stem loop binding protein

Overview
Namestem loop binding protein (AGS78023.1)
Smed IDSMED30026247
Length (bp)1157
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of stem loop binding protein (SMED30026247) t-SNE clustered cells

Violin plots show distribution of expression levels for stem loop binding protein (SMED30026247) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of stem loop binding protein (SMED30026247) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for stem loop binding protein (SMED30026247) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026247

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026247SMESG000060978.1 SmedASXL_008863SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026247SMESG000060978.1 SmedASXL_008863SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30026247SMESG000060978.1 dd_Smed_v4_9628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30026247SMESG000060978.1 Contig55557newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026247SMESG000060978.1 Contig55557uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30026247SMESG000060978.1 dd_Smed_v4_9628_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026247SMESG000060978.1 SMED_09692_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30026247SMESG000060978.1 SMED_09692_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of stem loop binding protein vs. Ensembl Human
Match: SLBP (stem-loop binding protein [Source:HGNC Symbol;Acc:HGNC:10904])

HSP 1 Score: 68.5514 bits (166), Expect = 1.158e-12
Identity = 34/89 (38.20%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPK-----FEELYAAGIE 667
             E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   P+TPNKF K SRR WD  ++ WK  +H W+ P       +E++   +E
Sbjct:   89 FETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIHPVDLE 177          
BLAST of stem loop binding protein vs. Ensembl Human
Match: SLBP (stem-loop binding protein [Source:HGNC Symbol;Acc:HGNC:10904])

HSP 1 Score: 67.781 bits (164), Expect = 2.005e-12
Identity = 43/117 (36.75%), Postives = 60/117 (51.28%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASI-LSFKESISETEDNKESNKDDF 763
             E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   P+TPNKF K SRR WD  ++ WK  +H W+ P          E  C   ++  + L   ES SE +    S++DDF
Sbjct:   83 FETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPP---------AEEGCDLQEIHPVDLESAESSSEPQ---TSSQDDF 187          
BLAST of stem loop binding protein vs. Ensembl Human
Match: SLBP (stem-loop binding protein [Source:HGNC Symbol;Acc:HGNC:10904])

HSP 1 Score: 67.781 bits (164), Expect = 2.171e-12
Identity = 41/117 (35.04%), Postives = 58/117 (49.57%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFK-ESISETEDNKESNKDDF 763
             E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   P+TPNKF K SRR WD  ++ WK  +H W+ P  E              D+  I     ES   + + + S++DDF
Sbjct:   93 FETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEE------------GCDLQEIHPVDLESAESSSEPQTSSQDDF 197          
BLAST of stem loop binding protein vs. Ensembl Human
Match: SLBP (stem-loop binding protein [Source:HGNC Symbol;Acc:HGNC:10904])

HSP 1 Score: 68.1662 bits (165), Expect = 3.101e-12
Identity = 34/89 (38.20%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPK-----FEELYAAGIE 667
             E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   P+TPNKF K SRR WD  ++ WK  +H W+ P       +E++   +E
Sbjct:  135 FETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIHPVDLE 223          
BLAST of stem loop binding protein vs. Ensembl Human
Match: SLBP (stem-loop binding protein [Source:HGNC Symbol;Acc:HGNC:10904])

HSP 1 Score: 67.781 bits (164), Expect = 3.157e-12
Identity = 34/89 (38.20%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPK-----FEELYAAGIE 667
             E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   P+TPNKF K SRR WD  ++ WK  +H W+ P       +E++   +E
Sbjct:  128 FETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIHPVDLE 216          
BLAST of stem loop binding protein vs. Ensembl Celegans
Match: cdl-1 (Histone RNA hairpin-binding protein [Source:UniProtKB/Swiss-Prot;Acc:Q09599])

HSP 1 Score: 57.3806 bits (137), Expect = 7.741e-9
Identity = 36/105 (34.29%), Postives = 52/105 (49.52%), Query Frame = 2
Query:  428 DVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFR-KPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDN 739
            D  VL RR  +ID+ K K  Y+ +  EV    R K   PRTPNK +  SRR WD  ++KWK+ ++ +      E  +  +    C SD        +++SE  DN
Sbjct:  223 DEAVLKRRSREIDRAKEKAVYQRYTSEVPLRDRIKGQHPRTPNKLINFSRRSWDTQIKKWKRSLYEY----CGEEPSDSVNTSFCYSD-------SDALSEAGDN 316          
BLAST of stem loop binding protein vs. Ensembl Fly
Match: Slbp (gene:FBgn0041186 transcript:FBtr0085409)

HSP 1 Score: 69.707 bits (169), Expect = 3.774e-13
Identity = 33/71 (46.48%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  422 EQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEP 634
            E D  +L+RRQ  ID GK+   Y+ +V  V K+ R    PRTPNK+ K SRR +DGLV+ W+K +H ++ P
Sbjct:  189 EADPAILSRRQKQIDYGKNTAAYERYVEMVPKDERTRDHPRTPNKYGKYSRRAFDGLVKIWRKSLHIYDPP 259          
BLAST of stem loop binding protein vs. Ensembl Zebrafish
Match: slbp (stem-loop binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-9686])

HSP 1 Score: 73.9442 bits (180), Expect = 1.207e-14
Identity = 43/111 (38.74%), Postives = 60/111 (54.05%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDNKES 748
            +E D   L RRQ  I+ GK+   Y  ++ EV K  R+P   P+TPNKF K SRR WD  ++ W+  +HAW+ P  E      IE      D+  I+ F+  + ET +N ES
Sbjct:  116 IETDETTLIRRQKQINYGKNTLAYDRYIKEVPKHLRQPGVHPKTPNKFKKYSRRSWDQQIKLWRVKLHAWDPPAEEGSDFQQIE----EIDLGEIMDFELDV-ETTENTES 221          
BLAST of stem loop binding protein vs. Ensembl Zebrafish
Match: slbp (stem-loop binding protein [Source:ZFIN;Acc:ZDB-GENE-030131-9686])

HSP 1 Score: 73.9442 bits (180), Expect = 2.422e-14
Identity = 43/111 (38.74%), Postives = 60/111 (54.05%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDNKES 748
            +E D   L RRQ  I+ GK+   Y  ++ EV K  R+P   P+TPNKF K SRR WD  ++ W+  +HAW+ P  E      IE      D+  I+ F+  + ET +N ES
Sbjct:  164 IETDETTLIRRQKQINYGKNTLAYDRYIKEVPKHLRQPGVHPKTPNKFKKYSRRSWDQQIKLWRVKLHAWDPPAEEGSDFQQIE----EIDLGEIMDFELDV-ETTENTES 269          
BLAST of stem loop binding protein vs. Ensembl Zebrafish
Match: slbp2 (stem-loop binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-070112-1722])

HSP 1 Score: 68.5514 bits (166), Expect = 1.691e-12
Identity = 33/67 (49.25%), Postives = 42/67 (62.69%), Query Frame = 2
Query:  437 VLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEP 634
            VL RRQ  I  GK+   Y+N+V +V K  R P   P TPNK+ K SRR WD  VR W++ +HAW+ P
Sbjct:  134 VLKRRQKQIQYGKNTCGYQNYVQQVPKRLRVPGIHPSTPNKYRKYSRRSWDMQVRLWRRALHAWDLP 200          
BLAST of stem loop binding protein vs. Ensembl Xenopus
Match: slbp (stem-loop binding protein [Source:NCBI gene;Acc:448105])

HSP 1 Score: 70.4774 bits (171), Expect = 2.797e-13
Identity = 34/78 (43.59%), Postives = 46/78 (58.97%), Query Frame = 2
Query:  416 KLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEE 646
            ++E D  VLTRRQ  I  GK+   Y  ++  V +  R+P   PRTPNKF K SRR WD  +R W+  +H W+ P  E+
Sbjct:  125 EMETDPAVLTRRQKQISYGKNTIAYDRYIKAVPRHLREPNVHPRTPNKFKKYSRRSWDQQIRLWRIALHQWDPPAEED 202          
BLAST of stem loop binding protein vs. Ensembl Xenopus
Match: fgfbp3 (fibroblast growth factor binding protein 3 [Source:Xenbase;Acc:XB-GENE-993937])

HSP 1 Score: 70.0922 bits (170), Expect = 5.158e-13
Identity = 34/88 (38.64%), Postives = 50/88 (56.82%), Query Frame = 2
Query:  374 LKYSEKLRKNQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEP 634
              +S  +  +    + E D   L RRQ  ID GK+   Y+ ++ +V K  RKP   PRTPNK+ K SRR WD  ++ W++ +HAW+ P
Sbjct:  114 FSFSRSMTISHDTARYETDEATLQRRQKQIDYGKNTIGYQCYLQQVPKSERKPGVHPRTPNKYKKYSRRSWDMQIKLWRRALHAWDPP 201          
BLAST of stem loop binding protein vs. Ensembl Xenopus
Match: fgfbp3 (fibroblast growth factor binding protein 3 [Source:Xenbase;Acc:XB-GENE-993937])

HSP 1 Score: 70.0922 bits (170), Expect = 6.126e-13
Identity = 34/88 (38.64%), Postives = 50/88 (56.82%), Query Frame = 2
Query:  374 LKYSEKLRKNQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEP 634
              +S  +  +    + E D   L RRQ  ID GK+   Y+ ++ +V K  RKP   PRTPNK+ K SRR WD  ++ W++ +HAW+ P
Sbjct:  116 FSFSRSMTISHDTARYETDEATLQRRQKQIDYGKNTIGYQCYLQQVPKSERKPGVHPRTPNKYKKYSRRSWDMQIKLWRRALHAWDPP 203          
BLAST of stem loop binding protein vs. Ensembl Mouse
Match: Slbp (stem-loop binding protein [Source:MGI Symbol;Acc:MGI:108402])

HSP 1 Score: 68.9366 bits (167), Expect = 4.874e-13
Identity = 35/85 (41.18%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPK-----FEELYA 655
            +E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   PRTPNKF K SRR WD  ++ WK  +H W+ P       +E+Y 
Sbjct:  128 VETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEMYV 212          
BLAST of stem loop binding protein vs. Ensembl Mouse
Match: Slbp (stem-loop binding protein [Source:MGI Symbol;Acc:MGI:108402])

HSP 1 Score: 68.9366 bits (167), Expect = 6.942e-13
Identity = 34/76 (44.74%), Postives = 45/76 (59.21%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFE 643
            +E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   PRTPNKF K SRR WD  ++ WK  +H W+ P  E
Sbjct:  108 VETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEE 183          
BLAST of stem loop binding protein vs. Ensembl Mouse
Match: Slbp (stem-loop binding protein [Source:MGI Symbol;Acc:MGI:108402])

HSP 1 Score: 68.5514 bits (166), Expect = 9.683e-13
Identity = 34/76 (44.74%), Postives = 45/76 (59.21%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFE 643
            +E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   PRTPNKF K SRR WD  ++ WK  +H W+ P  E
Sbjct:  128 VETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEE 203          
BLAST of stem loop binding protein vs. Ensembl Mouse
Match: Slbp (stem-loop binding protein [Source:MGI Symbol;Acc:MGI:108402])

HSP 1 Score: 68.9366 bits (167), Expect = 9.754e-13
Identity = 34/76 (44.74%), Postives = 45/76 (59.21%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFE 643
            +E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   PRTPNKF K SRR WD  ++ WK  +H W+ P  E
Sbjct:  128 VETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEE 203          
BLAST of stem loop binding protein vs. UniProt/SwissProt
Match: sp|P79943|SLBP1_XENLA (Histone RNA hairpin-binding protein OS=Xenopus laevis OX=8355 GN=slbp1 PE=1 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.482e-12
Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  416 KLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFE 643
            ++E D  V+TRRQ  I+ GK+   Y  ++  V +  R+P   PRTPNKF K SRR WD  +R W+  +H W+ P  E
Sbjct:  125 EMETDPAVITRRQKQINYGKNTIAYDRYIKAVPRHLREPNVHPRTPNKFKKYSRRSWDQQIRLWRIALHQWDPPAAE 201          
BLAST of stem loop binding protein vs. UniProt/SwissProt
Match: sp|Q9VAN6|SLBP_DROME (Histone RNA hairpin-binding protein OS=Drosophila melanogaster OX=7227 GN=Slbp PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 3.783e-12
Identity = 33/71 (46.48%), Postives = 46/71 (64.79%), Query Frame = 2
Query:  422 EQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEP 634
            E D  +L+RRQ  ID GK+   Y+ +V  V K+ R    PRTPNK+ K SRR +DGLV+ W+K +H ++ P
Sbjct:  189 EADPAILSRRQKQIDYGKNTAAYERYVEMVPKDERTRDHPRTPNKYGKYSRRAFDGLVKIWRKSLHIYDPP 259          
BLAST of stem loop binding protein vs. UniProt/SwissProt
Match: sp|P97440|SLBP_MOUSE (Histone RNA hairpin-binding protein OS=Mus musculus OX=10090 GN=Slbp PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 6.823e-12
Identity = 34/76 (44.74%), Postives = 45/76 (59.21%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFE 643
            +E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   PRTPNKF K SRR WD  ++ WK  +H W+ P  E
Sbjct:  128 VETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPRTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEE 203          
BLAST of stem loop binding protein vs. UniProt/SwissProt
Match: sp|Q14493|SLBP_HUMAN (Histone RNA hairpin-binding protein OS=Homo sapiens OX=9606 GN=SLBP PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.516e-11
Identity = 34/89 (38.20%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPK-----FEELYAAGIE 667
             E D  VL RRQ  I+ GK+   Y  ++ EV +  R+P   P+TPNKF K SRR WD  ++ WK  +H W+ P       +E++   +E
Sbjct:  128 FETDESVLMRRQKQINYGKNTIAYDRYIKEVPRHLRQPGIHPKTPNKFKKYSRRSWDQQIKLWKVALHFWDPPAEEGCDLQEIHPVDLE 216          
BLAST of stem loop binding protein vs. UniProt/SwissProt
Match: sp|Q9YGP6|SLBP2_XENLA (Oocyte-specific histone RNA stem-loop-binding protein 2 OS=Xenopus laevis OX=8355 GN=slbp2 PE=2 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 7.327e-10
Identity = 32/75 (42.67%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  413 IKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRK-PYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEP 634
            +  E D   L RRQ  ID GK+   Y+ ++ +V K  RK    PRTPNK  K SRR WD  ++ W++ +HAW+ P
Sbjct:   99 VGYETDEATLHRRQKQIDYGKNTVGYQCYLQQVPKTERKSGVHPRTPNKSKKYSRRSWDMQIKLWRRDLHAWDPP 173          
BLAST of stem loop binding protein vs. TrEMBL
Match: S5WBT8 (Stem loop binding protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=SLBP PE=2 SV=1)

HSP 1 Score: 487.263 bits (1253), Expect = 1.887e-171
Identity = 237/237 (100.00%), Postives = 237/237 (100.00%), Query Frame = 2
Query:  227 VCSNSSHKRYHKNYDPDIEIRQVNERLRKRVSNSWADLSLLNDEEQEDYLKYSEKLRKNQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDNKESNKDDFSEEEEETLQAYNTRKRTISPRDDETLDSSPQKLLLHSGLTNDAAALSVSKRIKLSEMK 937
            VCSNSSHKRYHKNYDPDIEIRQVNERLRKRVSNSWADLSLLNDEEQEDYLKYSEKLRKNQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDNKESNKDDFSEEEEETLQAYNTRKRTISPRDDETLDSSPQKLLLHSGLTNDAAALSVSKRIKLSEMK
Sbjct:    1 VCSNSSHKRYHKNYDPDIEIRQVNERLRKRVSNSWADLSLLNDEEQEDYLKYSEKLRKNQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDNKESNKDDFSEEEEETLQAYNTRKRTISPRDDETLDSSPQKLLLHSGLTNDAAALSVSKRIKLSEMK 237          
BLAST of stem loop binding protein vs. TrEMBL
Match: A0A5J4P115 (SLBP_RNA_bind domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0008928 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 2.584e-32
Identity = 111/311 (35.69%), Postives = 154/311 (49.52%), Query Frame = 2
Query:  155 VRSNFKQENQSPRPFHEISQSPGSVCSNSSHKRYHKNYDPDIEIRQVNERL-RKRVSNSWADLSLLNDEEQEDYLKYSEKLRKN-------QKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFE-------ELYAAG-------IEVECCNSDVASILSFKESISETEDNKESNKDDFS------EEEEETLQAYNTRK-------------RTISPRDDETLD--------------SSPQKLL-------LHSGLTNDAAAL 901
             R+  KQEN+S    H+ S+S   V S  S +R+H++YDP IEIR+  ERL R R  + W    LL D+  ED ++Y EK+++         + I+LE+    L RRQ DID GK  + Y  +V  V K  R+ + PRTPNKF K+SRR WDG++RKW+KH+H + +  FE         Y +G          +C   +V  +  F  + S T   K +  D F       EEEE+TLQA N +              RT +P D++TL               SS  KL+       LHSGLTND   +
Sbjct:   93 TRNRSKQENESD---HDRSRS--IVSSVGSKRRFHRDYDPCIEIRRAKERLERYRKKDDWNADMLLCDDADEDLIRYEEKVKRRLAERDELMEPIELERRQLELLRRQRDIDMGKVTERYAEYVLSVPKPVRERHHPRTPNKFRKVSRRAWDGMIRKWRKHLHNFEDLDFEVSWRSLSSTYVSGQSSDRSVASSDCETENVPPVNGFPLTASPT--IKPTRIDGFCDIQATLEEEEDTLQA-NPKAFKGETNRSPHHLLRTDNPEDEDTLSFMSTSLNGRRRITRSSNSKLIPGPTPDALHSGLTNDMVDM 395          
BLAST of stem loop binding protein vs. TrEMBL
Match: A0A4E0RLU5 (Histone RNA hairpin-binding protein OS=Fasciola hepatica OX=6192 GN=D915_006846 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 2.090e-30
Identity = 100/292 (34.25%), Postives = 138/292 (47.26%), Query Frame = 2
Query:  254 YHKNYDPDIEIRQVNERL-RKRVSNSWADLSLLNDEEQEDYLKYSEKLRKNQKN-------IKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELY------------------------------------------AAGIEVECCNSDVASILSFKESISETEDNKESNKDDFSEEEEETLQAYNTRKRTISP--------RDDETLDSSP----QKL-------------LLHSGLTNDAAALS 904
            YH +YDP IEIR+  ERL R +  + W    LL+D+  ED  +Y EKLRK           I+LE+    L RRQ DID GK    Y  +V  + K  R+ Y PRTPNKF K+SRR WDG++RKW+KH+H +++  FEE +                                           A + +   + D AS LS K S++    +++      SEEEE+TLQA+    R  SP         DD+TL ++P    ++L             +LHSGLTND   L+
Sbjct:  131 YHPDYDPLIEIRRAKERLDRYQAKDDWKADMLLSDDCDEDLQRYEEKLRKRLAERGDLIEPIELERRQIELLRRQKDIDLGKVTPRYAEYVLSIPKPERERYMPRTPNKFRKVSRRAWDGMIRKWRKHLHNFDDLNFEESWRSLSSTYLSTGSGLSTPDHSLASAASSDHENERDFKDAKLSATATVNLSTVSGDYAS-LSLKPSVARGFQSRQIK----SEEEEDTLQAHPKLFRGKSPAARATKLCEDDDTLSAAPTIEARRLTRSSSRPSGPTPDVLHSGLTNDMNELT 417          
BLAST of stem loop binding protein vs. TrEMBL
Match: A0A183M810 (SLBP_RNA_bind domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS12185 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 2.734e-30
Identity = 114/364 (31.32%), Postives = 167/364 (45.88%), Query Frame = 2
Query:   38 NRKEKPNKNSPFVEKFKYRRSSRIXXXXXXXX-----XXXXKSPVRSNFKQENQSPRPFHEISQSPGSVCSNSSHKRYHKNYDPDIEIRQVNERL-RKRVSNSWADLSLLNDEEQEDYLKYSEKLRK-------NQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELY--------------------AAGIEVECCNSD---VA----------SILSFKESISETEDNKESNKDDFS--EEEEETLQAY------NTRKRTISPRDDE--TLD------------------SSPQKLLLHSGLTNDAAALSV 907
            +RK  P KN+ F+      RS RI               + +SPV      + +S R     SQ+ GS       +++H NYDP IEIR+  ERL R R    W    LL+D+  ED  +Y EKL++        Q+ I+LE+    L RRQ DID GK  + Y  +V  + K  R+ Y PRTPNKF K+SRR WDG++RKW+KH+H ++   FE+ +                     A  + E  N +   +A          + LS K+  +    N   +++ +   +E+E+TLQ+         R  TI P+++E  TL                   S P   +LHSGLTND  +L+ 
Sbjct:   11 SRKSAPVKNAVFLGAINKGRS-RINPLVTQRYYHFNWLNSIRSPVDKLSHNDRESGRKLEISSQTIGS------RRKFHPNYDPLIEIRRAQERLDRYRTQGDWKVDMLLSDDADEDLSRYEEKLKRRLTEKGETQQPIELERRQMELLRRQKDIDMGKVTERYAEYVLSIPKPERQKYHPRTPNKFRKVSRRAWDGMIRKWRKHLHNFDNLNFEDTWRSLSTDLSSNFSGSSWVLESGASSDTENINPEEYHIALVNHSQPLSRTFLSSKDLTASPTINVSYSRNQYRKYDEDEDTLQSNPRHCKEEERFPTIVPKEEEEDTLTGPSSIHENRRITRNSKMLSGPSADVLHSGLTNDMQSLAA 367          
BLAST of stem loop binding protein vs. TrEMBL
Match: A0A3Q0KMQ9 (Slbp-P1-related OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 5.614e-30
Identity = 98/296 (33.11%), Postives = 142/296 (47.97%), Query Frame = 2
Query:  227 VCSNSSHKRYHKNYDPDIEIRQVNERL-RKRVSNSWADLSLLNDEEQEDYLKYSEKLRK-------NQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELY---AAGIEVECCNSDVA-------------------SILSFKESISET----EDNKESNKDDFS---------EEEEETLQAY------NTRKRTISPRDDE--TLD------------------SSPQKLLLHSGLTNDAAALSV 907
            + S  S +++H NYDP IEIR+  ERL R R    W    LL+D+  ED  +Y EKL++        Q+ I+LE+    L RRQ DID GK  + Y  +V  + K  R+ Y PRTPNKF K+SRR WDG++RKW+KH+H ++   FE+ +   +  +   C  S                      S+++  + +S T    +D   S   + S         EE+E+TLQ+         R  +I P+++E  TL                   S P   +LHSGLTND  +LS 
Sbjct:  114 LSSIGSRRKFHPNYDPLIEIRRAQERLDRYRTQGDWKVDMLLSDDADEDLSRYEEKLKRRLTEKGETQQPIELERRQMELLRRQKDIDMGKVTERYAEYVLSIPKPERQKYHPRTPNKFRKVSRRAWDGMIRKWRKHLHNFDNLNFEDTWRSLSTDLSSNCSGSSWVLESGASSDTENVNPEEYHISVVNHSQPLSRTFLSPKDLTASPTINVSYSRNQYRKYEEDEDTLQSNPRHCKEEERFTSIVPKEEEEDTLTGPSSIHENRRITRNSKMLSGPSADVLHSGLTNDMQSLSA 409          
BLAST of stem loop binding protein vs. Ensembl Cavefish
Match: slbp (stem-loop binding protein [Source:NCBI gene;Acc:103030345])

HSP 1 Score: 73.559 bits (179), Expect = 1.921e-14
Identity = 39/83 (46.99%), Postives = 49/83 (59.04%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFE--ELYAA 658
             E D  VL RRQ  I+ GK+   Y  ++ EV K  R+P   PRTPNKF K SRR WD  ++ WK  +HAW+ P  E  +L AA
Sbjct:  134 FETDESVLMRRQKQINYGKNTLAYDRYIKEVPKHLRQPGVHPRTPNKFKKYSRRSWDQQIKLWKVKLHAWDPPTEEGNDLQAA 216          
BLAST of stem loop binding protein vs. Ensembl Cavefish
Match: slbp2 (oocyte-specific histone RNA stem-loop-binding protein 2-like [Source:NCBI gene;Acc:103030271])

HSP 1 Score: 72.7886 bits (177), Expect = 6.011e-14
Identity = 47/162 (29.01%), Postives = 76/162 (46.91%), Query Frame = 2
Query:  347 LNDEEQEDYLKYSEKLRKNQKNI---KLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDNKESNKDDFSEEEEETLQAYNTRKRTIS 820
            +  E+ +D  +   +LR   +N+     E +  VL RRQ  I  GK+   Y+N++  V K  R P + P TPNK+ K SRR WD  VR W++ +HAW+ P   +    G                ++ + + +D  E    +  EE+E TL   ++    +S
Sbjct:  104 VGTEDLDDIKRSPSRLRWCTQNMDPSHFETNESVLKRRQKQIQYGKNTCGYQNYLKHVPKRLRIPGFHPSTPNKYRKYSRRSWDMQVRLWRRALHAWDPPLTSQGNNEG----------------QDPVDQLQDLLEKMNTELGEEKERTLDVSDSSASVLS 249          
BLAST of stem loop binding protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003310.1 (pep scaffold:Pmarinus_7.0:GL477328:4967:11096:1 gene:ENSPMAG00000003029.1 transcript:ENSPMAT00000003310.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 3.783e-18
Identity = 36/71 (50.70%), Postives = 49/71 (69.01%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQ-PRTPNKFLKMSRRGWDGLVRKWKKHIHAWN 628
            +E D +VL RRQ  ID GK+   Y+N+V EV +  R+P + PRTPNKF K SRR WD  +R W++ +HAW+
Sbjct:   16 METDEEVLVRRQKQIDYGKNTLAYENYVEEVPRHLREPGKHPRTPNKFKKYSRRSWDQQIRLWRRALHAWD 86          
BLAST of stem loop binding protein vs. Ensembl Nematostella
Match: EDO49148 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH28])

HSP 1 Score: 59.3066 bits (142), Expect = 1.287e-11
Identity = 27/72 (37.50%), Postives = 41/72 (56.94%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEP 634
            +E D+  L +RQ  ID GK+   Y  F  ++ +  R    P TP+KF + S R W G VR W++ +H+W+ P
Sbjct:    1 METDLHKLEKRQKQIDIGKNTVAYGRFSAQIPRSKRAKEDPSTPDKFQQCSTRSWVGQVRVWRRRLHSWDPP 72          
BLAST of stem loop binding protein vs. Ensembl Medaka
Match: ENSORLT00000040600.1 (stem-loop binding protein [Source:NCBI gene;Acc:101155501])

HSP 1 Score: 72.0182 bits (175), Expect = 5.505e-14
Identity = 34/73 (46.58%), Postives = 44/73 (60.27%), Query Frame = 2
Query:  419 LEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEP 634
            LE D  VL RRQ  I  GK+   Y  ++ EV K  R+P   P+TPNKF K SRR WD  ++ W+  +HAW+ P
Sbjct:  131 LETDEGVLLRRQKQISYGKNTLAYDRYIREVPKHLRQPGIHPKTPNKFRKYSRRSWDQQIKLWRVKLHAWDPP 203          
BLAST of stem loop binding protein vs. Ensembl Medaka
Match: slbp2 (uncharacterized LOC101168727 [Source:NCBI gene;Acc:101168727])

HSP 1 Score: 67.0106 bits (162), Expect = 5.736e-12
Identity = 37/96 (38.54%), Postives = 50/96 (52.08%), Query Frame = 2
Query:  422 EQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKP-YQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILS 706
            E +  VL RRQ  I  GK+   Y N++ +V K  R P   P TPNK+ K SRR WD  VR W++ +H W+ P   +       VE   S +A + S
Sbjct:  140 ETNAAVLKRRQKQIQYGKNTTGYLNYLQQVPKHLRDPKLHPSTPNKYKKYSRRSWDMQVRLWRRALHLWDPPSASQPDETPDPVEQLQSQLAKMTS 235          
BLAST of stem loop binding protein vs. Planmine SMEST
Match: SMESG000060978.1 (SMESG000060978.1)

HSP 1 Score: 588.956 bits (1517), Expect = 0.000e+0
Identity = 301/301 (100.00%), Postives = 301/301 (100.00%), Query Frame = 2
Query:   35 MNRKEKPNKNSPFVEKFKYRRSSRIXXXXXXXXXXXXKSPVRSNFKQENQSPRPFHEISQSPGSVCSNSSHKRYHKNYDPDIEIRQVNERLRKRVSNSWADLSLLNDEEQEDYLKYSEKLRKNQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDNKESNKDDFSEEEEETLQAYNTRKRTISPRDDETLDSSPQKLLLHSGLTNDAAALSVSKRIKLSEMK 937
            MNRKEKPNKNSPFVEKFKYRRSSRIQNQNDSDNFQNSKSPVRSNFKQENQSPRPFHEISQSPGSVCSNSSHKRYHKNYDPDIEIRQVNERLRKRVSNSWADLSLLNDEEQEDYLKYSEKLRKNQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDNKESNKDDFSEEEEETLQAYNTRKRTISPRDDETLDSSPQKLLLHSGLTNDAAALSVSKRIKLSEMK
Sbjct:    1 MNRKEKPNKNSPFVEKFKYRRSSRIQNQNDSDNFQNSKSPVRSNFKQENQSPRPFHEISQSPGSVCSNSSHKRYHKNYDPDIEIRQVNERLRKRVSNSWADLSLLNDEEQEDYLKYSEKLRKNQKNIKLEQDVDVLTRRQNDIDKGKSKQCYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEPKFEELYAAGIEVECCNSDVASILSFKESISETEDNKESNKDDFSEEEEETLQAYNTRKRTISPRDDETLDSSPQKLLLHSGLTNDAAALSVSKRIKLSEMK 301          
The following BLAST results are available for this feature:
BLAST of stem loop binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLBP1.158e-1238.20stem-loop binding protein [Source:HGNC Symbol;Acc:... [more]
SLBP2.005e-1236.75stem-loop binding protein [Source:HGNC Symbol;Acc:... [more]
SLBP2.171e-1235.04stem-loop binding protein [Source:HGNC Symbol;Acc:... [more]
SLBP3.101e-1238.20stem-loop binding protein [Source:HGNC Symbol;Acc:... [more]
SLBP3.157e-1238.20stem-loop binding protein [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of stem loop binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cdl-17.741e-934.29Histone RNA hairpin-binding protein [Source:UniPr... [more]
back to top
BLAST of stem loop binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Slbp3.774e-1346.48gene:FBgn0041186 transcript:FBtr0085409[more]
back to top
BLAST of stem loop binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slbp1.207e-1438.74stem-loop binding protein [Source:ZFIN;Acc:ZDB-GEN... [more]
slbp2.422e-1438.74stem-loop binding protein [Source:ZFIN;Acc:ZDB-GEN... [more]
slbp21.691e-1249.25stem-loop binding protein 2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of stem loop binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
slbp2.797e-1343.59stem-loop binding protein [Source:NCBI gene;Acc:44... [more]
fgfbp35.158e-1338.64fibroblast growth factor binding protein 3 [Source... [more]
fgfbp36.126e-1338.64fibroblast growth factor binding protein 3 [Source... [more]
back to top
BLAST of stem loop binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Slbp4.874e-1341.18stem-loop binding protein [Source:MGI Symbol;Acc:M... [more]
Slbp6.942e-1344.74stem-loop binding protein [Source:MGI Symbol;Acc:M... [more]
Slbp9.683e-1344.74stem-loop binding protein [Source:MGI Symbol;Acc:M... [more]
Slbp9.754e-1344.74stem-loop binding protein [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of stem loop binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P79943|SLBP1_XENLA1.482e-1242.86Histone RNA hairpin-binding protein OS=Xenopus lae... [more]
sp|Q9VAN6|SLBP_DROME3.783e-1246.48Histone RNA hairpin-binding protein OS=Drosophila ... [more]
sp|P97440|SLBP_MOUSE6.823e-1244.74Histone RNA hairpin-binding protein OS=Mus musculu... [more]
sp|Q14493|SLBP_HUMAN1.516e-1138.20Histone RNA hairpin-binding protein OS=Homo sapien... [more]
sp|Q9YGP6|SLBP2_XENLA7.327e-1042.67Oocyte-specific histone RNA stem-loop-binding prot... [more]
back to top
BLAST of stem loop binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5WBT81.887e-171100.00Stem loop binding protein (Fragment) OS=Schmidtea ... [more]
A0A5J4P1152.584e-3235.69SLBP_RNA_bind domain-containing protein OS=Paragon... [more]
A0A4E0RLU52.090e-3034.25Histone RNA hairpin-binding protein OS=Fasciola he... [more]
A0A183M8102.734e-3031.32SLBP_RNA_bind domain-containing protein OS=Schisto... [more]
A0A3Q0KMQ95.614e-3033.11Slbp-P1-related OS=Schistosoma mansoni OX=6183 PE=... [more]
back to top
BLAST of stem loop binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slbp1.921e-1446.99stem-loop binding protein [Source:NCBI gene;Acc:10... [more]
slbp26.011e-1429.01oocyte-specific histone RNA stem-loop-binding prot... [more]
back to top
BLAST of stem loop binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003310.13.783e-1850.70pep scaffold:Pmarinus_7.0:GL477328:4967:11096:1 ge... [more]
back to top
BLAST of stem loop binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of stem loop binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO491481.287e-1137.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of stem loop binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000040600.15.505e-1446.58stem-loop binding protein [Source:NCBI gene;Acc:10... [more]
slbp25.736e-1238.54uncharacterized LOC101168727 [Source:NCBI gene;Acc... [more]
back to top
BLAST of stem loop binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000060978.10.000e+0100.00SMESG000060978.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026247
GenBankAGS78023.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026247 ID=SMED30026247|Name=stem loop binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1157bp
TTATTTTTTAACTTTAATTTAAAATAAATCTTTTATGAATAGAAAAGAAA
AGCCAAATAAAAACTCGCCATTTGTTGAAAAATTCAAATATAGGCGTAGT
TCTAGAATTCAAAATCAAAATGATAGTGACAATTTTCAAAATTCTAAATC
ACCTGTTAGATCAAATTTTAAACAAGAGAATCAAAGCCCAAGGCCTTTTC
ATGAAATCTCTCAATCACCTGGAAGTGTGTGTTCAAATTCATCGCATAAA
AGATATCATAAAAATTACGATCCAGACATTGAAATCAGACAAGTTAATGA
ACGTTTAAGAAAACGTGTTAGTAATAGCTGGGCTGATTTATCTTTATTAA
ACGACGAAGAACAAGAAGACTACCTCAAATATTCAGAGAAGCTACGTAAA
AACCAAAAAAATATTAAATTAGAACAAGATGTTGATGTTTTGACTCGACG
TCAAAATGATATTGATAAAGGAAAATCTAAGCAATGTTACAAAAATTTTG
TGTATGAAGTAGCAAAAGAATTCAGAAAACCTTATCAACCTAGAACTCCT
AATAAATTTTTAAAAATGAGCCGAAGAGGCTGGGATGGTTTAGTACGTAA
ATGGAAAAAACACATTCATGCTTGGAATGAACCTAAATTTGAAGAGTTAT
ATGCAGCTGGAATAGAAGTTGAGTGCTGCAATAGTGATGTTGCGTCTATT
TTATCTTTTAAAGAAAGCATTAGCGAAACTGAAGATAATAAGGAAAGTAA
TAAAGACGATTTCAGTGAAGAGGAAGAGGAAACATTACAAGCGTATAACA
CTAGAAAAAGAACGATTTCTCCAAGAGATGATGAAACATTGGACAGTTCG
CCACAGAAATTATTACTTCATTCGGGATTAACAAATGACGCTGCTGCGTT
GAGCGTGAGTAAACGGATCAAATTATCAGAAATGAAATAATAATGTATTT
GATGTTTCGTATATTTATATAGATGTGTTTTTTCTATTTCTGGTTGAAAT
TTATTTGACTCGAGATTTTGTATATTTGTTGTATGATTATGCATAACTTT
AATTTACATTTATCGCAATTGGCTTGTTTTCTTTGGGAATTTCGTCAGCT
AATCAGACTTACATGTGTGCGACAATCTGATTGGTTGTTTGTTGGCTATA
ATTATTA
back to top

protein sequence of SMED30026247-orf-1

>SMED30026247-orf-1 ID=SMED30026247-orf-1|Name=SMED30026247-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=302bp
MNRKEKPNKNSPFVEKFKYRRSSRIQNQNDSDNFQNSKSPVRSNFKQENQ
SPRPFHEISQSPGSVCSNSSHKRYHKNYDPDIEIRQVNERLRKRVSNSWA
DLSLLNDEEQEDYLKYSEKLRKNQKNIKLEQDVDVLTRRQNDIDKGKSKQ
CYKNFVYEVAKEFRKPYQPRTPNKFLKMSRRGWDGLVRKWKKHIHAWNEP
KFEELYAAGIEVECCNSDVASILSFKESISETEDNKESNKDDFSEEEEET
LQAYNTRKRTISPRDDETLDSSPQKLLLHSGLTNDAAALSVSKRIKLSEM
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR038294SLBP_RNA_bind_sf
IPR026502SLBP1/SLBP2
IPR029344SLBP_RNA_bind
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003729mRNA binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 106..126
NoneNo IPR availableCOILSCoilCoilcoord: 229..249
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 26..71
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 250..272
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 230..276
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..25
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..73
IPR029344Histone RNA hairpin-binding protein, RNA-binding domainPFAMPF15247SLBP_RNA_bindcoord: 133..198
e-value: 1.6E-20
score: 73.0
IPR038294SLBP, RNA-binding domain superfamilyGENE3DG3DSA:1.10.8.1120coord: 126..199
e-value: 3.2E-23
score: 83.5
IPR026502Histone RNA stem-loop-binding protein SLBP1/SLBP2PANTHERPTHR17408HISTONE RNA HAIRPIN-BINDING PROTEINcoord: 5..300