANYLLFDLYSQRNTDFERTAFPEEVLDDVIILIKLDSVHLYCNPVNYTYLLPLVGCWRNLHFHCMS-----DGEAAEEYKIASFVNMVRDCGQIGIPYSCRGHL---QTFDMFIVEKWPIVQAFALEGIGG-------GGFFTMKHELMDVSELLWKVYSDMDPVLLESLIMEDLTTFEHQWTNLFSHFETE-IPFVLELSECQAGEPFRSYFSHGMLSSHIAEPSPCRQ--PFVLFGTHSTRENL--KPGNFIFPSEGHLVRNTGPGGSTAKHMVAQCVSPKGPLACSRTYFF-GSTHIPY----LGDTL-----LSQIYAAVVEA---VLAGIASYAKSLSPSKVRAVTSLFVWKNKC-VSKVTFQIEAV----NSLGRYVLSFMAVYDIPDVQNGRGCLGSVVFSESFL--KSQINVKEKGTHLL 422          

HSP 2 Score: 103.605 bits (257), Expect = 1.343e-21
Identity = 98/426 (23.00%), Postives = 176/426 (41.31%), Query Frame = 3
Query: 2418 FLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINE-------------NKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTG--PDSNSIKTTTLHRILRARNELCTIYLTPKADVTKELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKN-LTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            F++ + + + H  F W +    S      A+ +  +   N+ E              +N+R+L++    S   ++V+ L+  +    R    IG +  C+NP + ++++R +T P  L+ C++G V+++++T    +        L +++RA N      L  K  VT+  D                     L    + F      R    FY   Y     +LK   +       K+ +   PF  N+Y I G +   +  +R+  +   +L   L + P+ +  +     +    ++    + V          S K  D+K+     LR   +Q P KK   T   +T Q+M  IH   HL+ LP+G+FYNG  +V+  G + D HP +  FI D+++  N EIE  N  L+     D F +
Sbjct:  639 FISPETLFLCHGSFRWNVYRQPSDSMEDFASVHFQRHLSNVLEVKRKHGVHKAAFFRRNIRMLVVLDGYSDVLDVVQALQTHSDPEVRSSYIIGAVAACVNPLSCFMEHR-FTFPKFLEQCSQGIVSSVVITSLTTEQRHPNFVLLQKLIRAANPGAAFILAEKGMVTRNEDI-------------------ELIMSDSSFSNPQMLRALPAFYTDLY-----ILKSVCVFFCLTAIKSSIKTFPFSGNLYHIVGRVLFSDAEQRM-EVCHDTLVNSLRLAPVEDGPSPPPDPKRDQRETNQPCMLVFT------GCSLKEEDIKD----WLRQCAKQKPQKKLLRTRGTLTLQEMRGIHARHHLDPLPQGYFYNGTQFVNFLGEKMDYHPLMDQFIYDYLHEANQEIEKYNKELEAQEYFDIFGQ 1028          
BLAST of Si:ch211-194c3.5 vs. Ensembl Mouse
Match: 4930402H24Rik (RIKEN cDNA 4930402H24 gene [Source:MGI Symbol;Acc:MGI:1923029])

HSP 1 Score: 172.555 bits (436), Expect = 5.889e-43
Identity = 171/643 (26.59%), Postives = 294/643 (45.72%), Query Frame = 3
Query:  159 LSCQRLHKIQRLINYKKXXXXXXXX---XXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVA--KPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSL---------NKMRYSDCSFRIITIGDTN--------NSQGFLMIIQSVVFDIVN---EDRGENLGSVIFADTFVVTSTPVNKEDNL----TSVLRLGKKVPLFSYW----TNNNLSK--LHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGAIIL---YPDSVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKE 1958
            +SC RL ++Q ++          I+   GID R+N G  EL NYL F ++S    D +++   ++I DDV++ I  D VH+YCN  NY  LLPY+A W  L  HC++E E ED E  E+FKI +F +M R C +I +   ++G +   + FD  VVE WPI+Q++A +  G         GFFT+ +++ D+S  +  ++  +DP  LEN+  + L   E    + F   D++     LE+ E    EP +SYF H   +  +        P  L G ++ +  L +    +  SEG L        S  KHM+ QCVS    +  +RT F  G ++V     ++++  T   +  LS  Y A++      I+    + ++   +  A++ L+  L           +R S  +F I  + +          +S  F+   +  V+DI +      G  LGSV+F+++F+ +   V ++D      TS + L   +P F  W    +   LS+  L  T  +   L  L T      L     Q +  ++    FF   +L  ++  G+I++   + D+    +G+S     + ++      S   +   + +   + L L     SK+ ++  S V   W++
Sbjct:   27 VSCSRLRQVQSVLTQSSKSQPDGILCILGIDSRYNEGCRELANYLLFGLYSQNATDFEKTGFSEEILDDVILLIKSDSVHLYCNPVNYRYLLPYVAHWRNLHFHCMTENEYEDEEAAEEFKISSFVDMVRDCSRIGIPYSSQGHL---QIFDMFVVEKWPIVQAFALEGIGG-------DGFFTMKYELQDVSLSLWNVYSRMDPASLENMLSEDLAVFEHQWTSFFANFDTE-IPFLLELSESQAGEPFRSYFGHGMLSSHITENSPHRQPFVLFGNHSTRDNL-SAGSFNFPSEGHLVRNTGPAGSFAKHMVAQCVSPKGPLACSRTYFF-GATHVPYLGDNEKLPRTTEQIRLLSQIYAAVIEAVLAGIACYAKTCSLAKAKEVAEHTLESGLVFTELVPFKADLR-SKVTFHIHAVNNQGRIVPLNNEDSLSFVKTARMTVYDIPDLLGGGGGGCLGSVVFSESFLTSRILVKEKDGTITPETSYIILTAAIPRFCSWLVEDSEIKLSEKTLQATKGDDCCLGTLLTGGKGAYLYSNSPQ-SGPEEGSAYFFSGGLLFSHRHHGSIVIAKEHVDAFSFYDGDSTS--VVAALLIHFRSSILPHLPVHFHGSSNFLMLALFPKSKIYQAFYSEVFSPWQQ 652          

HSP 2 Score: 117.857 bits (294), Expect = 4.614e-26
Identity = 107/446 (23.99%), Postives = 190/446 (42.60%), Query Frame = 3
Query: 2361 EQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINE-------------NKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKT--TTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            E   +V++++ GLPG     L   ++ +  +   W++   I          +  K   +  E              K  R+L++    +   ++V+ L+       R    IG +TVC+ P + Y+++R +  P  LD C++G V+ ++ T   +         L  ++RA N      L     VT+  +++ ILS+ +F   +   +R L     ++  F   +   +     +I      PL K   +   R +  ++  +PF  NIY I G +    D ++   +   +LT  L I P+         SR+S   +     Y+     +    S K   LK+     LR   +Q P +K   T   +T Q++  IH +RHL+ LP G+FYNG  +V+  G ++D HP +  F+ D++   N EIE  N  L+     D F +
Sbjct:  744 ESDKVVISIVTGLPGCHASKLCAFLITLHKEYGRWMVYRQIMDSSECFHAAHFQKYLSSALEAQQNRSARQSAYIRKKTRLLVVLQGYTDVIDVVQALQTHPDPNVRSYFTIGAVTVCVEPLSCYMEHR-FLFPKCLDQCSQGVVSNVVFTSHTAEQKHPLLVQLQTLIRASNPTAAFILAENGIVTRNEDIELILSENSFSSPQMLRSRYLLFPGWYEGKFDAGS---VFPLMVQICVWFDCPLEKTRFVSRCRAIQSSIKPSPFSGNIYHILGKVKFS-DSEKTMEVCHNTLTNSLTIVPVLEGPTPPPNSRSSPQDNGQPECYL-----VFIGCSLKEDSLKD----WLRQSAKQRPQRKALKTRGMLTQQEIKNIHVKRHLDPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVEEANREIERYNRELEQQEYRDLFEQ 1175          
BLAST of Si:ch211-194c3.5 vs. Ensembl Mouse
Match: 4930402H24Rik (RIKEN cDNA 4930402H24 gene [Source:MGI Symbol;Acc:MGI:1923029])

HSP 1 Score: 137.502 bits (345), Expect = 1.856e-35
Identity = 81/216 (37.50%), Postives = 122/216 (56.48%), Query Frame = 3
Query:  159 LSCQRLHKIQRLINYKKXXXXXXXX---XXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQ 797
            +SC RL ++Q ++          I+   GID R+N G  EL NYL F ++S    D +++   ++I DDV++ I  D VH+YCN  NY  LLPY+A W  L  HC++E E ED E  E+FKI +F +M R C +I  +   S    + FD  VVE WPI+Q++A +  G         GFFT+ +++ D+S  +  ++  +DP  LEN+  +V  Q
Sbjct:   27 VSCSRLRQVQSVLTQSSKSQPDGILCILGIDSRYNEGCRELANYLLFGLYSQNATDFEKTGFSEEILDDVILLIKSDSVHLYCNPVNYRYLLPYVAHWRNLHFHCMTENEYEDEEAAEEFKISSFVDMVRDCSRIG-IPYSSQGHLQIFDMFVVEKWPIVQAFALEGIGG-------DGFFTMKYELQDVSLSLWNVYSRMDPASLENMLSEVRSQ 234          
BLAST of Si:ch211-194c3.5 vs. Ensembl Mouse
Match: 4930402H24Rik (RIKEN cDNA 4930402H24 gene [Source:MGI Symbol;Acc:MGI:1923029])

HSP 1 Score: 117.087 bits (292), Expect = 6.169e-26
Identity = 107/446 (23.99%), Postives = 190/446 (42.60%), Query Frame = 3
Query: 2361 EQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINE-------------NKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKT--TTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            E   +V++++ GLPG     L   ++ +  +   W++   I          +  K   +  E              K  R+L++    +   ++V+ L+       R    IG +TVC+ P + Y+++R +  P  LD C++G V+ ++ T   +         L  ++RA N      L     VT+  +++ ILS+ +F   +   +R L     ++  F   +   +     +I      PL K   +   R +  ++  +PF  NIY I G +    D ++   +   +LT  L I P+         SR+S   +     Y+     +    S K   LK+     LR   +Q P +K   T   +T Q++  IH +RHL+ LP G+FYNG  +V+  G ++D HP +  F+ D++   N EIE  N  L+     D F +
Sbjct:  613 ESDKVVISIVTGLPGCHASKLCAFLITLHKEYGRWMVYRQIMDSSECFHAAHFQKYLSSALEAQQNRSARQSAYIRKKTRLLVVLQGYTDVIDVVQALQTHPDPNVRSYFTIGAVTVCVEPLSCYMEHR-FLFPKCLDQCSQGVVSNVVFTSHTAEQKHPLLVQLQTLIRASNPTAAFILAENGIVTRNEDIELILSENSFSSPQMLRSRYLLFPGWYEGKFDAGS---VFPLMVQICVWFDCPLEKTRFVSRCRAIQSSIKPSPFSGNIYHILGKVKFS-DSEKTMEVCHNTLTNSLTIVPVLEGPTPPPNSRSSPQDNGQPECYL-----VFIGCSLKEDSLKD----WLRQSAKQRPQRKALKTRGMLTQQEIKNIHVKRHLDPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVEEANREIERYNRELEQQEYRDLFEQ 1044          

HSP 2 Score: 98.2117 bits (243), Expect = 4.627e-20
Identity = 98/383 (25.59%), Postives = 172/383 (44.91%), Query Frame = 3
Query:  507 FKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVA--KPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSL---------NKMRYSDCSFRIITIGDTN--------NSQGFLMIIQSVVFDIVN---EDRGENLGSVIFADTFVVTSTPVNKEDNL----TSVLRLGKKVPLFSYW 1562
            FKI +F +M R C +I +   ++G ++    FD  VVE WPI+Q++A +  G         GFFT+ +++ D+S  +  ++  +DP  LEN+  + L   E    + F   D++     LE+ E    EP +SYF H   +  +        P  L G ++ +  L +    +  SEG L        S  KHM+ QCVS    +  +RT F  G ++V     ++++  T   +  LS  Y A++      I+    + ++   +  A++ L+  L           +R S  +F I  + +          +S  F+   +  V+DI +      G  LGSV+F+++F+ +   V ++D      TS + L   +P F  W
Sbjct:   15 FKISSFVDMVRDCSRIGIPYSSQGHLQ---IFDMFVVEKWPIVQAFALEGIGG-------DGFFTMKYELQDVSLSLWNVYSRMDPASLENMLSEDLAVFEHQWTSFFANFDTE-IPFLLELSESQAGEPFRSYFGHGMLSSHITENSPHRQPFVLFGNHSTRDNL-SAGSFNFPSEGHLVRNTGPAGSFAKHMVAQCVSPKGPLACSRTYFF-GATHVPYLGDNEKLPRTTEQIRLLSQIYAAVIEAVLAGIACYAKTCSLAKAKEVAEHTLESGLVFTELVPFKADLR-SKVTFHIHAVNNQGRIVPLNNEDSLSFVKTARMTVYDIPDLLGGGGGGCLGSVVFSESFLTSRILVKEKDGTITPETSYIILTAAIPRFCSW 383          
BLAST of Si:ch211-194c3.5 vs. UniProt/SwissProt
Match: sp|Q5TEA3|CT194_HUMAN (Uncharacterized protein C20orf194 OS=Homo sapiens OX=9606 GN=C20orf194 PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 4.939e-73
Identity = 301/1236 (24.35%), Postives = 535/1236 (43.28%), Query Frame = 3
Query:  150 SSFLSCQRLHKIQRLI---NYKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTN-TRQSVLMTRLGKSSDSEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVA--KPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSLNKMRY--------SDCSFRIITIG--------DTNNSQGFLMIIQSVVFDIVNEDRGEN-LGSVIFADTFVVTSTPVNKEDNL----TSVLRLGKKVPLFSYW-TNNNLSKLHQTINEIYE-----LEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGAIILYPD---SVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYSLIHRKSCVRVFAQLMVMNYSLRYYD-NVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPG----------------SGQEFLTRKIM---KIIH-DDFDWLLVTPISIQDVTCATENILKDFENINENKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKT--TTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPL-----PNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKE-SFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAF 3632
            S  +SC RL ++Q ++   +  + DG+L I+GID R+N G  EL NYL F +++  T D +++   +++ DDV++ I  D VH+YCN  N+  LLPY+A W  L  HC++E E ED E  E+FKI +F +M R C +I +   ++G +   + FD  VVE WPI+Q++A +  G         GFFT+ +++ D+S ++  ++ ++DP+ LE++    L   E    + F   D++     LE+ E    EP +SYF+H   +  +        P  L G + TR+++       +  SEG L        S  KHM+ QCVS    +  +RT F  G ++V       ++      +  LS  Y A++      I+    + ++   +  A+  L   L+            S  +F I  +         D+ +S  F+      V+DI +   G   LGSV+F+++F+ +   V ++D      TS + L   VP F  W   +N  KL +   +        L    T      L   + Q +  ++    FF   +L  + +  +II+  D   S+   +G+S    T+ ++      S   +   + +   + L +     SK+ ++  S V   WK+             N  I+ K IQ   ++ +      S+Q +   +S+   +                R S   + A+L  +++ L+++  +    E +  +H  +    QQ  +           N  +++    E   ++++++ GLPG                 G+  + R+IM   +  H   F   L + +  Q    A ++           K  R+L++    +   ++V+ L+       +    IG IT C+ P + Y+++R +  P  LD C++G V+ ++ T   +         L  ++RA N      L     VT+  +++ ILS+ +F       +R L     ++   G  N   +     +I      PL K   +   + +  ++  +PF  NIY I G +    D +R   +   +L   L I P+     P  +++     +S  Q  Y+ +++                LKE S    LR   +Q P +K   T   +T Q++  IH +RHLE LP G+FYNG  +V+  G ++D HP +  F+ D++   N EIE  N  L+     D F
Sbjct:   24 SPSVSCSRLRQVQSILTQSSKSRPDGILCILGIDSRYNEGCRELANYLLFGLYNQNTSDFEKTGFSEEVLDDVIILIKSDSVHLYCNPVNFRYLLPYVAHWRNLHFHCMTENEYEDEEAAEEFKITSFVDMVRDCSRIGIPYSSQGHL---QIFDMFVVEKWPIVQAFALEGIGG-------DGFFTMKYELQDVSLNLWNVYSKMDPMSLESLLSDDLVAFEHQWTSFFANFDTE-IPFLLELSESQAGEPFRSYFSHGMISSHITENSPNRQPFVLFGNHSTRENLNAGNF--NFPSEGHLVRSTGPGGSFAKHMVAQCVSPKGPLACSRTYFF-GATHVPYLGGDSKLPKKTEQIRLLSQIYAAVIEAVLAGIACYAKTSSLTKAKEVAEQTLGSGLDSFELIPFKAALRSKMTFHIHAVNNQGRIVPLDSEDSLSFVKTACMAVYDIPDLLGGNGCLGSVVFSESFLTSQILVKEKDGTVTTETSSVVLTAAVPRFCSWLVEDNEVKLSEKTQQAVRGDESFLGTYLTGGEGAYLYSSNLQ-SWPEEGNVHFFSSGLLFSHCRHRSIIISKDHMNSISFYDGDSTS--TVAALLIDFKSSLLPHLPVHFHGSSNFLMIALFPKSKIYQAFYSEVFSLWKQ-----------QDNSGISLKVIQEDGLSVEQKRLHSSAQKLFSALSQPAGEK---------------RSSLKLLSAKLPELDWFLQHFAISSISQEPVMRTHLPVL--LQQAEI-----------NTTHRI----ESDKVIISIVTGLPGCHASELCAFLVTLHKECGRWMVYRQIMDSSECFHAAHFQRYLSSALEAQQNRSARQSAYI-------RKKTRLLVVLQGYTDVIDVVQALQTHPDSNVKASFTIGAITACVEPMSCYMEHR-FLFPKCLDQCSQGLVSNVVFTSHTTEQRHPLLVQLQSLIRAANPAAAFILAENGIVTRNEDIELILSENSFSSPEMLRSRYLMYPGWYE---GKLNAGSVYPLMVQICVWFGRPLEKTRFVAKCKAIQSSIKPSPFSGNIYHILGKVKF-SDSERTMEVCYNTLANSLSIMPVLEGPTPPPDSKSVSQDSSGQQECYL-VFIGC-------------SLKEDSIKDWLRQSAKQKPQRKALKTRGMLTQQEIRSIHVKRHLEPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQEYHDLF 1173          
BLAST of Si:ch211-194c3.5 vs. UniProt/SwissProt
Match: sp|Q7TT23|CT194_MOUSE (Uncharacterized protein C20orf194 homolog OS=Mus musculus OX=10090 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 4.119e-42
Identity = 171/643 (26.59%), Postives = 294/643 (45.72%), Query Frame = 3
Query:  159 LSCQRLHKIQRLINYKKXXXXXXXX---XXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVA--KPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSL---------NKMRYSDCSFRIITIGDTN--------NSQGFLMIIQSVVFDIVN---EDRGENLGSVIFADTFVVTSTPVNKEDNL----TSVLRLGKKVPLFSYW----TNNNLSK--LHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGAIIL---YPDSVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKE 1958
            +SC RL ++Q ++          I+   GID R+N G  EL NYL F ++S    D +++   ++I DDV++ I  D VH+YCN  NY  LLPY+A W  L  HC++E E ED E  E+FKI +F +M R C +I +   ++G +   + FD  VVE WPI+Q++A +  G         GFFT+ +++ D+S  +  ++  +DP  LEN+  + L   E    + F   D++     LE+ E    EP +SYF H   +  +        P  L G ++ +  L +    +  SEG L        S  KHM+ QCVS    +  +RT F  G ++V     ++++  T   +  LS  Y A++      I+    + ++   +  A++ L+  L           +R S  +F I  + +          +S  F+   +  V+DI +      G  LGSV+F+++F+ +   V ++D      TS + L   +P F  W    +   LS+  L  T  +   L  L T      L     Q +  ++    FF   +L  ++  G+I++   + D+    +G+S     + ++      S   +   + +   + L L     SK+ ++  S V   W++
Sbjct:   27 VSCSRLRQVQSVLTQSSKSQPDGILCILGIDSRYNEGCRELANYLLFGLYSQNATDFEKTGFSEEILDDVILLIKSDSVHLYCNPVNYRYLLPYVAHWRNLHFHCMTENEYEDEEAAEEFKISSFVDMVRDCSRIGIPYSSQGHL---QIFDMFVVEKWPIVQAFALEGIGG-------DGFFTMKYELQDVSLSLWNVYSRMDPASLENMLSEDLAVFEHQWTSFFANFDTE-IPFLLELSESQAGEPFRSYFGHGMLSSHITENSPHRQPFVLFGNHSTRDNL-SAGSFNFPSEGHLVRNTGPAGSFAKHMVAQCVSPKGPLACSRTYFF-GATHVPYLGDNEKLPRTTEQIRLLSQIYAAVIEAVLAGIACYAKTCSLAKAKEVAEHTLESGLVFTELVPFKADLR-SKVTFHIHAVNNQGRIVPLNNEDSLSFVKTARMTVYDIPDLLGGGGGGCLGSVVFSESFLTSRILVKEKDGTITPETSYIILTAAIPRFCSWLVEDSEIKLSEKTLQATKGDDCCLGTLLTGGKGAYLYSNSPQ-SGPEEGSAYFFSGGLLFSHRHHGSIVIAKEHVDAFSFYDGDSTS--VVAALLIHFRSSILPHLPVHFHGSSNFLMLALFPKSKIYQAFYSEVFSPWQQ 652          

HSP 2 Score: 117.857 bits (294), Expect = 3.228e-25
Identity = 107/446 (23.99%), Postives = 190/446 (42.60%), Query Frame = 3
Query: 2361 EQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINE-------------NKNLRILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKT--TTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            E   +V++++ GLPG     L   ++ +  +   W++   I          +  K   +  E              K  R+L++    +   ++V+ L+       R    IG +TVC+ P + Y+++R +  P  LD C++G V+ ++ T   +         L  ++RA N      L     VT+  +++ ILS+ +F   +   +R L     ++  F   +   +     +I      PL K   +   R +  ++  +PF  NIY I G +    D ++   +   +LT  L I P+         SR+S   +     Y+     +    S K   LK+     LR   +Q P +K   T   +T Q++  IH +RHL+ LP G+FYNG  +V+  G ++D HP +  F+ D++   N EIE  N  L+     D F +
Sbjct:  744 ESDKVVISIVTGLPGCHASKLCAFLITLHKEYGRWMVYRQIMDSSECFHAAHFQKYLSSALEAQQNRSARQSAYIRKKTRLLVVLQGYTDVIDVVQALQTHPDPNVRSYFTIGAVTVCVEPLSCYMEHR-FLFPKCLDQCSQGVVSNVVFTSHTAEQKHPLLVQLQTLIRASNPTAAFILAENGIVTRNEDIELILSENSFSSPQMLRSRYLLFPGWYEGKFDAGS---VFPLMVQICVWFDCPLEKTRFVSRCRAIQSSIKPSPFSGNIYHILGKVKFS-DSEKTMEVCHNTLTNSLTIVPVLEGPTPPPNSRSSPQDNGQPECYL-----VFIGCSLKEDSLKD----WLRQSAKQRPQRKALKTRGMLTQQEIKNIHVKRHLDPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVEEANREIERYNRELEQQEYRDLFEQ 1175          
BLAST of Si:ch211-194c3.5 vs. TrEMBL
Match: A0A504YHG1 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_03916 PE=4 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 4.466e-102
Identity = 318/1261 (25.22%), Postives = 577/1261 (45.76%), Query Frame = 3
Query:  102 VRRPKYERHDIKQHLFSSFLSCQRLHKIQRLINYKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAVV---TKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDL-----RDKF----VSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQ--LKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDRGENLGSVIFADTFVVTSTPVNKEDNLTSVLRLGKKVPLFSYWTNN-NLSKLHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGAIILYPDSV--------------EVVEGE-SYCDWTIFSITCQVSKSKFTNWIW----NKNNEKDV----------LHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINN-----------------QLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYS-LIHRKSCVRVFAQLMVMNY-----SLRYYDN---VDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINENKNLRILLIAPPLSFPSEIVRRLKAVASRIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSN--------SIKTTTLHRILRARNELCTIYLTPKADVTKE--LDTILSKVAFQQERFDLARLLY--NLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTK--QLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAF 3632
            +R  ++ RHDI Q  FSSFLS  RL   + L++  K D  LII+GID +FN GS    +YL FD+F TR  D+ +SK D D F+D+++C+   + H+YCN ANY +LLPY++ WP LR+HC++E +M + +  E+ K+  F+ +T+ C +IA+V     G+I     F  M++E WP++QS+A+D     +   S + FFTL  +VI+++ DV  +   +DPV +E +  + L    G +E +++L+D+   ++N      + E  + +Y                 NP ++   ++R ++     GK +  +  L     R  F     S   H I++  +L  G+V  RT F Q  S V+  S+E+  +     KL   Y  ++ T    +  ++ SK++ ++ +  K+Q  LK S+ +        ++      +     L ++   ++D+++ED    LGSV+ ADT ++++  +N+      V+ L   V     W  + NL K  Q I    E + L  E  D+++T  +    T       +  D +++  K+VG   + P  V              +VV  E S     + +   Q++ ++ +N       N + + DV          L ++    S+ ++     V P W+    +  T  +  P + +    +   +  +                 Q S+S+  +Q + +    ++H+S L  +  S   S  I    CV  +A    + Y     SL+  D+   +  L  + E +    ES +  W        ++    +    + + +SS V+TVICG  GS ++ L + +++++ +D  W+ + P ++ D+  +  + L ++   +      I      L+  +++    +  A+   I IG +  C++   A +DN  YT PG+L++  EGW N +I TGP  +         ++   + R+LR+ N   +    P  D      L+ +L + AF+Q     ARLL   NL        ++NF   + RF         PL +    R+ + +F  L   PF  NIY + G +    +  +L+ +   +LT   ++ +  LP  E + D  R  +   T           +  N +++     E F + +R    Q    K  +   D+T+  + +IH++ HL  LP GW+Y G  YV+M+G +S +HP +  FI +++  +N +I   N+ +    V D F
Sbjct:    2 LRNLQFTRHDIPQTQFSSFLSLHRLKNFRDLMHQHKCDAFLIILGIDSKFNCGSTLAISYLLFDLFETREADMNQSKFDTDTFEDLIICVRYTDTHIYCNAANYRILLPYISHWPNLRIHCVNETDMANLDTYEERKMSIFSCLTQDCKRIAIVYLDQHGNIP--STFTKMLIEDWPVVQSFAFD-----TARQSAREFFTLSREVINLARDVQQLTTRLDPVFIETVLLRTLLTFTGSLETVYRLVDAYVESENRSNKVKLLEPLMSAY----------------QNPNSVDKGDSRLALPYFLFGKDASKQNILSKSIERKYFENLESSEASHAIVRGCTLTHGLVCERTCFFQ--SPVSPDSEEVSRS-QHTSKLIEIYTRLLKTLWQFVDDVR-SKSLPIETILQKSQEALKISMKQYNCEGTELKLHYPQSNSLQSVCLAVLSGAIYDVIDED-STPLGSVVVADTIIISTIQINRTLISRKVINLTDSVAHVCLWLRSPNLFKPGQIIGN--EKQILCDEPMDLVITPMNIPGLTTANF--AWSNDSIVIHGKRVGITCVTPSKVFYYRPIDTERPEILQVVLSEYSKSPDNLIASPIQLALTESSNCPQENTDNGDEQMDVTTLRMKLCSSLWVLLKPKSRTKRLFMDKVAPIWRSRGVLIQTETLPPPEI-MRASLVATILTRDGLSDLSSFSSDKSVYLRQFSISQLVTQQMSNEAWLEIHRSDLQHIEASCCLSNTIPTVHCVAQYATCCGLTYPSYQPSLKMADDSQWISVLGDVIEYNMADHES-RSAWTGKVLK--SEESKEEEGSPSSDSRSSFVITVICGPIGSRKDMLMQNLVRMVKEDTRWIEMRPSNVNDLGSSLLSGLDEWVKCDSTNTEGICGAREVLAVLAKMHTSDEQSATLSSIRIGCVVTCVDIRCAIMDNGRYTFPGVLELIAEGWTNYLIQTGPPKSKQVAATKWGVQMEEVERLLRSVNPRLSQLSAPDGDTGHGHVLEALLDEDAFEQPAMQRARLLSYPNLIVSPCEPRLQNF---TLRFAR-------PLDRARFTRSLKTLFNTLKPWPFHGNIYSVHGQVAFINENHKLFEVYHNTLTGITRISLVSLPTSEAKSDERRPYWLMGTL---------AVSQNKAKENETTMELFASWIRQSGPQQEGLKPLLRRCDLTSDDLAKIHDKYHLNPLPPGWYYTGAYYVNMNGDKSFQHPDMEEFITEYLEGENNKIVARNARISRHPVPDLF 1207          
BLAST of Si:ch211-194c3.5 vs. TrEMBL
Match: A0A4S2LW31 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004459 PE=4 SV=1)

HSP 1 Score: 342.813 bits (878), Expect = 4.591e-95
Identity = 316/1299 (24.33%), Postives = 578/1299 (44.50%), Query Frame = 3
Query:   87 MPLTKVRRPKYERHDIKQHLFSSFLSCQRLHKIQRLINYKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDLRD-KFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVA----------KPSKEMDDTCADVM-KLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNED-RGENLGSVIFADTFVVTSTPVNKEDNLTSVLRLGKKVPLFSYWTNNNLS-KLHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVG------AIILY--------PDSVE-VVEGESY--CDWTIFSITCQV---------------SKSKFTNWIWNKNNEKDV-LHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGIS------EDVHQSQLIKVHNSMNYSLIHRKSCVRVFAQLMVMNYSLRYYDNVDYLETIFESHKEIFESC-------------QQNWLCHSFMDYTKFMNVKNQ-------LSNINEQSSIV----------------VTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENI----NENK-NLRILLIAPPLSFPSEIVRRLKAVASR-------IPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSN--------SIKTTTLHRILRARNELCTIYLTPKADVTKE--LDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISD--LKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            MPLT + +PK +  +     FS ++S  RL+ ++ L+++ + D L+++ G+D RF+ G+ ++  +L FD+F T      RSK + D+F+D ++CI  +EVH+YCN  N+ LLLP+   WP LR+HC SE +M + +  E +KI  F  + + C ++ V  +       +E F  M++E WPIIQSYAYD     ++H   + FFTL   +IDI  ++  +   IDPV+LE    + L    G  E++++L DS   +  L    +   EP+ S + H      L+       P  L G+++ +  L+     + + E  L D + +    HM+I+     +GIV  RT F+Q  +N +          K  +++     D++ K + A+N   S  D  +SK             A+N+LK  L    +      +            L ++   V+DI  ED  G ++GSV+ ADT ++++  +N       V+ L   +P    WT N +   + Q  +   + +P+  E  DIIL   +   +    + CT F D V++  K++G      + +LY        P+ +E V+   SY   D+   ++ C +               +K + T  + N+N+  ++ + L+    +K ++     V P W+    +  +  +       N + I+   I   LS   HS  S +  +S      +   Q+ L     S+N  +  + S     A LM+    LR+ +    L+T  E     ++                 N  C   +      N +++        S  N +SS+                 +TV+CG  GS ++ + + ++ ++ +D  W+ ++P +  D++ A E  +K+++++     E++  +R +L+ P      +++  +  ++S          + IG +  C++  A ++D    T PGLL+M +EGW N I+ TGP  +         +K   +  +L + N   +    P+  V +   L+ +L + AF       ARLL +     T  G      ++ RF         P+ +       + +F NL   PF  N+Y I G I    +P +++ +  ++L     I  +    +  D+         +    + A     P  + K SD  L   F   LR    Q    +  +  SD++   +++IH + HL  LP GW+Y G  YV+M+G +S +HP+  AF+ +++  +N +I   N+ +    + D F++
Sbjct:    1 MPLTHLLKPKEKHKEYVSVHFSPYISAYRLNSLRALMHHHQCDALVVVPGVDSRFSTGASQVTAFLLFDLFETHNPHFIRSKFEMDVFEDFIICIKQNEVHLYCNAVNHTLLLPFTTHWPNLRVHCASESKMSNVDEYENYKITVFQMLVKDCKRLVVPCLDMCGAMGSEKFTKMMIEEWPIIQSYAYD-----TEHQCSREFFTLSRDIIDIPHELRLLVNRIDPVYLETTLVRALLSFMGTFESVYRLFDSLVESKQLSSRANP-NEPLFSVYQHSAEIHGLLP------PYLLYGSDSSKQNLV-----AENIESKLSDLQMMVESDHMVIRGYDQPSGIVCERTNFIQQPNNASHLTDHKVRSEKKLRQIYSKLLDILWKATEAFNFADSDIDQTVSK-------------AQNELKCHLQSESFGSLEINLTYPWKNPTDAVTLAVLSGAVYDI--EDIGGSSMGSVVAADTLLISTLRLNDICLSRKVINLTATIPPTCLWTRNPMPIDMTQFTS---DKKPIFNEQLDIILAPANTPSSIT--VNCTCFEDYVIISGKRIGISQVNLSNVLYYRPVDMEQPELLEFVLPPSSYNTSDFLTSALKCCILNGSIDEALEKFQKPTKFRETETLRNENSSSNMSIWLMLKPKTKAKRLFLEQVAPVWRAKGLLRQSDHLP------NRQAIRAAFITTVLSRDTHSILSDLRSLSFSQLKFDSATQAGLY----SLNQLMTEQPSAK---AWLMIHQSELRHIEASWSLDTSVEGISSAYDYALCCGIHLKSSNVPPSNSACADEILSVLLRNSEDKDISLLWTHSATNNESSLTETQDNICREMRPKPLHITVVCGTVGSRKDNVVKNVVDLVKEDTHWIQMSPATPSDISSALETAVKEYDSLLGSATESRVRIRGILLCPGTCGARDVLNAVHRLSSNESTKQLVHSVRIGCVVTCVDTRAVFIDGGRMTFPGLLEMLSEGWTNYILSTGPPKSQQVAATKFGVKMEDVEALLHSVNPKLSQLPAPEGHVERGHVLEALLDEEAFNGPGLKRARLL-SYPSLNTTLGNPRMHAVTLRFAR-------PVERVRFTNHLKAIFANLKPWPFYGNLYSITGQIGFTGEPDKIFDVLHLTLNG---ISRISVNTDDSDFLPKRKANKPFWLTGILAA----PPAASKESDEWLANQFANWLRKSAPQQEAIRPPLRLSDLSKADLEKIHEKYHLHPLPAGWYYTGSYYVNMNGDKSFQHPNFEAFVQEYLEGENTKIAARNARIVNHPIPDLFSE 1234          
BLAST of Si:ch211-194c3.5 vs. TrEMBL
Match: A0A4V3SFE3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004459 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 2.787e-90
Identity = 308/1275 (24.16%), Postives = 564/1275 (44.24%), Query Frame = 3
Query:  159 LSCQRLHKIQRLINYKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDLRD-KFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVA----------KPSKEMDDTCADVM-KLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNED-RGENLGSVIFADTFVVTSTPVNKEDNLTSVLRLGKKVPLFSYWTNNNLS-KLHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVG------AIILY--------PDSVE-VVEGESY--CDWTIFSITCQV---------------SKSKFTNWIWNKNNEKDV-LHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGIS------EDVHQSQLIKVHNSMNYSLIHRKSCVRVFAQLMVMNYSLRYYDNVDYLETIFESHKEIFESC-------------QQNWLCHSFMDYTKFMNVKNQ-------LSNINEQSSIV----------------VTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENI----NENK-NLRILLIAPPLSFPSEIVRRLKAVASR-------IPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSN--------SIKTTTLHRILRARNELCTIYLTPKADVTKE--LDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISD--LKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
             S  RL+ ++ L+++ + D L+++ G+D RF+ G+ ++  +L FD+F T      RSK + D+F+D ++CI  +EVH+YCN  N+ LLLP+   WP LR+HC SE +M + +  E +KI  F  + + C ++ V  +       +E F  M++E WPIIQSYAYD     ++H   + FFTL   +IDI  ++  +   IDPV+LE    + L    G  E++++L DS   +  L    +   EP+ S + H      L+       P  L G+++ +  L+     + + E  L D + +    HM+I+     +GIV  RT F+Q  +N +          K  +++     D++ K + A+N   S  D  +SK             A+N+LK  L    +      +            L ++   V+DI  ED  G ++GSV+ ADT ++++  +N       V+ L   +P    WT N +   + Q  +   + +P+  E  DIIL   +   +    + CT F D V++  K++G      + +LY        P+ +E V+   SY   D+   ++ C +               +K + T  + N+N+  ++ + L+    +K ++     V P W+    +  +  +       N + I+   I   LS   HS  S +  +S      +   Q+ L     S+N  +  + S     A LM+    LR+ +    L+T  E     ++                 N  C   +      N +++        S  N +SS+                 +TV+CG  GS ++ + + ++ ++ +D  W+ ++P +  D++ A E  +K+++++     E++  +R +L+ P      +++  +  ++S          + IG +  C++  A ++D    T PGLL+M +EGW N I+ TGP  +         +K   +  +L + N   +    P+  V +   L+ +L + AF       ARLL +     T  G      ++ RF         P+ +       + +F NL   PF  N+Y I G I    +P +++ +  ++L     I  +    +  D+         +    + A     P  + K SD  L   F   LR    Q    +  +  SD++   +++IH + HL  LP GW+Y G  YV+M+G +S +HP+  AF+ +++  +N +I   N+ +    + D F++
Sbjct:    7 FSAYRLNSLRALMHHHQCDALVVVPGVDSRFSTGASQVTAFLLFDLFETHNPHFIRSKFEMDVFEDFIICIKQNEVHLYCNAVNHTLLLPFTTHWPNLRVHCASESKMSNVDEYENYKITVFQMLVKDCKRLVVPCLDMCGAMGSEKFTKMMIEEWPIIQSYAYD-----TEHQCSREFFTLSRDIIDIPHELRLLVNRIDPVYLETTLVRALLSFMGTFESVYRLFDSLVESKQLSSRANP-NEPLFSVYQHSAEIHGLLP------PYLLYGSDSSKQNLV-----AENIESKLSDLQMMVESDHMVIRGYDQPSGIVCERTNFIQQPNNASHLTDHKVRSEKKLRQIYSKLLDILWKATEAFNFADSDIDQTVSK-------------AQNELKCHLQSESFGSLEINLTYPWKNPTDAVTLAVLSGAVYDI--EDIGGSSMGSVVAADTLLISTLRLNDICLSRKVINLTATIPPTCLWTRNPMPIDMTQFTS---DKKPIFNEQLDIILAPANTPSSIT--VNCTCFEDYVIISGKRIGISQVNLSNVLYYRPVDMEQPELLEFVLPPSSYNTSDFLTSALKCCILNGSIDEALEKFQKPTKFRETETLRNENSSSNMSIWLMLKPKTKAKRLFLEQVAPVWRAKGLLRQSDHLP------NRQAIRAAFITTVLSRDTHSILSDLRSLSFSQLKFDSATQAGLY----SLNQLMTEQPSAK---AWLMIHQSELRHIEASWSLDTSVEGISSAYDYALCCGIHLKSSNVPPSNSACADEILSVLLRNSEDKDISLLWTHSATNNESSLTETQDNICREMRPKPLHITVVCGTVGSRKDNVVKNVVDLVKEDTHWIQMSPATPSDISSALETAVKEYDSLLGSATESRVRIRGILLCPGTCGARDVLNAVHRLSSNESTKQLVHSVRIGCVVTCVDTRAVFIDGGRMTFPGLLEMLSEGWTNYILSTGPPKSQQVAATKFGVKMEDVEALLHSVNPKLSQLPAPEGHVERGHVLEALLDEEAFNGPGLKRARLL-SYPSLNTTLGNPRMHAVTLRFAR-------PVERVRFTNHLKAIFANLKPWPFYGNLYSITGQIGFTGEPDKIFDVLHLTLNG---ISRISVNTDDSDFLPKRKANKPFWLTGILAA----PPAASKESDEWLANQFANWLRKSAPQQEAIRPPLRLSDLSKADLEKIHEKYHLHPLPAGWYYTGSYYVNMNGDKSFQHPNFEAFVQEYLEGENTKIAARNARIVNHPIPDLFSE 1216          
BLAST of Si:ch211-194c3.5 vs. TrEMBL
Match: A0A1S3K925 (uncharacterized protein C20orf194-like OS=Lingula unguis OX=7574 GN=LOC106179872 PE=4 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 1.845e-83
Identity = 322/1227 (26.24%), Postives = 542/1227 (44.17%), Query Frame = 3
Query:   87 MPLTKVRRPKYERHDIKQHLFSSFLSCQRLHKIQRLINYKKXXXXXX------XXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCL-SEIEMEDSEILEQFKIDTFAEMTRFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNT-RQSVLMTRLG--KSSDSEGDLRDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKL-KSSKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDRGENLGSVIFADTFVVTSTP-VNKEDNL--TSVLRLGKKVPLFSYW------TNNNLSKLHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGAIILYPD---SVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINN-QLSVSEHSSQSIIDGISEDVHQSQ-LIKVHNSMNYSLIHRKSCV-RVFAQLMVMNYSLRYYDNVDYLE-TIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPGSGQE-FLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINENKNLRILLIAPPLSFPSEIVRRLKAVAS------RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGP-DSNSIKTTTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLL----YNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLII----FPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAF 3632
            M   + +RP   R +IKQ  FSSF+S  RL  +Q ++                + GID R+N G  EL N+L F  F  R  +++ S   ++  DD+++ +  D VH+YCN  NY   LPY+A W  L+LHCL  E   ED E  E+FKI +F  M + C  I  +   +      FD   +E WP+IQ+YA + FG           FT+ H+V+D+S +V  ++  +DPV +E +  + LP  E   + +   +D +  +   E+ E    EP++SYF+H      + +      P  L G NT ++S+   R G  +SSD+         S   HM+ Q VS    +   RT F Q  S+   P K+  DT      +S  + +     +F I       + +VL E E+   +K              + T+        ++  I S+      E  G+ LGSV FA+ F+ ++ P VNK  +   + VL L   +P    W      T + +S +    N       +  +MA +   +     ++ ++     F   ++  + ++GA++L  D   S+E  +G+S     +  +  + S S F        N++  L  + +  +K  K+  + V+P W++  ++    K+ + +  +     Q  M N+ QL  +  SS   +  +   +   Q L +  + +  S + R     +  + L+   Y    +D+ D L  TI      I  S ++N LC + ++  K                            GQ+ F+ R+ +  I D FD     P  +Q    +   ++K  +   ++K L ILL+ P     ++IV  + A+ S      +  + IG +T C++P   Y+++R YT P LLD C EGWVN ++ T   D  +       +++RA N      L  K +VT+  +LD ILS+ AF +     AR L    ++  Q  +   V     +  RF +       PL +   +   +E+ K+        N+YF+ G++    D   L  +  V+L+  L+I       P     G     +  +   +   +  EE       EK+ D        +R   +Q P KK  ++ + +T  ++ +IH E HLEALP GWFYNG  +V + G +SD HP++  FIA++I   N EI+  N+ +D M + D F
Sbjct:    1 MSSRRPKRPSSARRNIKQETFSSFVSSSRLRHVQSILKGGSRAHASSPDAILCVTGIDSRYNDGCTELVNHLLFGFFENRRKELESSGFAEETIDDLLILVKHDSVHIYCNPVNYLYFLPYIAHWRNLKLHCLHPEKYDEDEEEAEEFKIHSFIAMVKDCKTIG-IPYSTWAHPLPFDKFSIEKWPVIQAYALEGFGGGGF-------FTMKHEVVDVSKEVAELYSIMDPVSVEMLATEHLPLFERQWKTMLTTVDVEGKSGIAELTERKVCEPLRSYFSHGLVG-AIKTDSFARYPFVLFGKNTNKKSLEAVRKGAVQSSDTIPS------SEASHMVCQAVSPKGPLSCVRTYFFQ-ASHKPYPVKKRCDTSDTA--VSATFISQRGNFEFSIEAYDHHGRPVVLKEGESSPLIK--------------LATV--------YIYNIPSI------EHNGQTLGSVGFAEAFLESTIPVVNKAGSSLDSQVLFLTSHIPRQHTWQYTGQLTPDIISMIGGGDNGSLGRTLVPGDMAQVFANN---GVSSPEEGHLHIFEQGIVFIHNQLGAVVLPKDKVISLEFFDGDSPSVVALLIVMYKPSLSPFLPAHLQGKNQQ--LVFVLTPKTKAYKAFFAEVLPLWRQEDQVP-PMKLLAGDAQLPEDLAQ--MHNHLQLKYTVESSHGTVTPLKHAMASLQDLDRFLDHLKVSSVGRVPVASKDLSILLNQPYDAGGFDDDDQLTVTIITG---IPGSYKRN-LCTTLVNMAK---------------------------DGQKWFVLRRPVDNI-DTFD-----PKGLQ---VSLSQLIKASKRKKQSKKLHILLVTPGF---TDIVDVITAIGSSEDPDIQRHLKIGAVTACVDPMNMYMEDR-YTFPKLLDQCAEGWVNNVLFTSNLDLKNPFLEEAQKLIRAANPEVGFILADKGEVTRSTDLDLILSETAFMENAAKRARHLSCPGWSCGQFSSGAVVPPLTDLRLRFTQ-------PLERPKFLGRLKELKKHFNKTSKAGNVYFVRGLLRF-SDSATLLDVEYVTLSGVLVINNAEMQTPPPSANGPAGSENGHEYCLVFTGLDLEE-------EKLKDW-------MRTCAKQKPAKKSHVSQATLTKNEVAKIHKEHHLEALPPGWFYNGSHFVSLAGDKSDTHPNMDEFIANYIKQTNEEIDKYNAKIDAMNIKDLF 1107          
BLAST of Si:ch211-194c3.5 vs. TrEMBL
Match: A0A1S3WWY1 (uncharacterized protein C20orf194 homolog isoform X2 OS=Erinaceus europaeus OX=9365 GN=LOC103128651 PE=4 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 7.497e-80
Identity = 303/1242 (24.40%), Postives = 553/1242 (44.52%), Query Frame = 3
Query:  159 LSCQRLHKIQRLINYKKXXXXXXXX---XXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAV--VTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDL------RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNV------AKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSLNK---MRY-----SDCSFRIITIG--------DTNNSQGFLMIIQSVVFDIVNEDRGE-NLGSVIFADTFVVTSTPVNKEDNL----TSVLRLGKKVPLFSYW-TNNNLSKLHQTINEIYE-----LEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGAIILYPDSVEVV---EGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGISEDVHQ--SQLIKVHNSMNYSLIHRKSCVRVF-AQLMVMNYSLRYYD-NVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNIN-----EQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDF--ENINENKNL------------RILLIAPPLSFPSEIVRRLKAVAS---RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKT--TTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIF-----PLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAFAK 3638
            +SC RL ++Q ++          I+   GID R+N G  EL NYL F +++  T D +++   +++ DDV++ I  D VH+YCN  NY  LLPY+A W  L  HC++E E ED E  E+FKI +F +MTR C +I +   ++G +   + FD  VVE WPI+Q++A +  G         GFFT+ +++ D+S ++  ++ ++DP+ LE++  + L   E    + F   D++     LE+ E    EP +SYF+H   +  +        P  L G ++ Q  L      +  SEG L      R  F    KHM++QCVS    +  +RT F  G +++      + P K+ +      M LS  Y A++ +    I+    + ++   +  A+  L  SL+    M++     S  +F+I  +         D+ +S  F+      ++DI +   G+ NLGSV+F+++F+ +   V +++      TS + L   +P F  W   +N  KL +   ++ +     L    TE     L     Q +  Q+    FF + +L  +   G+II+  D +  V   +G+S     + ++  +   S   +   + +     L +     SK+ ++  S V   W++             N  ++ K IQ                   DG+S +  +  S   K+ +++N+S + + S +++  A+L  +++ L+++  +    E +  +H                      ++V  Q + IN     E   ++++++ GLPG     L   ++ +  +   W++   I +    C      + +    +   KNL            R+L++    +   ++V+ L+       +    IG +TVC+ P + Y+++R +  P  LD C++G VN ++ T   +         +  ++RA N      L     VT+  ++D ILS+ +F   +   +R L     ++  F   +   +     +I      PL +   I   + +  ++  +PF  NIY I G +    D +R   +   +LT  L I      P+P  ++R     +S  Q +Y+ +++              S  +ES    LR   +Q P +K   T   +T Q++  IH +RHL+ LP G+FYNG  +V+  G ++D HP +  F+ D++   N EIE  N  L+     D F +
Sbjct:   27 VSCSRLRQVQNILTQSSKSHPDGILCILGIDSRYNEGCRELANYLLFGLYNQNTGDFEKTGFSEEVLDDVIILIKSDSVHLYCNPVNYRYLLPYVAHWRNLHFHCMTENEYEDEEAAEEFKISSFVDMTRDCSRIGIPYSSQGHL---QIFDMFVVEKWPIVQAFALEGIGG-------DGFFTMKYELQDVSLNLWNVYSKMDPMSLESLLSEDLVTFEHQWSSFFANFDTE-IPFLLELSESQAGEPFRSYFSHGMISSHITENSPSKQPFVLFGNHSTQENLNAG-NFNFPSEGHLVRNTGPRGSFA---KHMVVQCVSPRGPLACSRTYFF-GATHIPYLGDDSNPPKKTEQ-----MLLSQVYAAVIESVLAGIACYAKTSSLTKAKETAEQTLGSSLDSFELMQFKAALRSKMTFQIQAVNNHGRIMSLDSEDSLYFVKTASMTIYDIPDFLGGKGNLGSVVFSESFLTSRILVKEKNGTVTTETSFIVLTAAIPRFCSWLVEDNEVKLSEKTQQVVKGDECFLGTFLTEGEGAYLYSSDPQ-SWPQEGKVHFFSNGLLFSHHHHGSIIISKDHMNFVSFYDGDSTS--VVAALVIEYKSSLLPHLPVHFHGSNHFLMIALFPKSKIYQAFYSKVFSPWQQQA-----------NSGLSLKVIQE------------------DGLSVEQKRLHSSAQKLFSALNHSAVEKWSPLKLLSAKLPELDWFLQHFAVSSISQEPVMRNH----------------------LSVVLQQTEINPTHRVENDKVIISIVTGLPGCHASALCAFLVTLHKEYGRWMVYRQI-MDSSECFHAAHFQRYLSSALEAQKNLSARQSAYIRKKTRLLVVLQGYTDVIDVVQALQTHPDSNVKSSFTIGAVTVCVEPSSCYMEHR-FLFPKCLDQCSQGLVNNVVFTSHTTEQRHPLLVQVQSLIRAANPAAAFILAENGIVTRNEDIDLILSENSFSSPQMLQSRYLLYPGWYEGKFDAGS---VLPLMVQICVWFGRPLERTRFIAKCKAIQSSIKPSPFCGNIYHILGKVKF-SDSERTMEVCHNTLTNSLSIMPVLEGPMPPPDSRSTTQDSSGQQESYL-VFIGC------------SLKEESIKDWLRQSAKQKPQRKALKTRGMLTQQEIRNIHVKRHLDPLPAGYFYNGTQFVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNRELEQQEYHDLFEQ 1174          
BLAST of Si:ch211-194c3.5 vs. Ensembl Cavefish
Match: si:ch211-194c3.5 (si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-63])

HSP 1 Score: 235.728 bits (600), Expect = 4.963e-63
Identity = 287/1205 (23.82%), Postives = 530/1205 (43.98%), Query Frame = 3
Query:  165 CQRLHKIQRLI--NYKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNH--LKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDLRD--KFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVST--ADFVISKLKSSKNIVLDEVEAKNQLKY-SLNKMRYSDC-SFRIITIGDTNN----------SQGFLMIIQSVVFDIVN-EDRGENLGSVIFADTFVVTSTPVNKEDNLTS---VLRLGKKVPLFSYWTNNNLSKLHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCT------FFPDRVLLFNKKVGAIIL---YPDSVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYSLIHRKSCVR-VFAQLMVMNYSLRYYDNVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCA--TENILKDF-ENINENK--NLRILLIAPPLSFPSEIVRRLKAVAS------RIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKTTTLH--RILRARNELCTIYLTPKADVTKE-LDTILSKVAFQQERFDLAR-LLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAF 3632
            C RL K+Q L+  +       ++   ID R+N G  EL +YLFF ++    + I     ++ +  DV++ I  + VH+YCN  NY  LLPY++ W  L LHC++E E ED E  E+FKI +F  M   C  I +    S +  + FD  ++E WPIIQ++A +  G         GFFT+ +K++D+S  +   +  +DPV L+ +  + L   E     +F  +D ++    LE+ E    EP ++Y++H  + SN   I+      P  L G ++ +  L             +R+      + KHM++QCV+    +  ART F  G ++V   +        +++ LS  Y+A +    A      + SS +   D  E   QL   +   ++Y +  S  + +I   NN          S+  +     VV+DI + +  G NLGSV+F+++F+ +S  +     L++      L   VP    W  +  S +  +   ++ L+        + LT +         L  T      FF + +L  + + G I L   + ++++V  G+S     +  I  +   S   +  +  ++    L +     +K  KS  S V+  W               N  ++  ++Q+ +  +QLS+ + +              S+L+K+H+  + S  + ++ +R  + +L            +D+L+     H  +  S  +  +C   +    F N   + +    +  +V+++I GLPGS +E L   +++ ++ +  W +  P    +  C    +  L     N++E      R+LL+ P     ++++  L+A+ S      +  +++G +T C+NP  +++++  +  P LL+ C    VN ++ TG  +        H  +++ + N      L  +  VT E +  ILS  +F   +   AR LLY   + +   G  +   +S+ + +   P+   L  +       ++  +L  +P+  NIY I G +    +  RL  ++  S++  + + P     ++        T + Y+ IY              +   +E     LR   +Q   KK K T   +T Q++  IH +RHL+ LP G+FYNG  +V   G + + HP +  FI +++   N E+E  N  +DL   TD F
Sbjct:    1 CSRLRKVQALLKDDGSTAPDGILCSLIDSRYNQGCSELASYLFFGLYKHNQEQIPEDFPEEVL--DVIILIKAESVHLYCNPVNYSYLLPYVSHWRNLHLHCMNETEYEDEEAAEEFKISSFVSMVEDCTCIGI--PYSSQHAQKFDVFMLEKWPIIQAFALEGIGA-------GGFFTMKYKLVDVSEQLWQTYTRLDPVSLDCLLSEDLLTFERQWSCLFSSMDIETPLSMLELSEAQTAEPFRTYYSHGLISSN---ITDNKSRQPFVLFGNHSAKEDLDNYCFTFPSEGHQVRNTGPHGGSAKHMLLQCVAPKGPLACARTYFF-GSTHVPYLNDNTQQKKTELL-LSQIYSATIQAVLAGIKCFSINSSSSKAKDVAEQTFQLALDAFGLLQYRNALSKAVFSIQAVNNEGVIPLSDERSRFLIKTASMVVYDIPDLQWGGSNLGSVVFSESFLESSIYIQNSGALSTDSCFTVLTSSVPRHMCWLVDE-SDVRLSEQALHLLKEENGTCLGVPLTTKDSAHVYSNSLLSTPEEKLVFFSEGLLFVHARYGTITLSKNHINTIKVYNGDSISATAVLFI--EYESSLLPHLPFPLHSADRCLAITLMPRTKGYKSFYSQVLQIW---------------NKPVSGLWVQH-VDQDQLSLDQKN-------------YSRLLKLHDPHSSSPSNPRAALRSAYPEL----------PELDFLK-----HFTVSSSVCEESVCSDHLA-ALFPNAHPKPTPSESERKVVLSIISGLPGSFKESLCDFLVE-VNQECGWEVYYPDQDAEDLCVLHLQRYLSSLVSNLSETHFNTPRVLLLTP----YTDVLDVLQAIVSHPDRKVQSRVSVGAVTACVNPLHSFMEH--FLFPKLLEQCA---VNNVVFTGLTTEQKHPLLKHMQQLIHSANPNAAFILAERGAVTTEDMRLILSDSSFSHPQMIRARYLLYPGWEGRFVSGCGSVS-MSQHYLQFSRPLERALFLQRC-----KLKSSLRGSPYTGNIYHISGKVLFSSN--RLMEVSCNSVSGSVTVAP-----DQWSTHSPKTTHTCYLLIY-------------GVGFSQEGLKEWLRQCTKQKEPKKAKKTKRTLTPQEIRSIHVKRHLDPLPSGYFYNGYQFVSFYGEKLNFHP-MDQFIEEYLQEVNKEVECFNREVDLYAHTDLF 1104          
BLAST of Si:ch211-194c3.5 vs. Ensembl Sea Lamprey
Match: si:ch211-194c3.5 (si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-63])

HSP 1 Score: 271.166 bits (692), Expect = 4.578e-75
Identity = 306/1231 (24.86%), Postives = 534/1231 (43.38%), Query Frame = 3
Query:  165 CQRLHKIQRLI---NYKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNH-LKSNKTLISQCMQMNPLALSGTNT-RQSVLMTRLGKSSDSEGDL---RDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTC-ADVMK-LSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQL-----KYSLNKMR---YSDCSFRIITIG--------DTNNSQGFLMIIQSVVFDI--VNEDRGENLGSVIFADTFVVTSTPVNKEDNLTSV----LRLGKKVPLFSYWTNNN----LSKLHQTINEIYELEPLATEMADIILTDRHFQE--TTVQQLCCTFFPDRVLLFNKKVGAIIL---YPDSVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYSL-IHRKSCVRVFAQLMVMNYSLRYYDNVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINEN-------------KNLRILLIAPPLSFPSEIVRRLK-----AVASRIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGP--DSNSIKTTTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHF----GVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLT-KQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEET-IHPNDSEKI----SDLKESFLA-VLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSLPAFIADFINAKNLEIETNNSLLDLMTVTDAF 3632
            C RL ++QR++   +  K D LL I+GID R+N G  EL NYL F  ++    ++ R    +++ DDV++ +  + VH+YCN  NY  L+PY+A W  L++HC++ +E ED E  E+FKI +F  M + C  + V         + FD  V+E WP+IQ++A +            GFFT+ H+++D+S D+  ++  +DPV LE++  + L   E   +  F   D +S    L++ E    EP +SYFNH + S+        +  PL L G  T RQ +       S  SE  L        S+ +HMIIQC +    +  ART F  G S+     +E D +    ++K LS  Y + V      I     + +    +   +        KY L+K +    S  SF I  +         D +  +  +     +V+DI  + E R   LGSV F+++F+ +  PV   D   SV      L   +P ++ W        LS+  Q I +      L   +A   L   H     +  ++   T     +L  ++K G++IL   +  +++  +G+S C   +  +  +  +S      ++ +     L       S   K+    V+  W+           ++    +  K I      +Q  +SEH+  S+    S  +     I   N + + + +  ++C   F Q  + ++ +        ++ I  SH ++  +  +N               +NQ +N + +  +V+T+I GLPGS +E L   ++ +  +   W ++   +        E + +    + ++             K LRIL++ P  +   ++V+ ++      V S     IG IT C+NP AA +++   T P LL+ C +GW + ++LTGP  +    +   L  ++R  N    +      +V++  +++ ILS+ +F       AR L         F         ++IS RF         PL K   I   + +   L+ +PF  NIY I+G +   + PK +  ++ V+L    L +                 +         +A+ T +HP     +      L+E  L   LR   +QI   K   T   +T +++  IH  RHL+ LP G+FYNG+ +++  G +S++HP +  FI + +   N EI   N+ L  +   D F
Sbjct:    1 CSRLRQVQRILLGGSDSKPDALLCILGIDSRYNEGCSELANYLLFGFYAQDHSELDRKSFPEEVLDDVIILVKPESVHLYCNPVNYPHLVPYVARWRNLQIHCMTAMEYEDEEAGEEFKITSFVNMVQDCKTVGVPYSAQ-GHPQKFDMFVMEKWPMIQAFALEG-------LGGGGFFTMKHELVDLSEDLWEVYSRLDPVSLESLITEELVLFEWQWKTFFSNFDIESPASILDLSEAQVGEPFRSYFNHGMLSSHIPSKTSSRRQPLVLFGIRTGRQGMEEEDNNFSFPSESHLLRNTGPAASHARHMIIQCSNPKGPLSCARTYFF-GSSHTPYMGREKDLSLNTKILKVLSGVYASGVEAVLAGIVHYTETGDAFTTKATVEQLFFSCLDKYDLSKYKSTLRSALSFTIQPVNLQGRVCSMDEDACRFHVKTASLLVYDIPDLEEGRFSILGSVAFSESFLDSRVPVQAADGSLSVDGKCAILTANIPRYTSWLVEEAGVILSEKAQEIIKGDGCGLLGKRIAGPDLAYIHCSSPFSNPEEGKLTLLSSGILFVHRKYGSVILPMSHMTAIKFYDGDS-CS-VVAMVVIEYKRSLLPFLPFHLSGSTFSLAFGLMPKSTAYKTFYREVLSSWRN----------RAEEFGVALKMI------SQQELSEHAQLSL---TSITIVFFASITAPNDLVWKVNLVAQAC--AFVQRFLKHFEVSSV----LMDPILSSHFKLLINPLEN---------------ENQ-ANEDLRGKMVITIITGLPGSHRERLCATLVNLSKEHDRWAVLHNATESGAELNAEALQRYLSGVLQSHLYRSPRHALITRKKLRILMLTPGFADVVDVVQAIRTHPDPTVGSH--FVIGAITACVNPLAACMEH-SLTFPKLLEQCAQGWASNVVLTGPNHEKQHPRVKQLKELIRLVNPSAALIQAENGNVSRNEDIEMILSENSFNDAAMVRARHLLTPGWASGMFSSGAACPAMQQISVRFNR-------PLEKPLFIGQCKALKGMLSSSPFCGNIYSIQGRLKFSDSPK-VVEVSHVTLANNSLTLTATREGPVPRPPPAPRGSGGLVGGDGQSADGTGMHPEGRYHLVFTGCGLREECLKDWLRRSAKQITKNKTIKTKESLTQKELMSIHATRHLDPLPPGYFYNGMQFINFFGEKSNQHPLMETFIDEHLERLNAEINKYNAQLQRVAHHDLF 1168          
BLAST of Si:ch211-194c3.5 vs. Ensembl Nematostella
Match: EDO40349 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7K5])

HSP 1 Score: 175.637 bits (444), Expect = 1.780e-44
Identity = 161/566 (28.45%), Postives = 271/566 (47.88%), Query Frame = 3
Query:   90 PLTKVRRPKYERHDIKQHLFSSFLSCQRLHKIQRLINYKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLD--SKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNT-RQSVLMTRLGKSSDSEGDLRDKFV--SNPKHMIIQCVSLHTGIVIARTIFLQGC---SNVAKPSKEM--DDTCADVMKLSTAYNAIVSTADFVI-----SKLKSS-----------KNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVN-EDRGENLGSVIFADTF----VVTSTPVNKE---DNLTSVLR-----LGKKVPLFSYWTNNNLSKLHQTINEIYELEPLATEMAD-IILTDRHF 1667
            P++  ++ KYE       LFS  +SC RL ++Q LI  + +  LL I+GID R+N+G+ +L NYL F   +   D I  SK+ D+I +DV+V +  + VHVYCN  NY  LLP +  W  + +HCL+E E +  E  E+FKI +F  M   C  I +      E ++ FDP +VE WP+IQ++A +  G         GFFT+ H++ D+++ +  +F  ID V +E +  + LP  +   + +   +D  S S N   E+ E+   EP+ SYF H + +K   S      P  L G NT R+++ + R   +S+S+  +    +  S  KH +         I  ART F           +PS+ +   D    +     A +A++      +     SK KS+           + I LD       ++ S+     S   F +     T+ +   + ++   ++DI + E  G  LGS+ F +TF    V T  P N +   ++ +SVL      L + +  F+ W N+    + + + E+ + +  + E+ + +I+ D+ F
Sbjct:   13 PISAKKKKKYE-------LFSPPVSCGRLRRVQSLIKSEGLSALLCILGIDSRYNSGTKQLLNYLLFGYCNIAADSIS-SKVTDEILEDVVVLVKLESVHVYCNPLNYPHLLPLIGHWRNIHIHCLAEEEDD-DEKQEEFKILSFVSMVNGCSNIGIPYGKPGEHDKPFDPFLVEKWPLIQAFAIEGLGG-------GGFFTMEHEIKDVTSKMEQLFGMIDLVVVEMLLTERLPLFDHHCKAVLTNIDVESSSSNSFGELTENQVAEPIMSYFTHGQMSKGNSSASDNPRPFVLFGVNTSRKNIQLVRQIHASESKNKIVGSGLRGSKAKHTVCFARDPRGTITSARTYFFANGFVPYTGKEPSRIVFSKDLRLMLDLYLLAIDAVLEGIRIFVKCQDSSKSKSAILSALNGGLGERKISLDPSLFTKNVEISVQAFDLSGSEFDL----QTSMAAPVIKMVCLYIYDIPSIEQPGNKLGSIAFGETFLDSVVRTILPGNIQSFINDSSSVLDCNHLVLTENITRFATWQNDEEKTVSRNLEELVKSKEKSDELGEQLIMGDQGF 558          

HSP 2 Score: 104.76 bits (260), Expect = 1.340e-22
Identity = 95/418 (22.73%), Postives = 185/418 (44.26%), Query Frame = 3
Query: 2379 VTVICGLPGSGQEFLTRKIMKIIHDDFDWLLV-TPISI------QDVTCATENILKDFENIN-----ENKNLRILLIAPPLSFPSEIVRRLKAVASRIP-------IAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGP-DSNSIKTTTLHRILRARNELCTIYLTPKADVTK--ELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCA-PFDKN-IYFIEGIINIEEDP-------KRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPSL 3539
            +T++ G+PGSG++ L   ++ +  ++  W+++ +PIS       + +  +    L     ++       + L+++++ P  +   +IV  + A+A+  P       + IG IT C+NPE  +++NR YT+P LLD C +G+VN I+ T   D+ + + + + +++R  N      L     VT+  +++ ILS+ AF +      R L         F   N   +     EIF   Y PL +       +EM   L  A   ++  ++ I G +   +           L    S SL +   +   P+K  +     +S        ++               +   +S +  LR   +  P K+  ++   ++ +++D+I  +   + LPEGWFY G  YV + G ++ +HP +
Sbjct:  771 LTILTGVPGSGKDELCSTLVALAKENSKWIILKSPISSSQPFDPEGLQASLTTTLTSQRRLHVRLSASRRRLKVIVVTPGFT---DIVDVVMAIANH-PNAEVYSHVKIGAITCCVNPENVFMENR-YTLPKLLDQCAQGFVNNIVFTSCLDAQNEQLSAVQKLIRVCNPQAAFILAKDGKVTRTPDVELILSETAFDEVDSAQRRHLMCPGWTLCDF---NSGGMEPPINEIFIEFYKPLERHRFQSKLKEMKGQLCIAESLERGAVHSIRGHVRFSDHNTISEVHWTSLIGHLSQSLVETNNVPRPPSKPAQNSNQESSKANLAQFLVFT------------GFALKNDSLMDWLRGCIKPTPQKQPLVSKKTLSKKELDDIKGKHKCDTLPEGWFYTGTQYVSLTGEKAYQHPRI 1168          
BLAST of Si:ch211-194c3.5 vs. Planmine SMEST
Match: SMESG000044256.1 (SMESG000044256.1)

HSP 1 Score: 2342 bits (6068), Expect = 0.000e+0
Identity = 1143/1149 (99.48%), Postives = 1146/1149 (99.74%), Query Frame = 3
Query:   87 MPLTKVRRPKYERHDIKQHLFSSFLSCQRLHKIQRLINYKKXXXXXXXXXXXXRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDLRDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDRGENLGSVIFADTFVVTSTPVNKEDNLTSVLRLGKKVPLFSYWTNNNLSKLHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGAIILYPDSVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYSLIHRKSCVRVFAQLMVMNYSLRYYDNVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINENKNLRILLIAPPLSFPSEIVRRLKAVASRIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKTTTLHRILRARNELCTIYLTPKADVTKELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHP 3533
            MPLTKVRRPKYERHDIKQHLFSSFLSCQRLHKIQRLINYKKIDGLLIIIGIDGRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVID+STDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFN NLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDLRDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDRGENLGSVIFADTFVVTSTPVNKEDNLTSVLRLGKKVPLF+YWTNNNLSKLHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGA ILYPDSVE+VEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYSLIHRKSCVRVFAQLMVMNYSLRYYDNVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINENKNLRILLIAPPLSFPSEIVRRLKAV SRIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKTTTLHRILRARNELCTIYLTPKADVTKELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHP
Sbjct:    1 MPLTKVRRPKYERHDIKQHLFSSFLSCQRLHKIQRLINYKKIDGLLIIIGIDGRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEVHVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMTRFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKGFFTLVHKVIDLSTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLDSKSFNGNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTRQSVLMTRLGKSSDSEGDLRDKFVSNPKHMIIQCVSLHTGIVIARTIFLQGCSNVAKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEVEAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDRGENLGSVIFADTFVVTSTPVNKEDNLTSVLRLGKKVPLFNYWTNNNLSKLHQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKKVGATILYPDSVEMVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVLHLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWMINNQLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYSLIHRKSCVRVFAQLMVMNYSLRYYDNVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNVKNQLSNINEQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPISIQDVTCATENILKDFENINENKNLRILLIAPPLSFPSEIVRRLKAVVSRIPIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSIKTTTLHRILRARNELCTIYLTPKADVTKELDTILSKVAFQQERFDLARLLYNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLTCAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDYSRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLKKKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHP 1149          
The following BLAST results are available for this feature:
BLAST of Si:ch211-194c3.5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C20orf1941.028e-7324.35chromosome 20 open reading frame 194 [Source:HGNC ... [more]
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-194c3.54.918e-7223.51si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
si:ch211-194c3.51.846e-2829.85si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
CR788322.32.400e-2829.85pep chromosome:GRCz11:CHR_ALT_CTG13_1_13:13661778:... [more]
CR788322.32.213e-2636.15pep chromosome:GRCz11:CHR_ALT_CTG13_1_13:13661778:... [more]
si:ch211-194c3.54.119e-1640.58si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C20orf1944.816e-5031.58chromosome 20 open reading frame 194 [Source:NCBI ... [more]
C20orf1945.938e-4932.86chromosome 20 open reading frame 194 [Source:NCBI ... [more]
C20orf1941.531e-4828.68chromosome 20 open reading frame 194 [Source:NCBI ... [more]
C20orf1942.868e-4832.49chromosome 20 open reading frame 194 [Source:NCBI ... [more]
C20orf1943.892e-4832.49chromosome 20 open reading frame 194 [Source:NCBI ... [more]
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
4930402H24Rik5.889e-4326.59RIKEN cDNA 4930402H24 gene [Source:MGI Symbol;Acc:... [more]
4930402H24Rik1.856e-3537.50RIKEN cDNA 4930402H24 gene [Source:MGI Symbol;Acc:... [more]
4930402H24Rik6.169e-2623.99RIKEN cDNA 4930402H24 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Si:ch211-194c3.5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q5TEA3|CT194_HUMAN4.939e-7324.35Uncharacterized protein C20orf194 OS=Homo sapiens ... [more]
sp|Q7TT23|CT194_MOUSE4.119e-4226.59Uncharacterized protein C20orf194 homolog OS=Mus m... [more]
back to top
BLAST of Si:ch211-194c3.5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504YHG14.466e-10225.22Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
A0A4S2LW314.591e-9524.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4V3SFE32.787e-9024.16Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A1S3K9251.845e-8326.24uncharacterized protein C20orf194-like OS=Lingula ... [more]
A0A1S3WWY17.497e-8024.40uncharacterized protein C20orf194 homolog isoform ... [more]
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-194c3.54.963e-6323.82si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-194c3.54.578e-7524.86si:ch211-194c3.5 [Source:ZFIN;Acc:ZDB-GENE-090313-... [more]
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO403491.780e-4428.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:ch211-194c3.5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-194c3.5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000044256.10.000e+099.48SMESG000044256.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026263 ID=SMED30026263|Name=Si:ch211-194c3.5|organism=Schmidtea mediterranea sexual|type=transcript|length=3749bp
GGACGCCAATTTATTCTGTTTCTATTGGAATTCTTACATCTATTTGCAGG
CTAATTTTTTAATTAAATAATTAAATTTAAATAGAAATGCCATTAACTAA
AGTAAGAAGACCGAAATATGAAAGACATGATATTAAGCAACATCTATTTT
CATCATTTTTAAGTTGTCAGAGACTGCATAAAATTCAAAGATTGATTAAT
TACAAGAAAATCGACGGTCTTCTGATTATAATTGGAATTGACGGTCGTTT
TAATGCTGGATCACTAGAGCTATTTAATTATTTATTTTTCGACATATTTT
CCACAAGAACAGATGACATAAAACGATCTAAATTAGATGATGATATATTT
GATGATGTAATGGTTTGCATAACTTGCGACGAGGTTCATGTCTATTGTAA
TGGAGCTAATTATTGGTTGTTACTTCCTTATATGGCCTGTTGGCCGGGAT
TGAGATTGCATTGCTTATCGGAAATAGAAATGGAAGACTCTGAAATATTG
GAACAATTTAAAATAGACACATTTGCGGAAATGACAAGATTTTGTGATAA
AATAGCCGTAGTTACAAAAGGTTCTATAGAAGAAAACGAGGCCTTTGATC
CCATGGTTGTTGAAGGATGGCCTATAATTCAAAGTTACGCTTATGATGAT
TTCGGAAAATATTCGCAACATTATTCGAGGAAAGGATTTTTTACTCTTGT
CCATAAAGTGATTGATATATCTACCGACGTCCATACAATTTTCAAGGAAA
TTGATCCAGTTCATTTGGAAAATATTTATCAAAAAGTTCTTCCACAAATG
GAAGGATTAATGGAAAATATTTTCCAATTGCTTGATTCAAAATCCTTTAA
CGATAACCTTGAAATAGACGAGGATATCTTTGAAGAACCAGTAAAAAGTT
ATTTTAATCATTTGAAGAGTAATAAAACTCTGATTTCACAATGTATGCAA
ATGAATCCTCTGGCACTCAGCGGCACAAACACTCGTCAGTCGGTTTTGAT
GACCAGACTAGGGAAATCTTCTGATTCAGAAGGAGATCTTCGTGATAAAT
TCGTTTCAAATCCAAAACATATGATTATTCAATGCGTCAGTCTCCACACG
GGCATTGTTATAGCAAGGACCATTTTTCTCCAAGGATGCTCAAATGTTGC
TAAGCCAAGCAAAGAAATGGATGACACTTGCGCCGATGTAATGAAATTGT
CAACTGCTTACAACGCCATTGTATCAACCGCCGATTTTGTCATTTCTAAA
TTGAAGTCTTCTAAAAATATCGTTTTGGATGAAGTTGAAGCCAAAAACCA
ATTGAAATATTCTCTTAATAAAATGAGATATTCCGACTGTTCCTTCAGAA
TTATCACTATTGGTGATACAAATAATTCTCAAGGATTTCTGATGATTATT
CAAAGCGTCGTATTCGACATTGTCAATGAGGATCGAGGTGAAAATCTTGG
GTCAGTAATCTTTGCCGATACCTTTGTTGTTACTAGCACTCCAGTAAATA
AAGAAGATAATTTGACATCGGTTTTACGACTCGGGAAGAAAGTTCCATTA
TTCAGTTATTGGACCAATAATAATTTGTCAAAATTGCATCAAACAATAAA
TGAAATCTACGAATTAGAACCTCTGGCAACAGAAATGGCCGACATTATCC
TAACGGATCGACATTTCCAAGAAACTACAGTTCAGCAATTGTGCTGCACA
TTTTTTCCCGACCGAGTTCTATTATTCAACAAAAAAGTTGGAGCTATTAT
TCTATATCCCGATTCGGTTGAAGTGGTTGAAGGAGAATCGTACTGTGATT
GGACAATTTTCTCCATCACCTGCCAAGTGAGCAAATCAAAATTCACCAAT
TGGATATGGAATAAAAACAATGAAAAAGATGTTCTGCATTTGATATTCTC
AAATAACAGCAAACTCAGAAAGTCCATAACAAGCATTGTAATTCCTAAAT
GGAAGGAAACTATGAAAATTGCTAACACCACGAAAATCAAAAGCCCAAAT
CTGGATATAAATTGGAAATTCATTCAAAATTGGATGATAAACAACCAATT
ATCGGTATCGGAACATTCTTCACAATCGATCATTGATGGAATCAGCGAAG
ATGTCCACCAATCGCAACTGATTAAAGTCCATAATTCTATGAATTATTCT
CTGATTCATAGAAAAAGTTGTGTACGAGTATTTGCGCAATTAATGGTGAT
GAATTATTCCCTTCGTTACTATGACAATGTTGATTATCTGGAAACTATTT
TCGAATCCCACAAGGAAATCTTTGAATCTTGTCAACAAAATTGGCTTTGT
CATTCCTTTATGGATTACACAAAATTTATGAATGTTAAAAACCAATTATC
CAATATCAATGAGCAATCATCGATTGTCGTCACTGTCATTTGTGGGCTCC
CCGGCAGTGGGCAGGAATTTCTCACTAGAAAAATAATGAAAATTATACAT
GATGATTTTGATTGGTTATTGGTAACTCCGATCTCAATACAGGACGTAAC
TTGTGCAACTGAGAATATATTGAAAGATTTCGAAAATATCAATGAAAACA
AAAACTTAAGAATTCTTCTAATTGCTCCACCTCTGAGTTTCCCTAGTGAG
ATCGTTAGAAGACTCAAGGCCGTTGCTTCAAGGATTCCTATTGCTATTGG
TAATATCACCGTGTGCATTAATCCCGAAGCGGCATATCTGGATAATAGAG
AATATACTATACCCGGTCTTTTGGATATGTGTAATGAAGGATGGGTGAAC
ACAATTATTCTCACCGGGCCAGACAGCAATTCTATCAAAACAACAACATT
GCACAGAATCTTGCGCGCTAGAAATGAACTCTGTACCATATATCTGACAC
CGAAAGCTGATGTAACCAAGGAATTGGATACTATCCTATCGAAAGTCGCT
TTTCAACAAGAGAGATTTGATTTAGCCAGACTGCTGTACAATCTAACCCA
ACATCAAACACATTTTGGTGTTGAGAATTTCAAAAGAATCTCTAAAAGGT
TTTATGAAATTTTTTATCCCATATATGGACCATTATTAAAGGAAAATATT
ATAAGAGCTTCTCGAGAAATGTTCAAAAATCTGACGTGTGCTCCTTTCGA
TAAGAATATATATTTCATTGAAGGAATTATAAACATCGAAGAAGACCCTA
AACGACTTTATTCTTTGACATCGGTGTCTTTAACCAAACAGCTTATAATT
TTTCCATTGCCAAACAAAGAAAATCGTGGAGATTATTCTAGAGCTTCCTA
TACCCAATCGACATACATTAGAATTTATGTTACAGCAGAAGAAACCATTC
ATCCGAATGATTCGGAAAAAATTTCAGATTTAAAAGAAAGTTTTCTCGCG
GTGCTTCGAAATTTCCAGCGTCAAATTCCTCTAAAAAAGAAAAAAATTAC
TGCTTCTGATGTGACCGCACAACAGATGGATGAAATCCATAACGAACGAC
ATTTGGAAGCACTTCCGGAAGGATGGTTCTATAACGGAATAAGCTACGTG
CACATGGACGGTAGTAGAAGCGATAAGCATCCGTCACTTCCTGCCTTTAT
TGCCGATTTTATCAATGCCAAAAATTTGGAAATCGAAACGAACAATAGTC
TATTGGACTTGATGACTGTGACCGACGCATTCGCCAAATTTTAAACAAAA
ACTCTCAATTATTCGGATTTTACTTTTATTTGATTGGTTAAATTTCAAAT
TAAAATTCAAGCAATGTTTAACACTTTCATTTAATAAATAAGTTAATAA
back to top

protein sequence of SMED30026263-orf-1

>SMED30026263-orf-1 ID=SMED30026263-orf-1|Name=SMED30026263-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1186bp
MPLTKVRRPKYERHDIKQHLFSSFLSCQRLHKIQRLINYKKIDGLLIIIG
IDGRFNAGSLELFNYLFFDIFSTRTDDIKRSKLDDDIFDDVMVCITCDEV
HVYCNGANYWLLLPYMACWPGLRLHCLSEIEMEDSEILEQFKIDTFAEMT
RFCDKIAVVTKGSIEENEAFDPMVVEGWPIIQSYAYDDFGKYSQHYSRKG
FFTLVHKVIDISTDVHTIFKEIDPVHLENIYQKVLPQMEGLMENIFQLLD
SKSFNDNLEIDEDIFEEPVKSYFNHLKSNKTLISQCMQMNPLALSGTNTR
QSVLMTRLGKSSDSEGDLRDKFVSNPKHMIIQCVSLHTGIVIARTIFLQG
CSNVAKPSKEMDDTCADVMKLSTAYNAIVSTADFVISKLKSSKNIVLDEV
EAKNQLKYSLNKMRYSDCSFRIITIGDTNNSQGFLMIIQSVVFDIVNEDR
GENLGSVIFADTFVVTSTPVNKEDNLTSVLRLGKKVPLFSYWTNNNLSKL
HQTINEIYELEPLATEMADIILTDRHFQETTVQQLCCTFFPDRVLLFNKK
VGAIILYPDSVEVVEGESYCDWTIFSITCQVSKSKFTNWIWNKNNEKDVL
HLIFSNNSKLRKSITSIVIPKWKETMKIANTTKIKSPNLDINWKFIQNWM
INNQLSVSEHSSQSIIDGISEDVHQSQLIKVHNSMNYSLIHRKSCVRVFA
QLMVMNYSLRYYDNVDYLETIFESHKEIFESCQQNWLCHSFMDYTKFMNV
KNQLSNINEQSSIVVTVICGLPGSGQEFLTRKIMKIIHDDFDWLLVTPIS
IQDVTCATENILKDFENINENKNLRILLIAPPLSFPSEIVRRLKAVASRI
PIAIGNITVCINPEAAYLDNREYTIPGLLDMCNEGWVNTIILTGPDSNSI
KTTTLHRILRARNELCTIYLTPKADVTKELDTILSKVAFQQERFDLARLL
YNLTQHQTHFGVENFKRISKRFYEIFYPIYGPLLKENIIRASREMFKNLT
CAPFDKNIYFIEGIINIEEDPKRLYSLTSVSLTKQLIIFPLPNKENRGDY
SRASYTQSTYIRIYVTAEETIHPNDSEKISDLKESFLAVLRNFQRQIPLK
KKKITASDVTAQQMDEIHNERHLEALPEGWFYNGISYVHMDGSRSDKHPS
LPAFIADFINAKNLEIETNNSLLDLMTVTDAFAKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR040342C20orf194-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR040342Uncharacterized protein C20orf194-likePANTHERPTHR33664FAMILY NOT NAMEDcoord: 18..1174