Secretory carrier-associated membrane protein

Overview
NameSecretory carrier-associated membrane protein
Smed IDSMED30026242
Length (bp)1083
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Secretory carrier-associated membrane protein (SMED30026242) t-SNE clustered cells

Violin plots show distribution of expression levels for Secretory carrier-associated membrane protein (SMED30026242) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Secretory carrier-associated membrane protein (SMED30026242) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Secretory carrier-associated membrane protein (SMED30026242) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026242

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30026242SMESG000060788.1 Contig951GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30026242SMESG000060788.1 dd_Smed_v4_1544_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026242SMESG000060788.1 dd_Smed_v4_1544_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026242SMESG000060788.1 dd_Smed_v4_1544_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026242 Contig35052newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026242 Contig35052uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP1 (secretory carrier membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:10563])

HSP 1 Score: 160.614 bits (405), Expect = 1.314e-45
Identity = 104/300 (34.67%), Postives = 159/300 (53.00%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINP-LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N+     ++NPF++S+   P   ++      +P  QP   KP   E  P  ++   +  +    LL+R +EL R+ AEL +RE+E+  +      +   N+PP P  F + PCFYQDF V+I   F+ TV+L Y++WM ++  +F+NIFG L +  VD A +       L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G +  G+CGWI+S   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPN----VPNTQPAIMKPT--EEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKN---NWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP1 (secretory carrier membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:10563])

HSP 1 Score: 156.762 bits (395), Expect = 1.815e-44
Identity = 98/263 (37.26%), Postives = 142/263 (53.99%), Query Frame = 3
Query:  162 IPAVQPTASKPNLNETTPILSEFKTKEQIINP-LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +P  QP   KP   E  P  ++   +  +    LL+R +EL R+ AEL +RE+E+  +      +   N+PP P  F + PCFYQDF V+I   F+ TV+L Y++WM ++  +F+NIFG L +  VD A +       L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G +  G+CGWI+S   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   30 VPNTQPAIMKPT--EEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKN---NWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 284          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP2 (secretory carrier membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:10564])

HSP 1 Score: 134.035 bits (336), Expect = 1.014e-35
Identity = 95/285 (33.33%), Postives = 161/285 (56.49%), Query Frame = 3
Query:   87 TDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIK--NFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSY-FGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQ 932
             +FNPF+E+  A       +P      + QP   +P++  T P      +  Q    LL++ +EL+R+ AEL ++E+EL   ++     H++  N+PP P W  ++PCFYQDF  EI + ++   ++ Y++WML+S  +F+N+   L +      +S     FGLS+L F + +P +++ W+RP+YK FRS +S +FF+F   F   + + +IQ +GI  LG  GWI +   L ++     + MMV+   FT+    S+FL+ +V+ LYR +  S  +A+ EF+Q
Sbjct:   35 AEFNPFSETNAATTVPVTQLPG-----SSQPAVLQPSVEPTQPTPQAVVSAAQA--GLLRQQEELDRKAAELERKEREL---QNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWF---SGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQ 306          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP3 (secretory carrier membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:10565])

HSP 1 Score: 122.094 bits (305), Expect = 2.970e-31
Identity = 83/230 (36.09%), Postives = 130/230 (56.52%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            LL++ +ELNR+  EL +RE+EL       T     N+PP P +  ++PCF+QD  +EI   F+ TV   Y++WM  +  + +N    L    V+   + + + FGLS+L   L +P S+V W+RP+YK FRS SS NFF+F   F V  VL ++Q +GI   G  GWI++ +V        + M+++ + FT I    + ++ +++ LYR +  S  KA+ EFA    SN
Sbjct:   73 LLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVE---TNNGAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSN 299          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Match: SCAMP3 (secretory carrier membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:10565])

HSP 1 Score: 122.094 bits (305), Expect = 2.970e-31
Identity = 83/230 (36.09%), Postives = 130/230 (56.52%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            LL++ +ELNR+  EL +RE+EL       T     N+PP P +  ++PCF+QD  +EI   F+ TV   Y++WM  +  + +N    L    V+   + + + FGLS+L   L +P S+V W+RP+YK FRS SS NFF+F   F V  VL ++Q +GI   G  GWI++ +V        + M+++ + FT I    + ++ +++ LYR +  S  KA+ EFA    SN
Sbjct:   73 LLKKQEELNRKAEELDRRERELQHAALGGTATRQNNWPPLPSFCPVQPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFLACLASFCVE---TNNGAGFGLSILWVLLFTPCSFVCWYRPMYKAFRSDSSFNFFVFFFIFFVQDVLFVLQAIGIPGWGFSGWISALVVPKGNTAVSVLMLLVALLFTGIAVLGIVMLKRIHSLYRRTGASFQKAQQEFAAGVFSN 299          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 125.946 bits (315), Expect = 1.155e-33
Identity = 82/244 (33.61%), Postives = 126/244 (51.64%), Query Frame = 3
Query:  252 NPLLQRADELNRREAELIKREKELGKIEHQATGDHI------------KNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            + L ++  +L RR  EL  RE+EL + +  A G +              N+PP P    I PCFYQD +VEI  +F+ TV   Y+++++Y   + +N+  +L YMI    S        + L LF   S L    WFRP+YK FR+ SS NF +F      + + T +Q LG++   +CGWIN+    +      + M++  + FTV L   +  + KV+RLYR +  S+DKA+ EF     S+
Sbjct:    3 DELFRKQQDLERRAQELRMREEELDRRQRSAAGGNNLNTNAQNNAPRPHNWPPLPTIIPIEPCFYQDIEVEIPVQFQKTVTFAYYVFLMYVLALVVNVLASLFYMIFAGGSIGQLFLACIQLALFSPCSFLF---WFRPVYKAFRNDSSFNFMVFFFVLFFHCIFTFVQTLGLSNY-ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAGFSIDKARQEFTNGVMSD 242          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 127.102 bits (318), Expect = 1.849e-33
Identity = 85/266 (31.95%), Postives = 135/266 (50.75%), Query Frame = 3
Query:  186 SKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHI------------KNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            ++P  +++T  L        + + L ++  +L RR  EL  RE+EL + +  A G +              N+PP P    I PCFYQD +VEI  +F+ TV   Y+++++Y   + +N+  +L YMI    S        + L LF   S L    WFRP+YK FR+ SS NF +F      + + T +Q LG++   +CGWIN+    +      + M++  + FTV L   +  + KV+RLYR +  S+DKA+ EF     S+
Sbjct:   49 AQPTTHQSTGSLG--NKSAGMDDELFRKQQDLERRAQELRMREEELDRRQRSAAGGNNLNTNAQNNAPRPHNWPPLPTIIPIEPCFYQDIEVEIPVQFQKTVTFAYYVFLMYVLALVVNVLASLFYMIFAGGSIGQLFLACIQLALFSPCSFLF---WFRPVYKAFRNDSSFNFMVFFFVLFFHCIFTFVQTLGLSNY-ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAGFSIDKARQEFTNGVMSD 308          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Match: scm-1 (Secretory carrier-associated membrane protein [Source:UniProtKB/TrEMBL;Acc:G5EED5])

HSP 1 Score: 68.5514 bits (166), Expect = 1.710e-13
Identity = 41/110 (37.27%), Postives = 63/110 (57.27%), Query Frame = 3
Query:  621 WFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGI-NWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            WFRP+YK FR+ SS NF +F      + + T +Q LG+ N+  +CGWIN+    +      + M++  + FTV L   +  + KV+RLYR +  S+DKA+ EF     S+
Sbjct:   45 WFRPVYKAFRNDSSFNFMVFFFVLFFHCIFTFVQTLGLSNY--ACGWINALDTFNVSVPIALLMLISAITFTVALTGMVTALVKVHRLYRGAGFSIDKARQEFTNGVMSD 152          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Match: Scamp (gene:FBgn0040285 transcript:FBtr0332591)

HSP 1 Score: 140.584 bits (353), Expect = 2.465e-38
Identity = 96/287 (33.45%), Postives = 150/287 (52.26%), Query Frame = 3
Query:   90 DFNPFNESKXXXXXXXXXXXXXXFIPAVQ--PTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFG------AGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEF 926
            D+NPF E               V  P  Q  P     +L  + P  S   T E+    L +R +EL+R+ AEL +RE++L     Q     + N+PP P  FC++PCFYQDF+VEI   F+  V+  Y+IW+ Y+  +  N+ G L  +      +    TF L++    L SP SYV WFRP YK FR+ SS NF +F   +    + +++Q +G N +G CG+I +   +  + G       GI ++ +   FT +  A++ ++ K++ +YR++  SM KA+AEF
Sbjct:   42 DYNPFEEQAKPQLQINSTNTAAVVQPLSQNIPPPQTSSLGASAPSTSIQITSEE----LQRRQEELDRKAAELDRREQQL-----QGNVPQLNNWPPLPDNFCVKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLF----HAGEFETFFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFITA---IGQFDGQASGIIVGILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEF 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Match: Scamp (gene:FBgn0040285 transcript:FBtr0074079)

HSP 1 Score: 140.584 bits (353), Expect = 2.465e-38
Identity = 96/287 (33.45%), Postives = 150/287 (52.26%), Query Frame = 3
Query:   90 DFNPFNESKXXXXXXXXXXXXXXFIPAVQ--PTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFG------AGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEF 926
            D+NPF E               V  P  Q  P     +L  + P  S   T E+    L +R +EL+R+ AEL +RE++L     Q     + N+PP P  FC++PCFYQDF+VEI   F+  V+  Y+IW+ Y+  +  N+ G L  +      +    TF L++    L SP SYV WFRP YK FR+ SS NF +F   +    + +++Q +G N +G CG+I +   +  + G       GI ++ +   FT +  A++ ++ K++ +YR++  SM KA+AEF
Sbjct:   42 DYNPFEEQAKPQLQINSTNTAAVVQPLSQNIPPPQTSSLGASAPSTSIQITSEE----LQRRQEELDRKAAELDRREQQL-----QGNVPQLNNWPPLPDNFCVKPCFYQDFEVEIPPEFQKLVKRLYYIWIFYTMTLLANVIGGLILLF----HAGEFETFFLAIFYTMLFSPASYVCWFRPAYKAFRNDSSFNFMVFFFIYFFQTLYSIVQAVGFNKMGYCGFITA---IGQFDGQASGIIVGILLLNVAFCFTAVAVANVLMITKIHSIYRSTGASMAKAQAEF 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp1 (secretory carrier membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1803])

HSP 1 Score: 145.976 bits (367), Expect = 2.271e-40
Identity = 97/289 (33.56%), Postives = 154/289 (53.29%), Query Frame = 3
Query:   90 DFNPFNESKXXX--XXXXXXXXXXXFIPAV-QPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            ++NPF ++KP         V P     PA+ +PT   P   ++     + + + +    LL+R +EL R+ AEL +RE+E+  +   A+G    N+PP P  F + PCFY D  V+I   ++ TV++ Y++WM ++  +F NIFG L++  VD +         L  +LF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q +GI   G+ GWI++   L++    GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    +N
Sbjct:   36 EYNPFTDTKPVPPGSAPKSVPPTTNTQPAIMKPTEEPPAYTQSQQTPDQSRAQAE----LLRRQEELERKAAELDRREREMQSL--NASGGRKNNWPPLPEKFPVGPCFYHDISVDIPVEYQKTVKIMYYLWMFHTGTLFANIFGCLSWFCVDASRGVDFGLAMLWFMLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAIGITGWGASGWISALTGLNTSIPVGIIMILIAALFTASAVISLIMFKKVHALYRTTGASFEKAQQEFATGVMAN 315          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp3 (secretory carrier membrane protein 3 [Source:ZFIN;Acc:ZDB-GENE-041114-33])

HSP 1 Score: 130.954 bits (328), Expect = 1.087e-34
Identity = 92/230 (40.00%), Postives = 129/230 (56.09%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            LL++ +EL R+  EL +RE+EL      +      N+PP P +  + PCFYQD ++EI   F+ TV   Y+ WM  +  + IN+   L    VD     +   FGL++L F L +P S+V W+RP+YK FRS SS NFF F   F   LVL ++  +GI   G  GWI S   LS+    G  MM+  V FT  LA  + L+ +V+ +YR +E S +KA+AEFA    SN
Sbjct:   92 LLKKQEELERKAQELERRERELNAHALGSGASRQNNWPPLPSFCPVGPCFYQDINLEISQSFQRTVTTMYYYWMFTACTLLINLISCLAVFCVDP---NNGVGFGLAILWFLLFTPCSFVCWYRPVYKAFRSDSSFNFFAFFFVFFAQLVLYVMMTIGIPGWGFSGWIVSLAALSTSKAVGAIMMMNAVLFTAQLAMGIVLLKRVHSMYRQTEASFEKAQAEFATGVLSN 318          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp2l (secretory carrier membrane protein 2, like [Source:ZFIN;Acc:ZDB-GENE-030131-6432])

HSP 1 Score: 120.168 bits (300), Expect = 8.069e-31
Identity = 90/254 (35.43%), Postives = 147/254 (57.87%), Query Frame = 3
Query:  186 SKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            S+P + +TT   S   +       LL++  EL R+ AEL ++E+EL   +  A      N+PP P++  I+PCFYQDF+ EI   ++   ++ Y++WM +S  +F+N+   L Y  V     ++   FGLS+L F L +P+++V W+RP+YK F+S SS +FF F   F+  +++ +IQ +GI   G+ GWI +  V+ +     +FMMV+   FTV    S+ L+  V+ +YR +  S  KA+ EF+Q   +N
Sbjct:   57 SQPAVLQTTVEPSPQASVASGQAELLRQQAELERKAAELERKEQELR--DRDAARGKENNWPPLPKFLPIKPCFYQDFNEEIPVEYQRVCKMMYYLWMYHSVTLFLNLLACLVYFTVST---QNGVDFGLSILWFILFTPVAFVCWYRPVYKAFKSDSSFSFFFFFFIFSFQVIVYIIQSVGIPGWGNSGWITAISVIKTNIALSVFMMVVAGFFTVNAVFSVILLKMVHSMYRHTGASFQKAQEEFSQGVVTN 305          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp4 (secretory carrier membrane protein 4 [Source:ZFIN;Acc:ZDB-GENE-050913-40])

HSP 1 Score: 117.857 bits (294), Expect = 8.299e-31
Identity = 83/199 (41.71%), Postives = 112/199 (56.28%), Query Frame = 3
Query:  351 DHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            D   NFPP P++  I+PCFYQ+FD EI    R  VR  Y +WMLYS  + +N+ G + +     A   +++ FG SLL   + SP SY  WFRPLYK FR+ SS NF  F   F +  VL  IQ LGI+  G CGWI + I   +   A IFM++  + FTV      F++ KV+RLYR    S  +A+ E+   +  N
Sbjct:    3 DRTNNFPPLPKFLRIKPCFYQNFDEEIPQPHRQLVRRVYNLWMLYSMTLCVNVVGCIAWW----AGGGNATNFGFSLLWLLIFSPCSYTCWFRPLYKAFRADSSFNFMAFFFIFFLQCVLAFIQSLGISGWGVCGWIATVIFFGTDVVAAIFMLICTLLFTVNALLMAFVLIKVHRLYRGGGGSFQRAQEEWTTGAWKN 197          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Match: scamp4 (secretory carrier membrane protein 4 [Source:ZFIN;Acc:ZDB-GENE-050913-40])

HSP 1 Score: 117.857 bits (294), Expect = 8.299e-31
Identity = 83/199 (41.71%), Postives = 112/199 (56.28%), Query Frame = 3
Query:  351 DHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            D   NFPP P++  I+PCFYQ+FD EI    R  VR  Y +WMLYS  + +N+ G + +     A   +++ FG SLL   + SP SY  WFRPLYK FR+ SS NF  F   F +  VL  IQ LGI+  G CGWI + I   +   A IFM++  + FTV      F++ KV+RLYR    S  +A+ E+   +  N
Sbjct:    3 DRTNNFPPLPKFLRIKPCFYQNFDEEIPQPHRQLVRRVYNLWMLYSMTLCVNVVGCIAWW----AGGGNATNFGFSLLWLLIFSPCSYTCWFRPLYKAFRADSSFNFMAFFFIFFLQCVLAFIQSLGISGWGVCGWIATVIFFGTDVVAAIFMLICTLLFTVNALLMAFVLIKVHRLYRGGGGSFQRAQEEWTTGAWKN 197          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 153.295 bits (386), Expect = 6.038e-43
Identity = 102/302 (33.77%), Postives = 156/302 (51.66%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETT-PILSEFKTKEQIIN--PLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N+ +   ++NPF++S+   P   +       +P   P+     +N T  P      +KE  I    LL+R +EL ++ AEL +RE+E+  +     G    N+PP P  F + PCFYQDF V+I   F+ TV++ Y++WM ++  +F+NIFG L +  VD           L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G    G+CGWI++   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNVPSGLEEYNPFSDSQTPQPAKVK-------MPTAAPSTQPAIMNPTEEPSAYNQISKEHAIAQAELLKRQEELEKKAAELDRREREMQSLNQ--PGGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHTVTLFVNIFGCLAWFCVDSGRGVDFGLAILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 153.295 bits (386), Expect = 6.557e-43
Identity = 102/302 (33.77%), Postives = 156/302 (51.66%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETT-PILSEFKTKEQIIN--PLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N+ +   ++NPF++S+   P   +       +P   P+     +N T  P      +KE  I    LL+R +EL ++ AEL +RE+E+  +     G    N+PP P  F + PCFYQDF V+I   F+ TV++ Y++WM ++  +F+NIFG L +  VD           L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G    G+CGWI++   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNVPSGLEEYNPFSDSQTPQPAKVK-------MPTAAPSTQPAIMNPTEEPSAYNQISKEHAIAQAELLKRQEELEKKAAELDRREREMQSLNQ--PGGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHTVTLFVNIFGCLAWFCVDSGRGVDFGLAILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:549944])

HSP 1 Score: 153.295 bits (386), Expect = 9.418e-43
Identity = 102/302 (33.77%), Postives = 156/302 (51.66%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETT-PILSEFKTKEQIIN--PLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N+ +   ++NPF++S+   P   +       +P   P+     +N T  P      +KE  I    LL+R +EL ++ AEL +RE+E+  +     G    N+PP P  F + PCFYQDF V+I   F+ TV++ Y++WM ++  +F+NIFG L +  VD           L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G    G+CGWI++   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNVPSGLEEYNPFSDSQTPQPAKVK-------MPTAAPSTQPAIMNPTEEPSAYNQISKEHAIAQAELLKRQEELEKKAAELDRREREMQSLNQ--PGGRKNNWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHTVTLFVNIFGCLAWFCVDSGRGVDFGLAILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAAGFQGWGNCGWISALTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 312          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp2 (secretory carrier membrane protein 2 [Source:NCBI gene;Acc:407901])

HSP 1 Score: 132.109 bits (331), Expect = 5.524e-35
Identity = 98/290 (33.79%), Postives = 162/290 (55.86%), Query Frame = 3
Query:   90 DFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNL----NETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +FNPF+E         +       IPA QP  S+P +     E TP  +    +      LLQ+ +EL R+ A+L ++E+E+  +      +   N+PP P    I+PCFYQD  V+I + ++ T ++ Y++WML++F +F+N+   L+Y     A S     FGLS+L F + +P +++ W+RP+YK FR+ SS +FF+F + F   +V+ +IQ +GI   G  GWI +  ++ +     + M+V+   FTV    SLFL+ +V+ +YR +  S  +A+ EF+Q   SN
Sbjct:   36 EFNPFSEGSHLTNPNQKT------IPA-QPAQSQPAVLQPSVEPTPQAAAMAAQTG----LLQQQEELERKAADLDRKEQEMRNVNINLRQN---NWPPLPPKCPIKPCFYQDISVDIPADYQRTCKMLYYLWMLHTFTLFLNLLACLSYF---TAVSTGGVDFGLSILWFVMFTPCAFLCWYRPIYKAFRTDSSFSFFVFFIIFFCQIVIYIIQAVGIPGWGDSGWIMALSMIKTNIAVTVIMIVVASFFTVCSVFSLFLLKRVHSMYRRTGASFQRAQEEFSQGILSN 308          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Match: scamp5 (secretory carrier membrane protein 5 gene 2 [Source:NCBI gene;Acc:779947])

HSP 1 Score: 117.472 bits (293), Expect = 2.147e-30
Identity = 69/199 (34.67%), Postives = 106/199 (53.27%), Query Frame = 3
Query:  351 DHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            D   NFPP PR+  ++PCFYQDFD +I    R T +  Y++WML S  + +N+ G L ++I   +++     F   +L            WFRP+YK F++ SS NF  F   F   LV+++IQ +GI   G CGWI +     +  GA + M++  + FT +   S   + KV+R YR +  S+ KA+ E+   +  N
Sbjct:    3 DKPNNFPPLPRFIPLKPCFYQDFDTDIPDLHRTTAKRLYYLWMLNSITLGVNLIGCLAWLIGGGSATNFGLAFLWLILFTPCSYVC----WFRPIYKAFKTDSSFNFMAFFFTFTGQLVISIIQAVGIPGWGVCGWIATISFFGTSIGAAVVMLIPTIMFTAVAVLSFVALTKVHRFYRGAGGSLSKAQEEWTTGAWKN 197          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 159.844 bits (403), Expect = 1.435e-45
Identity = 106/301 (35.22%), Postives = 162/301 (53.82%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIIN--PLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N+     ++NPF++S+   P + ++      +P  QP   KP   E  P  ++  TKE  +    LL+R +EL R+ AEL +RE+E+  +      +   N+PP P  F + PCFYQDF V+I   F+ TV+L Y++WM ++  +F+NIFG L +  VD + +       L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G +  G+CGWI+S   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNVPPGLDEYNPFSDSRTPPPGSVKMPN----VPNTQPAIMKPT--EEHPAYTQI-TKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKN---NWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 156.377 bits (394), Expect = 1.056e-44
Identity = 100/264 (37.88%), Postives = 144/264 (54.55%), Query Frame = 3
Query:  162 IPAVQPTASKPNLNETTPILSEFKTKEQIIN--PLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +P  QP   KP   E  P  ++  TKE  +    LL+R +EL R+ AEL +RE+E+  +      +   N+PP P  F + PCFYQDF V+I   F+ TV+L Y++WM ++  +F+NIFG L +  VD + +       L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G +  G+CGWI+S   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:    4 VPNTQPAIMKPT--EEHPAYTQI-TKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKN---NWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 258          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp1 (secretory carrier membrane protein 1 [Source:MGI Symbol;Acc:MGI:1349480])

HSP 1 Score: 156.377 bits (394), Expect = 1.056e-44
Identity = 100/264 (37.88%), Postives = 144/264 (54.55%), Query Frame = 3
Query:  162 IPAVQPTASKPNLNETTPILSEFKTKEQIIN--PLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +P  QP   KP   E  P  ++  TKE  +    LL+R +EL R+ AEL +RE+E+  +      +   N+PP P  F + PCFYQDF V+I   F+ TV+L Y++WM ++  +F+NIFG L +  VD + +       L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G +  G+CGWI+S   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:    4 VPNTQPAIMKPT--EEHPAYTQI-TKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKN---NWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 258          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp2 (secretory carrier membrane protein 2 [Source:MGI Symbol;Acc:MGI:1346518])

HSP 1 Score: 133.265 bits (334), Expect = 1.380e-35
Identity = 99/297 (33.33%), Postives = 166/297 (55.89%), Query Frame = 3
Query:   54 ITMSSNLDNSQ-TDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIK--NFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINS-SIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQ 932
            +T  +N   S   +FNPF+E+  A    A   P P      QP   +P++    P  +           LL++ +EL+R+ AEL ++E+EL   ++ A   H++  N+PP P W  ++PCFYQDF  EI + ++   ++ Y++WML+S  +F+N+   L +   D A   + + FGLS+L F + +P +++ W+RP+YK FRS +S +FF+F   F   + +  IQ +G+  LG+ GW+ + S + +      I MMV+   FT+    SLFL+ +V+  YR +  S  +A+ EF+Q
Sbjct:   23 VTQLTNAPQSGLAEFNPFSETNAATTVPATQAPGPS-----QPAVLQPSVEPAQP--TPQAVAAAAQAGLLRQQEELDRKAAELERKEREL---QNTAANLHVRDNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFTSDAA---NGTAFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYFIQLIGLPNLGTSGWLAALSTMKNGPLAVTIIMMVVAGFFTLCAGLSLFLLQRVHAFYRRTGASFQQAQEEFSQ 306          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Match: Scamp3 (secretory carrier membrane protein 3 [Source:MGI Symbol;Acc:MGI:1346346])

HSP 1 Score: 118.627 bits (296), Expect = 5.401e-30
Identity = 82/230 (35.65%), Postives = 125/230 (54.35%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            LL++ +ELNR+  EL +RE+EL  +     G    N+PP P +  ++PCF+QD  +EI   F+ TV   Y++WM  +  + +N F  L    VD  S        L LLLF   S +    W+RP+YK FRS SS NFF+F   F V  V  ++Q +GI   G  GW+ + +V+ S     + M+++ + FT I    + ++ +++ LYR +  S  KA+ EFA    SN
Sbjct:  101 LLKKQEELNRKAEELDRRERELQHVALGGAGTRQNNWPPLPSFCPVKPCFFQDISMEIPQEFQKTVSTMYYLWMCSTLALLLNFFACLARFCVDTGSGSGFGLSMLWLLLFTPCSFVC---WYRPMYKAFRSDSSFNFFVFFFIFFVQDVFFVLQAIGIPGWGFSGWVTALVVVGSKPAVAVLMLLVALLFTGIAVLGIVMLKRIHSLYRQTGASFQKAQQEFAAGVFSN 327          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|O15126|SCAM1_HUMAN (Secretory carrier-associated membrane protein 1 OS=Homo sapiens OX=9606 GN=SCAMP1 PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 6.310e-45
Identity = 104/300 (34.67%), Postives = 159/300 (53.00%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINP-LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N+     ++NPF++S+   P   ++      +P  QP   KP   E  P  ++   +  +    LL+R +EL R+ AEL +RE+E+  +      +   N+PP P  F + PCFYQDF V+I   F+ TV+L Y++WM ++  +F+NIFG L +  VD A +       L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G +  G+CGWI+S   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPN----VPNTQPAIMKPT--EEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKN---NWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSARAVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|Q8K021|SCAM1_MOUSE (Secretory carrier-associated membrane protein 1 OS=Mus musculus OX=10090 GN=Scamp1 PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.004e-44
Identity = 106/301 (35.22%), Postives = 162/301 (53.82%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIIN--PLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N+     ++NPF++S+   P + ++      +P  QP   KP   E  P  ++  TKE  +    LL+R +EL R+ AEL +RE+E+  +      +   N+PP P  F + PCFYQDF V+I   F+ TV+L Y++WM ++  +F+NIFG L +  VD + +       L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G +  G+CGWI+S   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNVPPGLDEYNPFSDSRTPPPGSVKMPN----VPNTQPAIMKPT--EEHPAYTQI-TKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKN---NWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|P56603|SCAM1_RAT (Secretory carrier-associated membrane protein 1 OS=Rattus norvegicus OX=10116 GN=Scamp1 PE=1 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 1.306e-44
Identity = 106/301 (35.22%), Postives = 161/301 (53.49%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIIN--PLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N+     ++NPF++S+   P   ++      +P  QP   KP   E  P  ++  TKE  +    LL+R +EL R+ AEL +RE+E+  +      +   N+PP P  F + PCFYQDF V+I   F+ TV+L Y++WM ++  +F+NIFG L +  VD + +       L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G +  G+CGWI+S   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNVPPGLDEYNPFSDSRTPPPGGVKMPN----VPNTQPAIMKPT--EEHPAYTQI-TKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKN---NWPPLPSNFPVGPCFYQDFSVDIPVEFQKTVKLMYYLWMFHAVTLFLNIFGCLAWFCVDSSRAVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNKNIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|O77735|SCAM1_PIG (Secretory carrier-associated membrane protein 1 OS=Sus scrofa OX=9823 GN=SCAMP1 PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 3.167e-44
Identity = 102/300 (34.00%), Postives = 159/300 (53.00%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINP-LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N+     ++NPF++S+   P   ++      +P+ QP   KP   E  P  ++   +  +    LL+R +EL R+ AEL +RE+E+  +      +   N+PP P  F + PCFYQDF V+I   F+ TV++ Y++WM ++  +F+NIFG L +  VD +         L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q  G +  G+CGWI+S   L+     GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNVPPGLDEYNPFSDSRTPPPGNVKMPN----VPSTQPAIMKPT--EEHPAYTQIAKEHALAQAELLKRQEELERKAAELDRREREMQNLSQHGRKN---NWPPLPGNFPVGPCFYQDFSVDIPVEFQKTVKIMYYLWMFHAVTLFLNIFGCLAWFCVDPSRGVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYICQFAVHVLQAAGFHNWGNCGWISSLTGLNQSIPVGIMMIIIAALFTASAVISLVMFKKVHGLYRTTGASFEKAQQEFATGVMSN 310          
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Match: sp|O15127|SCAM2_HUMAN (Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2)

HSP 1 Score: 134.035 bits (336), Expect = 4.869e-35
Identity = 95/285 (33.33%), Postives = 161/285 (56.49%), Query Frame = 3
Query:   87 TDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIK--NFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSY-FGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQ 932
             +FNPF+E+  A       +P      + QP   +P++  T P      +  Q    LL++ +EL+R+ AEL ++E+EL   ++     H++  N+PP P W  ++PCFYQDF  EI + ++   ++ Y++WML+S  +F+N+   L +      +S     FGLS+L F + +P +++ W+RP+YK FRS +S +FF+F   F   + + +IQ +GI  LG  GWI +   L ++     + MMV+   FT+    S+FL+ +V+ LYR +  S  +A+ EF+Q
Sbjct:   35 AEFNPFSETNAATTVPVTQLPG-----SSQPAVLQPSVEPTQPTPQAVVSAAQA--GLLRQQEELDRKAAELERKEREL---QNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWF---SGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQ 306          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A267H8L5 (Secretory carrier-associated membrane protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032262g1 PE=3 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 8.528e-51
Identity = 102/232 (43.97%), Postives = 148/232 (63.79%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXX--XXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            L  ++ EL RREAE  +R++E       A      N+PP P    + PCFYQDFD EI + +R  V+LGY++W+++S ++ +NI G LTY IV   +   +S     +SLL+  +L P SY+ WFRPLYK F++ SS NFF F +  AV + + ++QCLGIN+LGSCGWIN +  L    GAG+FMMVI   FT+++ A + L+ +V+R+YR+S  S  KA+ E +Q   +N
Sbjct:   54 LEAKSRELERREAE--QRQREAESSAGAAGSQSPNNWPPLPACCPVGPCFYQDFDQEIPAEYRLVVKLGYYLWLVHSVLLLVNIIGTLTYFIVSPKTDAITSGTVFGVSLLVCIILVPCSYLCWFRPLYKAFKNDSSFNFFFFFLLIAVQICVLIVQCLGINYLGSCGWINGAATLKVKLGAGVFMMVIAALFTLLVIADVLLIIRVHRIYRSSGASFAKARQELSQGVAAN 283          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A1I8GUV9 (Secretory carrier-associated membrane protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 181.8 bits (460), Expect = 1.452e-50
Identity = 102/232 (43.97%), Postives = 148/232 (63.79%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXX--XXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            L  ++ EL RREAE  +R++E       A      N+PP P    + PCFYQDFD EI + +R  V+LGY++W+++S ++ +NI G LTY IV   +   +S     +SLL+  +L P SY+ WFRPLYK F++ SS NFF F +  AV + + ++QCLGIN+LGSCGWIN +  L    GAG+FMMVI   FT+++ A + L+ +V+R+YR+S  S  KA+ E +Q   +N
Sbjct:   80 LEAKSRELERREAE--QRQREAESSAGAAGSQSPNNWPPLPACCPVGPCFYQDFDQEIPAEYRLVVKLGYYLWLVHSVLLLVNIIGTLTYFIVSPKTDAITSGTVFGVSLLVCIILVPCSYLCWFRPLYKAFKNDSSFNFFFFFLLIAVQICVLIVQCLGINYLGSCGWINGAATLKVKLGAGVFMMVIAALFTLLVIADVLLIIRVHRIYRSSGASFAKARQELSQGVAAN 309          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A0R3W328 (Secretory carrier-associated membrane protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4287 PE=3 SV=1)

HSP 1 Score: 180.644 bits (457), Expect = 2.277e-50
Identity = 104/259 (40.15%), Postives = 155/259 (59.85%), Query Frame = 3
Query:  198 LNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREK-----ELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSNIFAA 959
            L  T P+L+        +  L +R  EL++R A+L  REK     E  +IEH      I N+PP PRW C +PC   DF+ +I S  R     G++ W+ YS ++ +N+FG L+Y+IV K   ES + FG+S+++F +L+P     W RPLYK  R  SS+ F +F  FFA  +++  IQ LGI++LG+CGWINS  V +S    G FM+++   F++  AA+++L+F+V+  YR S  SM +AK E AQ   ++ FAA
Sbjct:   63 LPSTQPVLT--------VADLQRRQAELDQRAAQLDLREKQAQQQEAWRIEHGYGTADIPNWPPLPRWCCFKPCIRVDFNSDIPSHCRWMAMYGHYFWLAYSCLLLLNVFGTLSYLIVSKTLEESGALFGVSIVVFLILTPAGCFCWNRPLYKALRKNSSMQFCLFFPFFAAQILIIFIQVLGIDYLGACGWINSLKVFASTPSVGTFMLILAALFSLAGAAAVYLIFRVHMYYRGSGASMQRAKQELAQDMAASSFAA 313          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A267H8C9 (Secretory carrier-associated membrane protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003135g2 PE=3 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 5.236e-50
Identity = 103/232 (44.40%), Postives = 149/232 (64.22%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXX--XXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            L  ++ EL RREAE  +R++E       A      N+PP P    + PCFYQDFD EI + +R  V+LGY++W+++S ++ +NI G LTY IV   +   +S     +SLL+  +L P SY+ WFRPLYK F++ SS NFF F + FAV + + ++QCLGIN+LGSCGWIN +  L    GAG+FMMVI   FT+++ A + L+ +V+R+YR+S  S  KA+ E +Q   +N
Sbjct:   62 LEAKSRELERREAE--QRQREAESSAGAAGSQSPNNWPPLPACCPVGPCFYQDFDQEIPAEYRLVVKLGYYLWLVHSVLLLVNIIGTLTYFIVSPKTDAITSGTVFGVSLLVCIILVPCSYLCWFRPLYKAFKNDSSFNFFFFFLLFAVQICVLIVQCLGINYLGSCGWINGAATLKVKLGAGVFMMVIAALFTLLVIADVLLIIRVHRIYRSSGASFAKARQELSQGVAAN 291          
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Match: A0A267GUG7 (Secretory carrier-associated membrane protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003135g1 PE=3 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 1.069e-49
Identity = 105/234 (44.87%), Postives = 150/234 (64.10%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKE--LGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXX--XXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            L  ++ EL RREAE  +RE E   G +  Q       N+PP P    + PCFYQDFD EI + +R  V+LGY++W+++S ++ +NI G LTY IV   +   +S     +SLL+  +L P SY+ WFRPLYK F++ SS NFF F + FAV + + ++QCLGIN+LGSCGWIN +  L    GAG+FMMVI   FT+++ A + L+ +V+R+YR+S  S  KA+ E +Q   +N
Sbjct:   56 LEAKSRELERREAEQRQREAESSAGAVGSQ----RPNNWPPLPACCPVGPCFYQDFDQEIPAEYRLVVKLGYYLWLVHSVLLLVNIIGTLTYFIVSPKTEAITSGTVFGVSLLVCIILVPCSYLCWFRPLYKAFKNDSSFNFFFFFLLFAVQICVLIVQCLGINYLGSCGWINGAATLKVKLGAGVFMMVIAALFTLLVIADVLLIIRVHRIYRSSGASFAKARQELSQGVAAN 285          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:103025528])

HSP 1 Score: 147.902 bits (372), Expect = 3.841e-41
Identity = 104/302 (34.44%), Postives = 166/302 (54.97%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNESKXXX--XXXXXXXXXXXFIPAV-QPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  ++ N      ++NPF ++KPA        + P     PA+ +PT   P  +++     + + + +    L++R +EL R+ AEL +RE+E+  +   A+G    N+PP P  F + PCFY D  V+I   F+ TV++ Y++WM ++  +F+NIFG L +  VD         FGL++L F L +P S+V W+RPLY  FRS SS  FF+F   +     + ++Q +GI   G+ GWI++   L++    GI M++I   FT     SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   23 VTQVTRNAPPGLEEYNPFTDTKPAPPGSAPKAMPPTTNTQPAIMKPTEEPPAYSQSQQTQDQARAQAE----LMRRQEELERKAAELDRREREMQSLS--ASGGRKNNWPPLPEKFPVGPCFYHDISVDIPVEFQKTVKIMYYLWMFHTGTLFLNIFGCLAWFCVDP---YRGVDFGLAMLWFLLFTPCSFVCWYRPLYGAFRSDSSFRFFVFFFVYICQFGVHVLQAIGIAGWGASGWISALTGLNTSIPVGIIMILIAALFTASAVISLIMFKKVHGLYRTTGASFEKAQQEFATGVMSN 315          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp2 (secretory carrier-associated membrane protein 2 [Source:NCBI gene;Acc:103046607])

HSP 1 Score: 134.806 bits (338), Expect = 3.536e-36
Identity = 104/310 (33.55%), Postives = 155/310 (50.00%), Query Frame = 3
Query:   66 SNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINP----------------LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            SN   +  D NPF +      T + V     + P   P +   NL  +T   S   ++  ++ P                LL++ +EL R+ AEL +RE+EL +   + TG    N+PP PR F I+PCFYQDF  EI    +   ++ Y++WMLY   +F+N+   L +   D           L  +LF   S L    WFRP+YK FR+ SS+NFF F   F   +V+T+IQ +GI   G+ GWI++  V+ S     + MMV+   FTV    S+ L+  V+  YR +  S +KA+ EF+Q   +N
Sbjct:    6 SNPFGNPVDVNPFQDPSVTEVTHSGVDHMDQYTPF--PASDTGNLTGSTIPASAVPSQPAVLQPSVEPSPQATAAAAQANLLRQQEELERKAAELDRREQEL-QNRDRTTGKE-NNWPPLPRSFPIKPCFYQDFSEEIPPEHQRICKMMYYLWMLYCVTLFLNVLACLAFFTADAGYGVDFGLSILWFILFTPCSFLC---WFRPVYKAFRTDSSINFFFFFFIFFAQVVVTVIQSVGIPKWGNSGWISAISVVRSNLAVSVVMMVVAAFFTVCATMSIVLLKMVHSHYRRTGASFEKAQQEFSQGVLTN 308          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp2 (secretory carrier-associated membrane protein 2 [Source:NCBI gene;Acc:103046607])

HSP 1 Score: 130.568 bits (327), Expect = 5.419e-35
Identity = 89/230 (38.70%), Postives = 129/230 (56.09%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            LL++ +EL R+ AEL +RE+EL     + TG    N+PP PR F I+PCFYQDF  EI    +   ++ Y++WMLY   +F+N+   L +   D           L  +LF   S L    WFRP+YK FR+ SS+NFF F   F   +V+T+IQ +GI   G+ GWI++  V+ S     + MMV+   FTV    S+ L+  V+  YR +  S +KA+ EF+Q   +N
Sbjct:   45 LLRQQEELERKAAELDRREQELQN-RDRTTGKE-NNWPPLPRSFPIKPCFYQDFSEEIPPEHQRICKMMYYLWMLYCVTLFLNVLACLAFFTADAGYGVDFGLSILWFILFTPCSFLC---WFRPVYKAFRTDSSINFFFFFFIFFAQVVVTVIQSVGIPKWGNSGWISAISVVRSNLAVSVVMMVVAAFFTVCATMSIVLLKMVHSHYRRTGASFEKAQQEFSQGVLTN 269          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp3 (secretory carrier membrane protein 3 [Source:NCBI gene;Acc:103021636])

HSP 1 Score: 125.561 bits (314), Expect = 1.086e-32
Identity = 83/230 (36.09%), Postives = 121/230 (52.61%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            LL++ +EL R+  EL +RE+EL             N+PP P +  + PCFYQD +VEI   F+ TV + Y+ WM  + V+  N+   L+   VD +         L +LLF   S +    W+RP+YK FRS SS NFF F   F   +V+ +I  +GI   G  GWI     L      G+ M++  V FT   A  + ++ KV+ +YR ++ S  KA+AEFA +  SN
Sbjct:   90 LLRKQEELERKAKELERRERELDSQSRSTGSSRQNNWPPLPSFCPVGPCFYQDINVEISQAFQRTVTIMYYFWMFTASVLAFNLISCLSLFCVDPSGGVGLGLAILWILLFTPCSFVC---WYRPVYKAFRSDSSFNFFAFFFIFFAQVVVYVIMTIGIPGWGFSGWIVGLYALKKNVAVGVIMLLNAVLFTAQAAMGVVMLKKVHSMYRQTDASFQKAQAEFATEVFSN 316          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Match: scamp2l (secretory carrier-associated membrane protein 2-like [Source:NCBI gene;Acc:103024986])

HSP 1 Score: 114.775 bits (286), Expect = 7.839e-29
Identity = 88/256 (34.38%), Postives = 145/256 (56.64%), Query Frame = 3
Query:  180 TASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
             AS+P + + T   S           LL++  EL R+ AEL ++E++L +    A G    N+PP P++  I+PCFYQDF+ EI   F    ++ Y++WM +   +F+N+   L    V+    +    FGLS+L F L SP +++ W+RP+YK F+S SS +FF F   F+  +++ +IQ +GI   G+ GWI++  VL+   G  +FM+++ + FTV    ++ L+  V+  YR +  S  KA+ EF+Q   +N
Sbjct:   57 AASQPAVLQPTVEPSPRAAAAAAQADLLKQQAELERKAAELQRKEEDL-QSRDTARGKE-NNWPPLPKFLPIKPCFYQDFNEEIPVEFHRVCKMMYYLWMYHCVTLFLNVLACLACFTVNA---QKGIDFGLSILWFLLFSPAAFICWYRPVYKAFKSDSSFSFFFFFFIFSFQVIVYIIQSVGIPSWGNSGWISAISVLNFNIGVAVFMLLVAMFFTVNAVLAVILLKMVHSKYRRTGASFQKAQEEFSQGVVTN 307          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: scamp1 (secretory carrier membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-1803])

HSP 1 Score: 148.673 bits (374), Expect = 3.446e-42
Identity = 100/286 (34.97%), Postives = 145/286 (50.70%), Query Frame = 3
Query:   90 DFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            D+NPF +                 +P  QP   +P   E  P      +       LL+R +EL ++ AEL +RE+E+   + Q       N+PP P    + PCFYQD  VEI   F+ TVR+ Y++WM ++  +F+N+ G L +  V+ A         L  LLF   S +    WFRP+YK FRS SS NFF+F   F    V+ ++Q +GI   G+CGWI S   L+   G GI +M++   FT     S+ ++ KV+ LYR +  S +KA+ EFA    SN
Sbjct:   36 DYNPFGDGSKPGALVGATPA---VLPTSQPAVMQPT-EEPPPYTGPSASAAAAQADLLRRQEELEKKAAELDRREREM---QTQPGAVKKNNWPPLPTQCPVGPCFYQDIPVEIPVEFQKTVRMLYYMWMFHAVTLFLNLLGCLAWFCVNTARGIDFGMAILWFLLFTPCSFVC---WFRPVYKAFRSDSSFNFFLFFFIFFCQFVVHVMQSIGIPGWGNCGWIASLEALNHSIGVGIILMLLAAFFTGSAVLSVVMLKKVHSLYRQTGASFEKAQQEFATGVMSN 311          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: SCAMP5 (secretory carrier membrane protein 5 [Source:HGNC Symbol;Acc:HGNC:30386])

HSP 1 Score: 116.701 bits (291), Expect = 2.478e-31
Identity = 63/199 (31.66%), Postives = 104/199 (52.26%), Query Frame = 3
Query:  351 DHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            D + NFPP P++  ++PCFYQDF+ +I    R +V+  Y++W+++   + +N+ G L ++I   ++          +L            WFR +YK FRS SS N+ +F   F+  +VL +IQ +GI   G CGWI +     +  G G+ M+   + FT +   S   + KV+  YR    S+ KA+ EF+  +  N
Sbjct:    3 DRVNNFPPLPKFVRLKPCFYQDFNEDIPEPHRLSVKRLYYLWIMHGITLVVNLIGCLAWLIGGGSAVNFGLAILWLILFTPCSYVC----WFRAVYKGFRSDSSFNYMLFFFTFSGQVVLNIIQAVGIPGWGVCGWIATISYFGTNIGVGVVMLFPTIMFTGLAVISFLALIKVHSFYRGGGGSVGKAQQEFSTGAWKN 197          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Match: SCAMP5 (secretory carrier membrane protein 5 [Source:HGNC Symbol;Acc:HGNC:30386])

HSP 1 Score: 49.2914 bits (116), Expect = 4.299e-8
Identity = 35/98 (35.71%), Postives = 59/98 (60.20%), Query Frame = 3
Query:  363 NFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIW--MLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFR 650
            NFPP P++  ++PCFYQD + +I      TV+  Y++W   +    + +N+ G L ++I   +    ++ FGL+++   L +P SYV WFRP+YK F+
Sbjct:    9 NFPPLPKFIRLKPCFYQDIEGDIPPPHTQTVKRLYYLWDVSVQGLTLAVNLIGCLAWIIGGGS----ATNFGLAIVWLLLFTPCSYVCWFRPIYKAFK 102          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Nematostella
Match: EDO31962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWE3])

HSP 1 Score: 127.102 bits (318), Expect = 8.911e-34
Identity = 95/315 (30.16%), Postives = 157/315 (49.84%), Query Frame = 3
Query:   51 IITMSSNLDNSQTDFNPFNE--------SKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXX-XXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVI-------GVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +  M+S       DFNPF E        +KP+  T A   P+    P  +   S+P + +T      +  + +  N L +R ++L R+ AEL ++E+EL ++++  +G    NFPP P+WF  +PCFY D  V+I   ++   R  +  W  YSFVMF N   AL  +      + +        +L+ +   P S++ W+RP YK  ++ SS ++ IF + F +++ + +   LG+   GSCG+I ++        A   MM I       GVG   I      L+ KV+R+YR +  S++KA+ EFA+   +N
Sbjct:   18 VTDMTSGASRGLGDFNPFAEQDTSSGLTTKPSPTTTAAPPPQLPPQPQAKTQPSQPAVLQTHQDPPPYVIENEQEN-LRKRQEDLERKAAELQRKEQELQRMQY--SGYRENNFPPLPKWFKCKPCFYHDIQVDIPIEYQKLCRFLFIRWQAYSFVMFYNFIVALALLSTSATGNHNEGKTFGLSILYLVWNVPASFLCWYRPAYKALKNDSSFSYIIFFLIFFLHISINIYYTLGMPGGGSCGFITATDTWHGTNKAVSIMMFICAAMLLAGVGIDCI------LIVKVHRIYRQAGASLEKAQGEFAKGVATN 323          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: SCAMP1 (secretory carrier-associated membrane protein 1 [Source:NCBI gene;Acc:101157947])

HSP 1 Score: 149.828 bits (377), Expect = 4.800e-42
Identity = 107/293 (36.52%), Postives = 154/293 (52.56%), Query Frame = 3
Query:   81 SQTDFNPFNESKXXXXXXXXXXXXXXFIPA----VQPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            S  D NPF +   + P  A     P   PA     QP   KP   E  P  ++ +T+ +    LL+R +EL ++ AEL +RE+EL    H A G    N+PP P  F + PCFY D  V+I   F+ TV++ Y +WM ++  +F+N+FG L + IVD +         L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q +GI   G+CGWI +   L++    GI M++I   FT +   SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:    2 SDFDSNPFADPDFSNPFQAAPGSGPKSAPAPSQNTQPAIMKPT--EEPPAYTQQQTQARAQAELLRRQEELEKKAAELDRRERELQT--HGAAGRK-NNWPPLPEKFPVGPCFYHDIAVDIPVEFQKTVKIMYNLWMFHAGTLFVNMFGCLAWFIVDASRGVDFGLAMLWFLLFTPCSFIC---WYRPLYGAFRSDSSFRFFVFFFIYICQFGVHVLQAIGITGWGTCGWIAALTGLNTSIPVGIIMLLIAALFTALAVGSLIMFKKVHALYRTTGASFEKAQQEFATGVMSN 286          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: SCAMP1 (secretory carrier-associated membrane protein 1 [Source:NCBI gene;Acc:101157947])

HSP 1 Score: 149.058 bits (375), Expect = 1.956e-41
Identity = 104/296 (35.14%), Postives = 156/296 (52.70%), Query Frame = 3
Query:   90 DFNPFNESKXXXXXXXXXXXXXXFIPA----VQPTASKPNLNETTPILSEFKTKEQIIN------PLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            ++NPF +++ A P +          PA     QP   KP   E  P  ++ +T+ +  +       LL+R +EL ++ AEL +RE+EL    H A G    N+PP P  F + PCFY D  V+I   F+ TV++ Y +WM ++  +F+N+FG L + IVD +         L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + ++Q +GI   G+CGWI +   L++    GI M++I   FT +   SL +  KV+ LYRT+  S +KA+ EFA    SN
Sbjct:   37 EYNPFTDARTAAPGSGPKSA-----PAPSQNTQPAIMKPT--EEPPAYTQQQTQRRTEDQARAQAELLRRQEELEKKAAELDRRERELQT--HGAAGRK-NNWPPLPEKFPVGPCFYHDIAVDIPVEFQKTVKIMYNLWMFHAGTLFVNMFGCLAWFIVDASRGVDFGLAMLWFLLFTPCSFIC---WYRPLYGAFRSDSSFRFFVFFFIYICQFGVHVLQAIGITGWGTCGWIAALTGLNTSIPVGIIMLLIAALFTALAVGSLIMFKKVHALYRTTGASFEKAQQEFATGVMSN 319          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp1 (secretory carrier membrane protein 1 [Source:NCBI gene;Acc:101169127])

HSP 1 Score: 142.895 bits (359), Expect = 3.309e-39
Identity = 98/290 (33.79%), Postives = 154/290 (53.10%), Query Frame = 3
Query:   90 DFNPFNESKXXXXXXXXXXXXXXFIPAV--QPTASKPNLNETTPILSEFKTKE--QIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            ++NPF ++KP     A         PAV  QP   KP+  +  P  S+ + +E  +    LL+R +EL R+ AEL +RE+E+  +   A+G    N+PP P    + PCFY D  V+I   F+  V++ Y++WM ++  +  N+   L++  VD           L  LLF   S +    W+RPLY  FRS SS  FF+F   +     + +IQC+GI+  G+ GWI++ + L++    GI M+++   FT +   SL +  K++ LYRT+  S +KA+ EFA    SN
Sbjct:   36 EYNPFTDAKPTPAGTAPRTTG----PAVSTQPAIMKPS--DEPPAYSQPQGQEATRAAAELLRRQEELERKAAELDRREREMQTLS--ASGGRKNNWPPLPENLPVAPCFYHDISVDIPVEFQKIVKIMYYLWMFHTGTLLANLIACLSWFCVDATHGVDFGLSILWFLLFTPCSFVC---WYRPLYGAFRSDSSFRFFVFFFVYVCQFGIYVIQCIGISGWGASGWISALMGLNTSIPVGIIMILVAALFTSLAVMSLIMFKKIHALYRTTGASFEKAQQEFATGVMSN 314          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp2 (secretory carrier-associated membrane protein 2 [Source:NCBI gene;Acc:101162341])

HSP 1 Score: 124.405 bits (311), Expect = 2.449e-32
Identity = 85/285 (29.82%), Postives = 148/285 (51.93%), Query Frame = 3
Query:   93 FNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +NPF +S   +             P+  P   +P+ ++ +P  S  + +      LL++ +EL R+ AEL +RE+EL   + + +     N+PP P+ F I+PCFYQDF  EI   ++   ++ Y++WM     +F+N+   + + I D           L L+LF   S +    W+RP+Y  F++ SS +FF F   F   +V+ +IQ +G+   G+ GWI +  ++ S    G  M+++ + FT+  A S+ L+  V+ +YR +  S  KA+ EF+Q   +N
Sbjct:   37 YNPFPQSNDGLAIHTTPAVLRTQQPSTSPAVLQPS-SDPSPQASAARAQAD----LLRQQEELERKAAELDRREQEL---QSRGSTGKENNWPPLPKSFPIKPCFYQDFSEEIPVEYQRVCKMTYYLWMFNCVTLFLNLLACMAHFITDSKYGVDFGLSILWLILFSPCSFIC---WYRPVYNAFKTDSSFSFFTFFFVFFCQVVVFIIQSVGLPNWGNSGWIAAISIIGSNKAVGGIMIIVSILFTLCAAVSIILLKMVHSMYRHTGASFQKAQQEFSQGVFTN 310          
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Match: scamp3 (secretory carrier membrane protein 3 [Source:NCBI gene;Acc:101156986])

HSP 1 Score: 122.094 bits (305), Expect = 1.488e-31
Identity = 79/230 (34.35%), Postives = 117/230 (50.87%), Query Frame = 3
Query:  258 LLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            LL++ +EL R+  EL +RE+EL             N+PP P +  + PCFYQD DVEI  RF+ TV   Y+ WM+ +  +  N+  +      D +         +   L F         W+RP+YK FR+ SS NFFIF   F   + + +I  +GI   G  GWI S   L +  G G+ M++  + FT   A  + ++ K++ LYR ++ S  KA+AEFA    SN
Sbjct:   88 LLRKQEELERKAQELERRERELQSHSLGPGATRQNNWPPLPSFCPVGPCFYQDIDVEIAQRFQRTVSTMYYFWMVCAGALLFNLISSFANFCSDPSGGGVGLGLSILWALLFTPCSFVC--WYRPVYKAFRTDSSFNFFIFFFIFFAQVCVFVIMTIGIPGWGFSGWIVSLAALRTSTGVGVIMVMNAIVFTGQAAMGVVMLKKIHSLYRQTDASFQKAQAEFASGVMSN 315          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000075964.1 (SMESG000075964.1)

HSP 1 Score: 176.407 bits (446), Expect = 3.126e-52
Identity = 112/226 (49.56%), Postives = 143/226 (63.27%), Query Frame = 3
Query:  270 ADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            A+EL R+E E  +R  E           +IKNFPP P WF ++PCFYQ+ DVEI   +R  VR G++IW+ Y  +MFINIFG L+YMI       S + FG+SLLLF L SP SY+ WFR LYK FRS SS NFF+F   F   L++ +IQ LGIN LGSCGWI S   L    G G FM +I   +T +L +   L FKV+R+YR++  S +KAKAEF++   SN
Sbjct:   81 ANELTRKEEEQRRRYMEFQ--------GNIKNFPPLPSWFPMKPCFYQEIDVEIPIEYRQLVRYGFYIWIAYVAIMFINIFGTLSYMISQNVEGSSGTLFGMSLLLFLLFSPASYICWFRSLYKAFRSDSSFNFFMFFFIFFAQLIILIIQVLGINTLGSCGWIISLAELKKSIGVGAFMCIISGLYTAVLVSGSILFFKVHRIYRSTGASFEKAKAEFSRDLASN 298          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000060788.1 (SMESG000060788.1)

HSP 1 Score: 164.851 bits (416), Expect = 1.728e-50
Identity = 96/97 (98.97%), Postives = 96/97 (98.97%), Query Frame = 3
Query:   60 MSSNLDNSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATG 350
            MSSNLDNSQTDFNPFNESKPAVPTAARVVPRPVFIPAVQPT SKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATG
Sbjct:    1 MSSNLDNSQTDFNPFNESKPAVPTAARVVPRPVFIPAVQPTDSKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATG 97          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000035622.1 (SMESG000035622.1)

HSP 1 Score: 155.606 bits (392), Expect = 1.465e-44
Identity = 111/260 (42.69%), Postives = 161/260 (61.92%), Query Frame = 3
Query:  174 QPTASKPNL--NETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSN 947
            +P  ++P +   E TP+     T    ++ L +   +L  R   L + E+ L K E+ AT +   NFPP P+   ++PCFYQ  DVEI  ++R  V+LG+ +W+ YS  +FINIFGAL+YMI      ES   FGLS+L FFL  PLSYV WFRPLYK F++ SS NFF+F + F   +++ +IQ LGI +LG+CGW+  S + +   G   FM++I   F++ LAAS +++ +VN  +RTS  S+ KAK EF + + SN
Sbjct:   35 EPFNNEPAILQTEATPVAKPKVT----VDDLERMQRDLEERSQRLAEEEERLNKPEYAATRN---NFPPLPKCCPLKPCFYQAIDVEIPEQYRLIVKLGFILWICYSMTLFINIFGALSYMISINLKDESGPLFGLSMLYFFLFVPLSYVFWFRPLYKAFKNNSSFNFFLFFIIFGSQIIVLIIQVLGIKYLGACGWV-VSFMANKTPGVMAFMLIIAAAFSLNLAASFYIIIRVNLYFRTSGGSLQKAKEEFHKDALSN 286          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000037804.1 (SMESG000037804.1)

HSP 1 Score: 147.517 bits (371), Expect = 1.167e-41
Identity = 92/257 (35.80%), Postives = 151/257 (58.75%), Query Frame = 3
Query:  189 KPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSNIFAA 959
            +P  N  T   ++    +++   L ++  EL+ R +EL +RE+E   + + ++   + NFPP   +   + CFYQD +VEI  ++   V  GY +W+    ++ +N+F +L Y I    ++ + ++FG S+L+  L  P SYV WFRPLY  F++ SS+NFFIF       +V+++IQ LGI WLGSCGW+N  ++L     AG FM+V   GFT++       + KV+RLYR ++ S +KAK+EF   + S++ + 
Sbjct:   22 QPFKNAPTSSTAKNSDTKKMYEDLEKKQKELDMRASELDRREREQSHLLNDSS--TVNNFPPLLSFCPCKSCFYQDINVEIPPQYINIVTRGYHLWISLCGILMLNLFASLGYFITSSNATMAGTSFGSSILVCLLFPPASYVCWFRPLYNAFKNDSSINFFIFFFIMFAQIVVSVIQALGIYWLGSCGWLNGLMMLHQNRFAGGFMLVTATGFTILSVFETVFLIKVHRLYRNTDASFEKAKSEFGVNAASSVISG 276          
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Match: SMESG000064285.1 (SMESG000064285.1)

HSP 1 Score: 129.028 bits (323), Expect = 8.372e-35
Identity = 94/289 (32.53%), Postives = 144/289 (49.83%), Query Frame = 3
Query:   78 NSQTDFNPFNESKXXXXXXXXXXXXXXFIPAVQPTASKPNLNETTPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHIKNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINIFGALTYMIVDKAXXXXXXXXXXXXXXXXXXXXXXXXXWFRPLYKCFRSQSSLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFMMVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTS 944
            ++  ++NPFNE+  A              PAV    + P   E  P      TK+ +++    + +    RE    K   +L      + G+   N+PPFP    IRPCFY DFD++I  + RG V+  Y+IW+ Y+  +  N+FG+L Y I + +    S+     +           + WF PLYK  R  SS N+F+F +     +V+T IQ LGI+WLGSCG+INS  +       G  M  IG+ F+ +    L L+FKVN +YR + V    A+A+ ++ ST+
Sbjct:    8 DALDEYNPFNENNKAQQ------------PAVINVTNNPE--EVEP------TKKSLLSNSSNKKNFQGEREDGSYKESTKL----IDSPGN---NWPPFPTCCPIRPCFYIDFDLDIPEKHRGLVKFAYYIWITYAIAIVFNVFGSLAYYITENSMISGSTFGTALIFGILFPVLSFIL-WFWPLYKAIRWDSSTNYFMFFIIICCQIVITGIQMLGIDWLGSCGFINSLKMFRKDILTGCIMFFIGLWFSALFTLFLILLFKVNYIYRHAIVP--DAQADNSKFSTN 266          
The following BLAST results are available for this feature:
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCAMP11.314e-4534.67secretory carrier membrane protein 1 [Source:HGNC ... [more]
SCAMP11.815e-4437.26secretory carrier membrane protein 1 [Source:HGNC ... [more]
SCAMP21.014e-3533.33secretory carrier membrane protein 2 [Source:HGNC ... [more]
SCAMP32.970e-3136.09secretory carrier membrane protein 3 [Source:HGNC ... [more]
SCAMP32.970e-3136.09secretory carrier membrane protein 3 [Source:HGNC ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
scm-11.155e-3333.61Secretory carrier-associated membrane protein [So... [more]
scm-11.849e-3331.95Secretory carrier-associated membrane protein [So... [more]
scm-11.710e-1337.27Secretory carrier-associated membrane protein [So... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Scamp2.465e-3833.45gene:FBgn0040285 transcript:FBtr0332591[more]
Scamp2.465e-3833.45gene:FBgn0040285 transcript:FBtr0074079[more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp12.271e-4033.56secretory carrier membrane protein 1 [Source:ZFIN;... [more]
scamp31.087e-3440.00secretory carrier membrane protein 3 [Source:ZFIN;... [more]
scamp2l8.069e-3135.43secretory carrier membrane protein 2, like [Source... [more]
scamp48.299e-3141.71secretory carrier membrane protein 4 [Source:ZFIN;... [more]
scamp48.299e-3141.71secretory carrier membrane protein 4 [Source:ZFIN;... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp16.038e-4333.77secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp16.557e-4333.77secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp19.418e-4333.77secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp25.524e-3533.79secretory carrier membrane protein 2 [Source:NCBI ... [more]
scamp52.147e-3034.67secretory carrier membrane protein 5 gene 2 [Sourc... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scamp11.435e-4535.22secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp11.056e-4437.88secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp11.056e-4437.88secretory carrier membrane protein 1 [Source:MGI S... [more]
Scamp21.380e-3533.33secretory carrier membrane protein 2 [Source:MGI S... [more]
Scamp35.401e-3035.65secretory carrier membrane protein 3 [Source:MGI S... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15126|SCAM1_HUMAN6.310e-4534.67Secretory carrier-associated membrane protein 1 OS... [more]
sp|Q8K021|SCAM1_MOUSE1.004e-4435.22Secretory carrier-associated membrane protein 1 OS... [more]
sp|P56603|SCAM1_RAT1.306e-4435.22Secretory carrier-associated membrane protein 1 OS... [more]
sp|O77735|SCAM1_PIG3.167e-4434.00Secretory carrier-associated membrane protein 1 OS... [more]
sp|O15127|SCAM2_HUMAN4.869e-3533.33Secretory carrier-associated membrane protein 2 OS... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267H8L58.528e-5143.97Secretory carrier-associated membrane protein (Fra... [more]
A0A1I8GUV91.452e-5043.97Secretory carrier-associated membrane protein OS=M... [more]
A0A0R3W3282.277e-5040.15Secretory carrier-associated membrane protein OS=T... [more]
A0A267H8C95.236e-5044.40Secretory carrier-associated membrane protein (Fra... [more]
A0A267GUG71.069e-4944.87Secretory carrier-associated membrane protein (Fra... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scamp13.841e-4134.44secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp23.536e-3633.55secretory carrier-associated membrane protein 2 [S... [more]
scamp25.419e-3538.70secretory carrier-associated membrane protein 2 [S... [more]
scamp31.086e-3236.09secretory carrier membrane protein 3 [Source:NCBI ... [more]
scamp2l7.839e-2934.38secretory carrier-associated membrane protein 2-li... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
scamp13.446e-4234.97secretory carrier membrane protein 1 [Source:ZFIN;... [more]
SCAMP52.478e-3131.66secretory carrier membrane protein 5 [Source:HGNC ... [more]
SCAMP54.299e-835.71secretory carrier membrane protein 5 [Source:HGNC ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO319628.911e-3430.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCAMP14.800e-4236.52secretory carrier-associated membrane protein 1 [S... [more]
SCAMP11.956e-4135.14secretory carrier-associated membrane protein 1 [S... [more]
scamp13.309e-3933.79secretory carrier membrane protein 1 [Source:NCBI ... [more]
scamp22.449e-3229.82secretory carrier-associated membrane protein 2 [S... [more]
scamp31.488e-3134.35secretory carrier membrane protein 3 [Source:NCBI ... [more]
back to top
BLAST of Secretory carrier-associated membrane protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075964.13.126e-5249.56SMESG000075964.1[more]
SMESG000060788.11.728e-5098.97SMESG000060788.1[more]
SMESG000035622.11.465e-4442.69SMESG000035622.1[more]
SMESG000037804.11.167e-4135.80SMESG000037804.1[more]
SMESG000064285.18.372e-3532.53SMESG000064285.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026242 ID=SMED30026242|Name=Secretory carrier-associated membrane protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1083bp
TTCTATTTTGAAAATGAATAAAATTATATTCCGATAAAATTTTAATATAT
ATTATAACTATGTCGAGTAACTTAGACAATTCTCAAACCGATTTTAATCC
ATTCAATGAATCCAAACCAGCAGTGCCTACAGCTGCTAGGGTTGTCCCAA
GGCCAGTATTCATTCCAGCAGTCCAACCGACCGCTAGTAAACCTAATTTA
AATGAAACCACTCCGATTTTATCCGAATTTAAAACGAAAGAACAAATAAT
AAATCCGTTATTACAAAGAGCAGATGAACTGAATCGACGAGAAGCTGAAT
TGATAAAACGAGAAAAAGAATTGGGTAAAATAGAACATCAGGCCACTGGC
GATCATATTAAAAATTTCCCACCATTTCCAAGATGGTTTTGTATCCGACC
TTGCTTTTATCAGGATTTCGATGTAGAGATTGATTCAAGATTTCGTGGAA
CTGTCCGTTTGGGATATTGGATTTGGATGTTGTATTCGTTCGTGATGTTC
ATTAATATCTTCGGAGCACTGACATACATGATCGTGGATAAGGCATCGAG
TGAATCGAGTTCCACATTCGGATTGTCGCTGTTGTTGTTCTTCTTGTTGA
GTCCGTTATCATATGTGCTCTGGTTCCGTCCTTTATACAAATGTTTTCGG
TCTCAAAGTTCATTAAATTTCTTCATATTTATCGTGTTTTTTGCGGTATA
TTTAGTATTGACTCTCATTCAATGTTTGGGCATCAATTGGCTTGGGTCAT
GTGGTTGGATAAATTCTTCTATTGTCTTGTCATCCTATTTCGGAGCTGGT
ATCTTTATGATGGTTATTGGAGTCGGATTCACAGTTATTCTCGCTGCATC
GTTATTTCTAGTATTTAAGGTTAACCGTTTGTATCGAACCAGCGAAGTTA
GCATGGATAAAGCCAAGGCTGAATTTGCTCAAAAGTCAACGTCGAATATC
TTTGCCGCATAACATTTGACTAACTACTATTTTCCTGCTTTATCACTTTG
TTTTGATTTAATATTGATAATTTTTTACTTTCCATAACTTTTTTTATTTA
TATAAAGACACGAAAAAAATGTATTCAGTGGAA
back to top

protein sequence of SMED30026242-orf-1

>SMED30026242-orf-1 ID=SMED30026242-orf-1|Name=SMED30026242-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=301bp
MSSNLDNSQTDFNPFNESKPAVPTAARVVPRPVFIPAVQPTASKPNLNET
TPILSEFKTKEQIINPLLQRADELNRREAELIKREKELGKIEHQATGDHI
KNFPPFPRWFCIRPCFYQDFDVEIDSRFRGTVRLGYWIWMLYSFVMFINI
FGALTYMIVDKASSESSSTFGLSLLLFFLLSPLSYVLWFRPLYKCFRSQS
SLNFFIFIVFFAVYLVLTLIQCLGINWLGSCGWINSSIVLSSYFGAGIFM
MVIGVGFTVILAASLFLVFKVNRLYRTSEVSMDKAKAEFAQKSTSNIFAA
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR007273SCAMP
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0006810transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007273SCAMPPFAMPF04144SCAMPcoord: 101..277
e-value: 1.7E-50
score: 171.7
IPR007273SCAMPPANTHERPTHR10687SECRETORY CARRIER-ASSOCIATED MEMBRANE PROTEIN SCAMPcoord: 9..296
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..17
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR10687:SF8SECRETORY CARRIER-ASSOCIATED MEMBRANE PROTEIN 1coord: 9..296
NoneNo IPR availableTMHMMTMhelixcoord: 202..224
NoneNo IPR availableTMHMMTMhelixcoord: 247..269
NoneNo IPR availableTMHMMTMhelixcoord: 167..189
NoneNo IPR availableTMHMMTMhelixcoord: 135..157