Coiled-coil and C2 domain containing 2A

Overview
NameCoiled-coil and C2 domain containing 2A
Smed IDSMED30026237
Length (bp)4995
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coiled-coil and C2 domain containing 2A (SMED30026237) t-SNE clustered cells

Violin plots show distribution of expression levels for Coiled-coil and C2 domain containing 2A (SMED30026237) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coiled-coil and C2 domain containing 2A (SMED30026237) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coiled-coil and C2 domain containing 2A (SMED30026237) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026237

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026237SMESG000048372.1 SmedASXL_077808SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026237SMESG000048372.1 SmedASXL_018133SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026237SMESG000048372.1 dd_Smed_v4_11189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026237SMESG000048372.1 dd_Smed_v4_11189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026237SMESG000048372.1 dd_Smed_v4_11189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026237SMESG000048372.1 dd_Smed_v4_11189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30026237SMESG000048372.1 dd_Smed_v4_11189_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026237SMESG000048372.1 dd_Smed_v6_11189_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026237SMESG000048372.1 dd_Smed_v6_11189_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026237SMESG000048372.1 dd_Smed_v6_11189_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30026237SMESG000048372.1 dd_Smed_v4_11189_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026237SMESG000048372.1 dd_Smed_v4_11189_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Human
Match: CC2D2A (coiled-coil and C2 domain containing 2A [Source:HGNC Symbol;Acc:HGNC:29253])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 442/1403 (31.50%), Postives = 734/1403 (52.32%), Query Frame = 2
Query:  965 FLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRI-QKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEH-IDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFK--LSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVT--GFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV-------------------------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYM------------ESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            F+   PA     ++ L +E E  +LF P    +  +   P     R LE+EGLY G RP +  TN+  + +R+  ++ +  WFG+DGRI  LP+P+K  P RP +  ++   +   L+T   K +    + +H I SGDP  +FQ+ I++  L F+HH  FS EHVLA ++ QL+  Y    ++    F   ++ +L++A+Q   +    K   +   I   I+ Y+ EIR TR  R+ E+   R L  +IIK WK++KS R     T T + + ++K+ AD   D   +E +I  +I+E  E     Y ++M+ Y    Q +    K++   +                    KR +  E     E  +   E D+ +P  P+P D   + +E+R +    RR P EP + P L + GS++ N+   + E++RR  ++K   Y+++ FNNK+V  T ++ L  DF V F +   + I  +PE + L++YE+ G +S  L  AE+ +P+P    ++     E   F +NQ++   + GVGSG    P  S +   S ++   L TSG +     WA+  +G  +IP     +  F +     D + ++G + + D+++  +W + ES LDPNDP +A ++  +     +    E+ +  DFFRL     EF F ++ +++RS RFR++ LR+  VPEF     +P+YD ++  ++ +DYE R  +    +I T    +  + I  +++++VR+ V+++F  +     L +M+ EEE+P I+ +   LF +    RPL+   + RK ++  N+ + +++++V I RA ++PV                                      + +  + PFV+V+FQ     T   EG NP+W+ EL LPF+ P    +  SL +++D + IN++D+ + ++  D   +   +H R ERHWLG +++PF+TIY  ++I+G F++  P  + GY  +  M                 +++FIT++P++ P +S+++    KF+S ED  L+   +++Q E  ++FP R    TV+++  +   ITRY+  L PP+ELL V  N  Q   +++AR+VSLI F+ D + F GI D+WST DQFL +L GDE+EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E  G   +WN  +G  +   D  C +  +G L+   N+W N Q+   P  + FD++    W   F  ++    L +VQP+ +IY+        + Q  +E  L+  IMDWR    T +       +   L  LE + GE + +    ++   +  Y+  GFP+++PY E+  ++  + +TG+H    P VEFALAVYI  YP  VLS+WIYVASL+RN
Sbjct:  264 FVAVRPADYESIHDRLQMERE--MLFIPSRQTVPTYKKLPENVQPRFLEDEGLYTGVRPEVARTNQNIMENRLLMQDPERRWFGDDGRILALPNPIKPFPSRPPVLTQE-QSIKAELETLYKKAVKYVHSSQHVIRSGDPPGNFQLDIDISGLIFTHHPCFSREHVLAAKLAQLYDQYLARHQRNKAKFLTDKLQALRNAVQTGLD--PEKPHQSLDTIQKTINEYKSEIRQTRKFRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKADQKADEEAYEAEIQAEISELLEEHTEEYAQKMEEYRTSLQQWKAWRKVQRAKK-------------------KKRKQAAEEHPGDEIAEPYPEEDLVKPSPPEPTDRAVIEQEVRERAAQSRRRPWEPTLVPELSLAGSVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLL-AEVFLPIPETTVVTGRAPTEEVEFSSNQHVTLDHEGVGSG---VPF-SFEADGSNQLT--LMTSGKVSHSVAWAIGENGIPLIPPLSQQNIGFRSALKKADAISSIGTSGLTDMKKLAKW-AAESKLDPNDPNNAPLMQLI----SVATSGESYVP-DFFRLEQLQQEFNFVSDQELNRSKRFRLLHLRSQEVPEFRNYKQVPVYDREIMEKVFQDYEKR--LRDRNVIETKEHIDTHRAIVAKYLQQVRESVINRFLIAKQYFLLADMIVEEEVPNISILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIVRAYDIPVRKPAVSKFQQPSRSSRMFSEKHAASPSTYSPTHNADYPLGQVLVRPFVEVSFQRTVCHTTTAEGPNPSWNEELELPFRAPNGDYSTASLQSVKDVVFINIFDEVLHDVLEDDRERGSGIHTRIERHWLGCVKMPFSTIYFQARIDGTFKIDIPPVLLGYSKERNMILERGFDSVRSLSEGSYITLFITIEPQLVPGESIRE----KFESQEDEKLLQATEKFQAECALKFPNRQCLTTVIDISGKTVFITRYLKPLNPPQELLNVYPNNLQATAELVARYVSLIPFLPDTVSFGGICDLWSTSDQFLDLLAGDEEEHAVLLCNYFLSLGK---KAWLLMGNAIPEGPTAYVLTWE-QGRYLIWNPCSGHFYGQFDTFCPLKNVGCLIGPDNIWFNIQRYESPLRINFDVTRPKLWKSFFSRSLPYPGLSSVQPEELIYQRSDKAAAAELQDRIEKILKEKIMDWRPRHLTRWNRYCTSTLRHFLPLLEKSQGEDVEDDHRAELLKQLGDYRFSGFPLHMPYSEVKPLIDAVYSTGVHNIDVPNVEFALAVYIHPYPKNVLSVWIYVASLIRN 1619          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Human
Match: CC2D2A (coiled-coil and C2 domain containing 2A [Source:HGNC Symbol;Acc:HGNC:29253])

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 442/1403 (31.50%), Postives = 734/1403 (52.32%), Query Frame = 2
Query:  965 FLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRI-QKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEH-IDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFK--LSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVT--GFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV-------------------------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYM------------ESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            F+   PA     ++ L +E E  +LF P    +  +   P     R LE+EGLY G RP +  TN+  + +R+  ++ +  WFG+DGRI  LP+P+K  P RP +  ++   +   L+T   K +    + +H I SGDP  +FQ+ I++  L F+HH  FS EHVLA ++ QL+  Y    ++    F   ++ +L++A+Q   +    K   +   I   I+ Y+ EIR TR  R+ E+   R L  +IIK WK++KS R     T T + + ++K+ AD   D   +E +I  +I+E  E     Y ++M+ Y    Q +    K++   +                    KR +  E     E  +   E D+ +P  P+P D   + +E+R +    RR P EP + P L + GS++ N+   + E++RR  ++K   Y+++ FNNK+V  T ++ L  DF V F +   + I  +PE + L++YE+ G +S  L  AE+ +P+P    ++     E   F +NQ++   + GVGSG    P  S +   S ++   L TSG +     WA+  +G  +IP     +  F +     D + ++G + + D+++  +W + ES LDPNDP +A ++  +     +    E+ +  DFFRL     EF F ++ +++RS RFR++ LR+  VPEF     +P+YD ++  ++ +DYE R  +    +I T    +  + I  +++++VR+ V+++F  +     L +M+ EEE+P I+ +   LF +    RPL+   + RK ++  N+ + +++++V I RA ++PV                                      + +  + PFV+V+FQ     T   EG NP+W+ EL LPF+ P    +  SL +++D + IN++D+ + ++  D   +   +H R ERHWLG +++PF+TIY  ++I+G F++  P  + GY  +  M                 +++FIT++P++ P +S+++    KF+S ED  L+   +++Q E  ++FP R    TV+++  +   ITRY+  L PP+ELL V  N  Q   +++AR+VSLI F+ D + F GI D+WST DQFL +L GDE+EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E  G   +WN  +G  +   D  C +  +G L+   N+W N Q+   P  + FD++    W   F  ++    L +VQP+ +IY+        + Q  +E  L+  IMDWR    T +       +   L  LE + GE + +    ++   +  Y+  GFP+++PY E+  ++  + +TG+H    P VEFALAVYI  YP  VLS+WIYVASL+RN
Sbjct:  264 FVAVRPADYESIHDRLQMERE--MLFIPSRQTVPTYKKLPENVQPRFLEDEGLYTGVRPEVARTNQNIMENRLLMQDPERRWFGDDGRILALPNPIKPFPSRPPVLTQE-QSIKAELETLYKKAVKYVHSSQHVIRSGDPPGNFQLDIDISGLIFTHHPCFSREHVLAAKLAQLYDQYLARHQRNKAKFLTDKLQALRNAVQTGLD--PEKPHQSLDTIQKTINEYKSEIRQTRKFRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKADQKADEEAYEAEIQAEISELLEEHTEEYAQKMEEYRTSLQQWKAWRKVQRAKK-------------------KKRKQAAEEHPGDEIAEPYPEEDLVKPSPPEPTDRAVIEQEVRERAAQSRRRPWEPTLVPELSLAGSVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLL-AEVFLPIPETTVVTGRAPTEEVEFSSNQHVTLDHEGVGSG---VPF-SFEADGSNQLT--LMTSGKVSHSVAWAIGENGIPLIPPLSQQNIGFRSALKKADAISSIGTSGLTDMKKLAKW-AAESKLDPNDPNNAPLMQLI----SVATSGESYVP-DFFRLEQLQQEFNFVSDQELNRSKRFRLLHLRSQEVPEFRNYKQVPVYDREIMEKVFQDYEKR--LRDRNVIETKEHIDTHRAIVAKYLQQVRESVINRFLIAKQYFLLADMIVEEEVPNISILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIVRAYDIPVRKPAVSKFQQPSRSSRMFSEKHAASPSTYSPTHNADYPLGQVLVRPFVEVSFQRTVCHTTTAEGPNPSWNEELELPFRAPNGDYSTASLQSVKDVVFINIFDEVLHDVLEDDRERGSGIHTRIERHWLGCVKMPFSTIYFQARIDGTFKIDIPPVLLGYSKERNMILERGFDSVRSLSEGSYITLFITIEPQLVPGESIRE----KFESQEDEKLLQATEKFQAECALKFPNRQCLTTVIDISGKTVFITRYLKPLNPPQELLNVYPNNLQATAELVARYVSLIPFLPDTVSFGGICDLWSTSDQFLDLLAGDEEEHAVLLCNYFLSLGK---KAWLLMGNAIPEGPTAYVLTWE-QGRYLIWNPCSGHFYGQFDTFCPLKNVGCLIGPDNIWFNIQRYESPLRINFDVTRPKLWKSFFSRSLPYPGLSSVQPEELIYQRSDKAAAAELQDRIEKILKEKIMDWRPRHLTRWNRYCTSTLRHFLPLLEKSQGEDVEDDHRAELLKQLGDYRFSGFPLHMPYSEVKPLIDAVYSTGVHNIDVPNVEFALAVYIHPYPKNVLSVWIYVASLIRN 1619          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Human
Match: CC2D2A (coiled-coil and C2 domain containing 2A [Source:HGNC Symbol;Acc:HGNC:29253])

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 442/1411 (31.33%), Postives = 733/1411 (51.95%), Query Frame = 2
Query:  965 FLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRI-QKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEH-IDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFK--LSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVT--GFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTIND-----IFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV-------------------------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYM------------ESFPMMSVFITLDPEIHPPQSLKDRN---ITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            F+   PA     ++ L +E E  +LF P    +  +   P     R LE+EGLY G RP +  TN+  + +R+  ++ +  WFG+DGRI  LP+P+K  P RP +  ++   +   L+T   K +    + +H I SGDP  +FQ+ I++  L F+HH  FS EHVLA ++ QL+  Y    ++    F   ++ +L++A+Q   +    K   +   I   I+ Y+ EIR TR  R+ E+   R L  +IIK WK++KS R     T T + + ++K+ AD   D   +E +I  +I+E  E     Y ++M+ Y    Q +    K++   +                    KR +  E     E  +   E D+ +P  P+P D   + +E+R +    RR P EP + P L + GS++ N+   + E++RR  ++K   Y+++ FNNK+V  T ++ L  DF V F +   + I  +PE + L++YE+ G +S  L  AE+ +P+P    ++     E   F +NQ++   + GVGSG    P  S +   S ++   L TSG +     WA+  +G  +IP     +  F +     D + ++G + + D+++  +W + ES LDPNDP +A ++  +         S      DFFRL     EF F ++ +++RS RFR++ LR+  VPEF     +P+YD ++  ++ +DYE R  +    +I T    +  + I  +++++VR+ V+++F  +     L +M+ EEE+P I+      +   LF +    RPL+   + RK ++  N+ + +++++V I RA ++PV                                      + +  + PFV+V+FQ     T   EG NP+W+ EL LPF+ P    +  SL +++D + IN++D+ + ++  D   +   +H R ERHWLG +++PF+TIY  ++I+G F++  P  + GY  +  M                 +++FIT++P++ P +S++++    + KF+S ED  L+   +++Q E  ++FP R    TV+++  +   ITRY+  L PP+ELL V  N  Q   +++AR+VSLI F+ D + F GI D+WST DQFL +L GDE+EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E  G   +WN  +G  +   D  C +  +G L+   N+W N Q+   P  + FD++    W   F  ++    L +VQP+ +IY+        + Q  +E  L+  IMDWR    T +       +   L  LE + GE + +    ++   +  Y+  GFP+++PY E+  ++  + +TG+H    P VEFALAVYI  YP  VLS+WIYVASL+RN
Sbjct:   84 FVAVRPADYESIHDRLQMERE--MLFIPSRQTVPTYKKLPENVQPRFLEDEGLYTGVRPEVARTNQNIMENRLLMQDPERRWFGDDGRILALPNPIKPFPSRPPVLTQE-QSIKAELETLYKKAVKYVHSSQHVIRSGDPPGNFQLDIDISGLIFTHHPCFSREHVLAAKLAQLYDQYLARHQRNKAKFLTDKLQALRNAVQTGLD--PEKPHQSLDTIQKTINEYKSEIRQTRKFRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKADQKADEEAYEAEIQAEISELLEEHTEEYAQKMEEYRTSLQQWKAWRKVQRAKK-------------------KKRKQAAEEHPGDEIAEPYPEEDLVKPSPPEPTDRAVIEQEVRERAAQSRRRPWEPTLVPELSLAGSVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLL-AEVFLPIPETTVVTGRAPTEEVEFSSNQHVTLDHEGVGSG---VPF-SFEADGSNQLT--LMTSGKVSHSVAWAIGENGIPLIPPLSQQNIGFRSALKKADAISSIGTSGLTDMKKLAKW-AAESKLDPNDPNNAPLMQLISV-----ATSGESYVPDFFRLEQLQQEFNFVSDQELNRSKRFRLLHLRSQEVPEFRNYKQVPVYDREIMEKVFQDYEKR--LRDRNVIETKEHIDTHRAIVAKYLQQVRESVINRFLIAKQYFLLADMIVEEEVPNISSEGSGILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIVRAYDIPVRKPAVSKFQQPSRSSRMFSEKHAASPSTYSPTHNADYPLGQVLVRPFVEVSFQRTVCHTTTAEGPNPSWNEELELPFRAPNGDYSTASLQSVKDVVFINIFDEVLHDVLEDDRERGSGIHTRIERHWLGCVKMPFSTIYFQARIDGTFKIDIPPVLLGYSKERNMILERGFDSVRSLSEGSYITLFITIEPQLVPGESIREKMSNMLKKFESQEDEKLLQATEKFQAECALKFPNRQCLTTVIDISGKTVFITRYLKPLNPPQELLNVYPNNLQATAELVARYVSLIPFLPDTVSFGGICDLWSTSDQFLDLLAGDEEEHAVLLCNYFLSLGK---KAWLLMGNAIPEGPTAYVLTWE-QGRYLIWNPCSGHFYGQFDTFCPLKNVGCLIGPDNIWFNIQRYESPLRINFDVTRPKLWKSFFSRSLPYPGLSSVQPEELIYQRSDKAAAAELQDRIEKILKEKIMDWRPRHLTRWNRYCTSTLRHFLPLLEKSQGEDVEDDHRAELLKQLGDYRFSGFPLHMPYSEVKPLIDAVYSTGVHNIDVPNVEFALAVYIHPYPKNVLSVWIYVASLIRN 1451          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Human
Match: CC2D2A (coiled-coil and C2 domain containing 2A [Source:HGNC Symbol;Acc:HGNC:29253])

HSP 1 Score: 434.876 bits (1117), Expect = 1.252e-131
Identity = 275/852 (32.28%), Postives = 460/852 (53.99%), Query Frame = 2
Query: 2066 EPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFK--LSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTG--FEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV-------------------------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYM------------ESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWA 4435
            E D+ +P  P+P D   + +E+R +    RR P EP + P L + GS++ N+   + E++RR  ++K   Y+++ FNNK+V  T ++ L  DF V F +   + I  +PE + L++YE+ G +S  L  AE+ +P+P    ++     E   F +NQ++   + GVGSG   F  E+ DG  S ++   L TSG +     WA+  +G  +IP     +  F +     D + ++G + + D+++  +W + ES LDPNDP +A ++  +         S      DFFRL     EF F ++ +++RS RFR++ LR+  VPEF     +P+YD ++  ++ +DYE R  +    +I T    +  + I  +++++VR+ V+++F  +     L +M+ EEE+P I+ +   LF +    RPL+   + RK ++  N+ + +++++V I RA ++PV                                      + +  + PFV+V+FQ     T   EG NP+W+ EL LPF+ P    +  SL +++D + IN++D+ + ++  D   +   +H R ERHWLG +++PF+TIY  ++I+G F++  P  + GY  +  M                 +++FIT++P++ P +S+++    KF+S ED  L+   +++Q E  ++FP R    TV+++  +   ITRY+  L PP+ELL V  N  Q   +++AR+VSLI F+ D + F GI D+WST DQFL +L GDE+EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E  G   +WN  +G  +   D  C +  +G L+   N  A
Sbjct:   56 EEDLVKPSPPEPTDRAVIEQEVRERAAQSRRRPWEPTLVPELSLAGSVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLL-AEVFLPIPETTVVTGRAPTEEVEFSSNQHVTLDHEGVGSG-VPFSFEA-DG--SNQLT--LMTSGKVSHSVAWAIGENGIPLIPPLSQQNIGFRSALKKADAISSIGTSGLTDMKKLAKWAA-ESKLDPNDPNNAPLMQLISV-----ATSGESYVPDFFRLEQLQQEFNFVSDQELNRSKRFRLLHLRSQEVPEFRNYKQVPVYDREIMEKVFQDYEKR--LRDRNVIETKEHIDTHRAIVAKYLQQVRESVINRFLIAKQYFLLADMIVEEEVPNISILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIVRAYDIPVRKPAVSKFQQPSRSSRMFSEKHAASPSTYSPTHNADYPLGQVLVRPFVEVSFQRTVCHTTTAEGPNPSWNEELELPFRAPNGDYSTASLQSVKDVVFINIFDEVLHDVLEDDRERGSGIHTRIERHWLGCVKMPFSTIYFQARIDGTFKIDIPPVLLGYSKERNMILERGFDSVRSLSEGSYITLFITIEPQLVPGESIRE----KFESQEDEKLLQATEKFQAECALKFPNRQCLTTVIDISGKTVFITRYLKPLNPPQELLNVYPNNLQATAELVARYVSLIPFLPDTVSFGGICDLWSTSDQFLDLLAGDEEEHAVLLCNYFLSLGK---KAWLLMGNAIPEGPTAYVLTWE-QGRYLIWNPCSGHFYGQFDTFCPLKNVGCLIGPDNAQA 884          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Human
Match: CC2D2B (coiled-coil and C2 domain containing 2B [Source:HGNC Symbol;Acc:HGNC:31666])

HSP 1 Score: 420.239 bits (1079), Expect = 7.376e-122
Identity = 290/974 (29.77%), Postives = 504/974 (51.75%), Query Frame = 2
Query: 2231 ELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLP--FKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRN-NNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVRE-EEIPTINDIFPKLFNVNRFSRPLQRLP---EPRKPISVHNIYEMNVEIVVVIQRATNLPV-----------------------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGY------------ESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAV---DENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNIN---LQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEM--NESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            E  RR  +QK +Y+I++F+NNK+V  TS   L  DF V F++   + +  +PEVI L++YE S  TS     A++ +PLP   +L     ++   F +++ ++  +  VGS   + P   L+G  + E+   L TSG L     W+++ +G  +IP+       + ++  N D     G+  +++ Q+  EW + E  +DPN+P  + ++ ++      G D        +FRL    DEF F +E+++ +S RF++++LRN   +  FL   +PL+D ++P  + ++YE++K    +   V    A+++    F++KVR  ++ +    + K +L ++V + EEI + + +      V +F  P ++L    + RK ++   I + +++I+V I RA N+P                                     +   T+ PFV+V+FQ+    T+   G +P W+ E+++ F  P    + +SL  I+D + IN++D+ +   + D   K  + H    ++WLG +  PF+ +   S+I G F++  P  + GY             +++ ++    +++F T++P+I    S    N T    ++  +++     ++      FP R    TV N    + L+TRYI  L PP++LL +   + N    +IARFVSLI F+ +       SDIW T +  + + IG+++EHA+LLCN+F Y  +   K  + LG ++ EG  AYV+T+E N +  LWN STG  +K  DP C +  +  L ++RNVW N QQ   P  + FD S ++ W  L   N+    +Q++QP+ IIY E     V+D +  +E  L+S +M+WR    T++       + +IL  LE   G    +E  NE  + ++  Y V GFPI +PY+++  ++  +  TGIH    P+ EFALAVYI  YPN +LS+W+Y+ASLV++
Sbjct:  491 EQKRRAKIQKLKYFIKIFYNNKQVSCTSVSPLQFDFKVMFQQIFNIQLMYWPEVICLEVYEKSKRTSLL---AKLYIPLPNYTELKGKTALQYVEFSSDKLVMPADGEVGS---NVPF-LLEGNGTEELC--LLTSGKLSYSLSWSLDENGLPLIPMPQSLRSSYCSMLRNVDARSVPGIPWLMNEQKLFEWAN-EVRIDPNNPEYSDLMESVTYMRLKGQDI-----PKYFRLEQLQDEFNFVSEEEMAKSKRFQLLQLRNAGQLDNFLLQQMPLHDTEIPDLVFQEYESQKEKEVSVSDVNSITAQRINSANFLKKVRRLIMKRI-VKISKCNLSDIVNDYEEIVSTSQLTDA---VCKFVEPRRKLKPQRKERKKVTAQAISDGDIKILVRIVRAYNIPTRKTTINGSLDMPTCLKSSISCLRHRETIKSVASDETLHEDTVHPFVEVSFQHTVYKTNTASGSHPCWNEEIKVDFVSPGHDYSFSSLSKIKDNIYINIFDEMMTEKHEDHCLKSCSGHSYIRKNWLGCIVFPFSALLQQSEISGTFQVTIPPVLLGYTWSNTYVFPKEDSNEQNLKECTFLNIFATIEPQI----SYVTCNPTLDKFLDQTEVLQRAQIFKKNCKAMFPNRRIVTTVFNDEGIQFLVTRYIKALNPPQQLLDIFLHNSNATFDLIARFVSLIPFVPNTPDENDGSDIWMTSEHCISLAIGNKEEHAILLCNFFLYFGK---KALVLLGTSVLEGHVAYVVTQETN-EYLLWNPSTGQCYKQFDPFCPLKSVDCLFDDRNVWFNIQQNNTPMAVFFDYSKESFWKQLLPKNVQGTKIQSIQPEEIIYFETDKSMVEDLRNRIERTLKSKVMEWRPKHPTHWNRQCTFILRQILPKLEFGIGSFVSSEGDNE-FERILQFYWVTGFPIQMPYIDVQSIIDAVYQTGIHSAEFPQTEFALAVYIHPYPNNILSVWVYLASLVQH 1436          

HSP 2 Score: 88.5817 bits (218), Expect = 1.067e-16
Identity = 90/280 (32.14%), Postives = 138/280 (49.29%), Query Frame = 2
Query: 1088 RNLEEEGLYVGRRPFINTTNERKLASRIQK-ENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSF-----------QMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKK-QLADADEDYRLWERDISDQIAEEKEYFENNYRKEMK 1888
            R LE+EG Y+ R+P I      K+ +R+ K E    WFGE G I  LP P+K+       WN + N     ++ E L P++  T Y      D  SSF           Q+ +N+  L+FSHHHLF+ E VL  R+ QL+  +Q   +Q       +++ +L  A      KLSN+N+         + +Y  +I NT+   + E G    L  SI++TWKQIKS R+  G T T + +++++ ++   DE          +QI+E  E  + N  KE+K
Sbjct:  192 RILEDEGFYIQRKPEIYKKTCNKMENRLLKLEEGKCWFGESGEIMSLPTPIKQ------SWNFRLN-----VRKEPLNPLLK-TIYRKAVKYDLGSSFMNKMEGSREIYQLDLNIVGLQFSHHHLFNQEQVLCARLLQLYECFQDRQQQNVSQLLYEKLKALTDAT-----KLSNENSEINQLTRKSLQDYYWQISNTKQMYDLERGKDLSLLHSILRTWKQIKSLRHGQGFTSTPIKLQVQRIKMNKCDEQ---------EQISEMSETEKKNEGKELK 445          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Celegans
Match: mks-6 (MecKel-Gruber Syndrome (MKS) homolog [Source:UniProtKB/TrEMBL;Acc:Q21303])

HSP 1 Score: 160.999 bits (406), Expect = 2.055e-39
Identity = 167/641 (26.05%), Postives = 302/641 (47.11%), Query Frame = 2
Query: 3053 DDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLF---NVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFH-TLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFIT-LDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ-KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNIN---LQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASL 4948
            DDK  LE +++ E+R    K     +  ++R++   +F    R  V+   R    ++   E+VREE IPT++  F +LF   +V+R  +P+++    R+          +  I+V IQ A NLPV    + + PFV V++      TDV  G +P W       F    T++  D   + + I VYDQ V +++ D   + H  +HE+     LG+  I F T+ + SKI    RL  P ++  Y+     ES  +  +F T +DP+     ++   + + F++ +  +  +++++   E+   FPKR  R  V ++    T+ TRY+  + PP+  + + EN     +I R  + I      +     SDIW    Q   + +G  +E + LL  +  + ++ P  V + LGEA  E  T +VLT E+ G   L +   G  +   D  C++ KI    + +N +AN Q   Q  ++  +L    +W PLF  N+N   L+++Q   + Y +     + + +++LE +++    + R      + +   R++ EI   LE   G    S+ E++  L  GY++    I + Y  + + +  + +  +  T D   +FA+AV +  +   V+ I I +A L
Sbjct:  599 DDKKRLEELRE-EDR--AQKRFAYRSAIDSRRISALQFANLARKRVMD--RRQRKERKYEEIVREESIPTLSVAFSQLFGPADVSRRLKPMRKDERAREE-------GWDNTIIVNIQSAINLPVRTSGQ-VQPFVIVSYSGKRINTDVAVGRHPNWQ------FTGKLTISKEDREHEFIEIKVYDQLVESIDKD--DRIHNVVHEQLTARLLGTQRIRFETLAVVSKISSPIRLNIPLYISNYKISP--ESSFLKVLFSTQIDPKSQIEYTM---STSSFETGKTLEKCSNLEKHVREL---FPKRISRPLVTDLNSHSTVCTRYLRPIAPPQ--IVMQENASNLPLICRLAAKIVSGMPRVDSTSHSDIWGNVFQLTSIAVGGIEERSTLLGCWLLH-FRLP--VAIVLGEARGE-KTGFVLT-ELEGKQVLIDPDDGHIYPILDSNCALEKIYGAFDNKNYYANVQSYDQTPQISLNLDKYTNWKPLF--NVNEEPLESIQTATVRYSKLPEDWIVELRISLEREIKIRFDESRKHAIPQWHLVAARQLREI---LENPRGITESSVEERIVRLKEGYELTVIIIRVNYSSMEECVHEVLSNRLQDTPDLNSQFAIAVNVIDFFAHVIQIDIALAVL 1198          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Fly
Match: Cc2d2a (gene:FBgn0263113 transcript:FBtr0307337)

HSP 1 Score: 159.458 bits (402), Expect = 1.014e-38
Identity = 130/525 (24.76%), Postives = 238/525 (45.33%), Query Frame = 2
Query: 3443 PFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYE-----------SDEYMESFPMMSVFITLDPEIHPPQS-LKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPK--RFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKE-MNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTT--NFIIAPRREMVEILKCLE----INCGEMNESI-NEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLV 4951
            PFV +++      +   EG NP W+ +L+L  +     +    +RD L I+++D+ +    SD  S    +++R + +WLG   +P N++  +   EG   L  P  + GY+           +D+Y E    + ++  L   I P    L   +       E  +L  ++D  + E+    P+  R+    V   + +   +TR +  +  P   +   EN  +  I R+VSL+S +       G   +W      L        +  VLLCNY   L  +    +L LG + P G  ++VL ++    +++L + +TG +++  D  C + +I  +V ++N++ N Q   +     F+L   A WFPLF+  +         + Y      E+   Q  +E ++   I  WR    T  N    PR  + +IL  +E     + G  +E I +E+++     Y+++GF +N  Y  +  +  RI  + IH   D  VEF +AV++ ++ N VLS+W+++ S+V
Sbjct:  824 PFVTLSYGQRLCRSRTAEGSNPTWNEQLQLQIQ-----SQFGDLRDDLKISLFDELIEQQYSDEASD---VYQRVQCNWLGEFRVPINSLLASRTFEGCIELAMPKVLVGYKRPLIDSVTNMPTDQYPEFKEAVHLWFYLS--IEPGGGDLAPLHSCALACAEKPELQQYLDERRLELQQLLPQPQRYVEPLVCTAQGKRVCLTRLMDPVPLPPAAVPSGENPLEICI-RYVSLLSHLRSYDPCQGFRGVWLDNQSLLDSTWCSVKDLGVLLCNYMLSLGLE---CWLILGVSCPHGECSFVLFRQPETAELFLVSPATGKRYQLQDVHCPLRRIYCVVGKQNIYFNIQTETRVSMTHFNLQDGACWFPLFRRRVPAPQSGVQKLDYAYKRSYELSQLQKHIERKIMKKISAWRTTRKTIWNRAFQPR--LHKILCDMEDLSTFSRGRYDEPIFSEQLEREFPNYRLYGFTLNFAYTNLAAISERIRTSCIHYNHDASVEFCVAVHLHAHANDVLSVWLFLLSMV 1332          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Zebrafish
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 527.709 bits (1358), Expect = 1.201e-158
Identity = 341/1017 (33.53%), Postives = 547/1017 (53.79%), Query Frame = 2
Query: 2105 DEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSI-SNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALH--TNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVT--GFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLT---------------------------------------PFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMES------------FPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCG-EMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLV 4951
            D   L  ++R +    RR PGEP + P L V GSI +NE   + E  RR  + K   ++++ +N+K+V  T ++ LN DF V F +   + I  +PE I L+++ES G +S  L+   + VP    L+ +   E   F +NQ +   + GVGSG   F  E+ DGT        L TSG L     WAV  D   + P S        +     D +  +G + + D+++  +W + ES LDPNDP +A ++  L   +  ++G+        ++FRL    +EF F +E+++ RS R+R++RLR+  V EF     +P  D ++  ++ +DYENR  + + +II T    +A + +  +++++VR+ V+++F  +     L +++ E+E+P+I  +   LF +    RPL+   + RK ++  N+ E +++++V I R  ++PV   RR  T                                       PFV+V+FQ     T   EG NP W+ E+ LPF  P    + TSL ++RD + INV+D+ + ++  D   + +T+H R ERHWLGS+ IPF+TIYL S+I+G F++  P  + GY  +  + S               +S+FIT++P++ P  ++++    KFDS E   ++   + ++ E + RF  R    TV+++  +   +TR+I  L PP+ELL    N  Q   +++AR+VSLI  + D++ F G+ D+WSTCDQFL +L GDE+EHAVLLCNYF  + +   + +L +G AIPEG TAYVLT E +  V +WNASTG  +   D  C +  IG L+N  NVW N Q    P  + FD+S    W P F        L +VQPDA++Y         + Q  +E  LR  +M+WR    T +       + + L  LE++ G E+ E    +++ L+  Y++ GFP++LP+ E+  ++  + +TG+H    P VEFALAVY+  YP+ VLS+W+Y+ASLV
Sbjct:  655 DTSILEEQVREKAARIRRNPGEPVLIPELTVSGSITANEQCPRAEFARREDVAKRSLFVKVLYNDKEVSRTDSRTLNMDFRVHFGQIFNLKIVNWPESIKLQVFESVGSSSTQLTEVCVPVPESSVLTGSAPSEEMEFSSNQRVTFNHEGVGSG-VPFSFEA-DGTNP----QTLLTSGKLSCCVSWAVGEDDVPLAPPSAQPGVAMHSGLRQMDAIACIGASGLNDMKKLGKW-AAESRLDPNDPSNASIMQLLSVVSGGDMGV-------PEYFRLEQLQEEFNFLSEEELQRSRRYRLLRLRSQEVQEFRHFKCVPSTDREISEKVFQDYENR--LKEGEIIDTKEHIDAHRALVAKYLQRVRESVINRFLIAKHHFILSDVISEDEVPSIGVLGWNLFKLAEPKRPLKPRRKERKKVTAQNLSEGDIKLLVNIIRGYDIPV---RRPYTGKAPVSAKSGRSFTETFTAPASQTGQQGSEWPFAQPLIRPFVEVSFQRSVLQTSTAEGPNPCWNEEIVLPFSAPNGDYSSTSLQSVRDEVFINVFDELLYDVVEDERERGNTIHTRIERHWLGSINIPFSTIYLQSRIDGTFKVCTPPVLLGYSKERSLGSEGGYDAVRSPSEGTFLSLFITIEPQLVPGDTVRE----KFDSQEVERVLLASEVFEKEASRRFSDRPCITTVIDINGKTVFVTRFIRPLNPPQELLDASPNGTQDSTELVARYVSLIPSLPDSVSFAGVCDLWSTCDQFLTLLAGDEEEHAVLLCNYFLSMGK---RAWLIIGSAIPEGPTAYVLTYEQSRYV-IWNASTGQHYGQYDVFCPLQTIGCLINADNVWFNIQPYAAPVRMSFDISKPNLWKPFFSRAFPDPGLSSVQPDALVYRRTDRTAAVELQDRIEKVLREKLMEWRPRHPTRWNRYCISTLRQFLPKLELSGGREVAEEHRLELQSLLGEYRISGFPLHLPFSELRPIIEAVHSTGVHKVESPNVEFALAVYVHPYPSNVLSVWVYIASLV 1644          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Zebrafish
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 527.709 bits (1358), Expect = 1.471e-158
Identity = 341/1017 (33.53%), Postives = 547/1017 (53.79%), Query Frame = 2
Query: 2105 DEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSI-SNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALH--TNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVT--GFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLT---------------------------------------PFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMES------------FPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCG-EMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLV 4951
            D   L  ++R +    RR PGEP + P L V GSI +NE   + E  RR  + K   ++++ +N+K+V  T ++ LN DF V F +   + I  +PE I L+++ES G +S  L+   + VP    L+ +   E   F +NQ +   + GVGSG   F  E+ DGT        L TSG L     WAV  D   + P S        +     D +  +G + + D+++  +W + ES LDPNDP +A ++  L   +  ++G+        ++FRL    +EF F +E+++ RS R+R++RLR+  V EF     +P  D ++  ++ +DYENR  + + +II T    +A + +  +++++VR+ V+++F  +     L +++ E+E+P+I  +   LF +    RPL+   + RK ++  N+ E +++++V I R  ++PV   RR  T                                       PFV+V+FQ     T   EG NP W+ E+ LPF  P    + TSL ++RD + INV+D+ + ++  D   + +T+H R ERHWLGS+ IPF+TIYL S+I+G F++  P  + GY  +  + S               +S+FIT++P++ P  ++++    KFDS E   ++   + ++ E + RF  R    TV+++  +   +TR+I  L PP+ELL    N  Q   +++AR+VSLI  + D++ F G+ D+WSTCDQFL +L GDE+EHAVLLCNYF  + +   + +L +G AIPEG TAYVLT E +  V +WNASTG  +   D  C +  IG L+N  NVW N Q    P  + FD+S    W P F        L +VQPDA++Y         + Q  +E  LR  +M+WR    T +       + + L  LE++ G E+ E    +++ L+  Y++ GFP++LP+ E+  ++  + +TG+H    P VEFALAVY+  YP+ VLS+W+Y+ASLV
Sbjct:  683 DTSILEEQVREKAARIRRNPGEPVLIPELTVSGSITANEQCPRAEFARREDVAKRSLFVKVLYNDKEVSRTDSRTLNMDFRVHFGQIFNLKIVNWPESIKLQVFESVGSSSTQLTEVCVPVPESSVLTGSAPSEEMEFSSNQRVTFNHEGVGSG-VPFSFEA-DGTNP----QTLLTSGKLSCCVSWAVGEDDVPLAPPSAQPGVAMHSGLRQMDAIACIGASGLNDMKKLGKW-AAESRLDPNDPSNASIMQLLSVVSGGDMGV-------PEYFRLEQLQEEFNFLSEEELQRSRRYRLLRLRSQEVQEFRHFKCVPSTDREISEKVFQDYENR--LKEGEIIDTKEHIDAHRALVAKYLQRVRESVINRFLIAKHHFILSDVISEDEVPSIGVLGWNLFKLAEPKRPLKPRRKERKKVTAQNLSEGDIKLLVNIIRGYDIPV---RRPYTGKAPVSAKSGRSFTETFTAPASQTGQQGSEWPFAQPLIRPFVEVSFQRSVLQTSTAEGPNPCWNEEIVLPFSAPNGDYSSTSLQSVRDEVFINVFDELLYDVVEDERERGNTIHTRIERHWLGSINIPFSTIYLQSRIDGTFKVCTPPVLLGYSKERSLGSEGGYDAVRSPSEGTFLSLFITIEPQLVPGDTVRE----KFDSQEVERVLLASEVFEKEASRRFSDRPCITTVIDINGKTVFVTRFIRPLNPPQELLDASPNGTQDSTELVARYVSLIPSLPDSVSFAGVCDLWSTCDQFLTLLAGDEEEHAVLLCNYFLSMGK---RAWLIIGSAIPEGPTAYVLTYEQSRYV-IWNASTGQHYGQYDVFCPLQTIGCLINADNVWFNIQPYAAPVRMSFDISKPNLWKPFFSRAFPDPGLSSVQPDALVYRRTDRTAAVELQDRIEKVLREKLMEWRPRHPTRWNRYCISTLRQFLPKLELSGGREVAEEHRLELQSLLGEYRISGFPLHLPFSELRPIIEAVHSTGVHKVESPNVEFALAVYVHPYPSNVLSVWVYIASLV 1672          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Zebrafish
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:564926])

HSP 1 Score: 62.3882 bits (150), Expect = 4.812e-9
Identity = 106/500 (21.20%), Postives = 198/500 (39.60%), Query Frame = 2
Query: 3581 TLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEG-NFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNE-MNMRFPKRFRRVTVVNMRCQETLITR----YISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGI-SDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKF--KSNDPTC-SMF----------KIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINL-------QTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWR--FGLTT------NFIIAPRREMVEILKCLEINCG--EMNESINEKVKDLMTGYKVFGFPINLPYM----EIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            T ++++ D   + L     S   TL   Y   W   L  P   I +++++ G     K PA V   +    +E +P ++   TL P++   Q   +R  T   + ++R  + +  +W  E +++R   + + V +      E  + R    Y+  L+    L    E+ +Q   ARFVSL++     +V  G+  + W++   FL    GD ++HA LLC+       D    ++C+G  +      +V+T   +G +  W + T  ++  +  DP   SM            +G + N +   AN Q         FD +  + W  + +  +          ++ P   +     +      QL LE  +R  + + R   GL T      +++++      E+ +C  ++ G  E  +++   V D   G+    FPIN  +          L       I       V  A+ V +  YP +  ++WI  A   R+
Sbjct:  186 TTMLSICDPVHMVLIKTDTSGDTTLVSSYFLDWRTVLSAPNGKISVSAELLGVGAEAKVPAGVLNLK----LELYPPLTE--TLSPDVVTMQKSLERQKT---AEKERLFLVYAKQWWQEFLDIRPSNKSKLVKIFAQ--DENGVNRPVCSYVRVLRAGRLL----ESPRQA--ARFVSLLAQERAPVVGGGVRQEQWASMMVFLCRNKGDCEDHATLLCSLLLGFGLD---AYVCVGTKVKNIPHTWVMTCGTDGSITFWESFTAHRYLHRPIDPDAPSMILQPKPVHPYQTLGCVFNHKIFLANCQVSDAVERCVFDFTDGSRWKAMSEEAVRSVCDPGFNASLPPTPPLCSSSLVPNEASNQLELE--MRYLLSEHRKDLGLATVWDDHLSYLLSAALSAYELERCAGVSYGNEEFQDAVRRAVPD---GHTFKAFPINFLHCNARRAFATCLRSPFCEEIVCCRGDHVRLAVRVRVFGYPESACAVWIMFACKYRS 660          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Xenopus
Match: dhcr7 (7-dehydrocholesterol reductase [Source:Xenbase;Acc:XB-GENE-920362])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 421/1358 (31.00%), Postives = 710/1358 (52.28%), Query Frame = 2
Query: 1088 RNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGL-QTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHL---QEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYES--SGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLT-------------------------------------PFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTT---VTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFV------------QGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCG-EMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            R LE+EGLY G RP I  TN+  L +RI ++   +WFG+DG+I  L +P+K+   RP +++     + +G+ Q  +   +  ++    + SG+    +Q+ I++  + F+HH LFS EHVLA ++ QL+  Y    ++        ++ +L++A+Q++   +   S++    QS     I  Y+ EIR TR  R+ E+   R L  SIIK WK++KS R+    T T + + ++K+  +   D    E +I  +I E  E +  +Y K+M  Y++  Q +    K +                      ++  NE   Y            P++ +PV P+  D++ + +++R +    RR PGEP + P + + G+++ NE   + E+ RR  +QK+  +I + FNNK+V  T  K L  DF V   E   + I   PE I L++YE+   G T+  L+ A + +P     +    +E   F +NQ ++H + GVGS +  F  E+ DG  S ++I  L TSG +     W V  +G  ++P     +       +N D + ++G + + D+++  +W + ES LDPNDP +A ++    +N E  +        +FFRL     EF F++E+++ RS RFR+++LRN  V EF     IPL D ++P +L +DYE +          +  +  +++  +++++VR+ V+++F  +     L ++V EE+IP++  +   LF +    RPL+   + RK ++  N+ + +++++V + RA ++PV   R+ +T                                     PFV+V+FQ     T   +G NP W+ EL LPF+ P +     SL +++D + INV+D+   ++  D   + H +H R ERHWLGS+ IPF TIY  ++I+G F ++ P  +             GY++   +     +++FIT++P++ P + +++    KF+S ED  L+   +++Q+E   ++P R    TV ++      +TRYI  L PP+ELL    N  Q   +++A +VSLI F+ D + F GI ++WST DQFL +L GDE+EHAVLLCNYF  + +   K +L +G A+PEG T YVLT E N  + +WN STG  +   D  C +  +G L+N  N+W NTQQ   P  + FD S    W P F  +     L +VQP+ ++Y+        + Q  +E  L+  IM+WR    T +       +   L  LE+N G ++ E    +++  +  Y+  GFPI++ + E+  ++  + +TG+  +  P VEFALAVY+  YP  + S+W+YVASLVRN
Sbjct:   87 RFLEDEGLYTGERPKITQTNQNILENRILRQE--EWFGDDGKILALANPIKQSSTRPPIFS-----LHEGIDQALETIYVKENSCIRSVGSGE----YQLDIDISGIVFTHHPLFSREHVLASKLAQLYDQYLGRKQKNLSGLLTDKLHALRNAVQNIYGIRAANSSRTFVEQS-----ISEYKLEIRQTRKLRDTEQQKDRMLLKSIIKVWKEMKSLRDFQKFTNTSMKLFLRKEDVNKKSDEEAHEAEIQAEIQELIEEYMEDYEKDMVQYKSDLQKWKSWRKAQV-------------------IDKSAENEHAGY------------PELPKPVPPEIIDKKDVEQQVREKAAHIRRKPGEPILIPEMNLSGAVTPNELCPRVEVQRREDIQKHSLFIRILFNNKEVSRTIAKRLGSDFRVHLGEIFNLQIFNLPESIKLEIYETVRHGATT-LLADAFIPIPETTVHTGRAPVEEIEFSSNQRVMHDHEGVGS-DVPFSFEA-DG--SNKMI--LMTSGKVSYAASWGVGDNGVPLVPPILQYNTGIQRAFNNMDAVASIGASGLTDMKKLAKWAA-ESKLDPNDPNNAALMQLTASNGEASV-------PEFFRLEHLQKEFNFTSEEELRRSKRFRLLQLRNQEVAEFRNYKQIPLKDREIPDKLFQDYEKKLREQDTITAESHLDKHRVLVAKYLQRVRESVINRFLVAKHHFILSDLVIEEDIPSLGILGMSLFKLAEPKRPLKPRRKERKKVTAQNLSDGDIKVLVNVIRAYDIPV---RKQVTSKPAQQPRSARSFNEMFTSAASPQGQTPTPESTVLVRPFVEVSFQRTVCQTTTADGPNPNWNEELVLPFRAPNSDYSTASLQSVKDDVFINVFDEVSYDILEDDRERGHGIHTRIERHWLGSVRIPFTTIYFQARIDGTFLIETPPVLLGYSKQRSAGIEGGYDATRGLSQGSFLTLFITIEPQLVPGEPVRE----KFESREDEKLLQAAEKYQSEGVQKYPNRQCLTTVTDINGTTVFVTRYIKPLNPPQELLDAHPNNTQAASELVAHYVSLIPFLPDNVSFAGICNLWSTADQFLDLLAGDEEEHAVLLCNYFLAMGK---KAWLLIGNAVPEGPTTYVLTLEQNQYI-IWNPSTGRFYGQYDTFCPLQSVGCLINADNIWFNTQQYDAPVSMTFDTSRTNMWKPFFSRSYPHPGLSSVQPEELMYQRIDKAAAAELQDRIEKILKEKIMEWRPRHPTRWNRFCTSTLRHFLPLLELNRGRDVEEDHRAELQRQLGDYRFSGFPIHMAFSEVRPLIEAVYSTGVQNSEVPNVEFALAVYVHPYPKNIYSVWVYVASLVRN 1371          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Xenopus
Match: dhcr7 (7-dehydrocholesterol reductase [Source:Xenbase;Acc:XB-GENE-920362])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 436/1411 (30.90%), Postives = 730/1411 (51.74%), Query Frame = 2
Query:  965 FLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRI-QKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLK--PIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHL---QEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGE----PVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYES--SGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHT--NEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV-------------------------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTT---VTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFV------------QGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCG-EMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            F++ LPA +   Y   L ++E    F P +  +      P     R LE+EGLY G RP I  TN+  L +RI ++E    WFG+DG+I  L +P+K+   RP +++     +   L+T  +K  P      Y  + SG+    +Q+ I++  + F+HH LFS EHVLA ++ QL+  Y    ++        ++ +L++A+Q++   +   S++    QS     I  Y+ EIR TR  R+ E+   R L  SIIK WK++KS R+    T T + + ++K+  +   D    E +I  +I E  E +  +Y K+M  Y++  Q +    K +   + +++                         + A++ + LG    GE    PV P+  D++ + +++R +    RR PGEP + P + + G+++ NE   + E+ RR  +QK+  +I + FNNK+V  T  K L  DF V   E   + I   PE I L++YE+   G T+  L+ A + +P     +    +E   F +NQ ++H + GVGS +  F  E+ DG  S ++I  L TSG +     W V  +G  ++P     +       +N D + ++G + + D+++  +W + ES LDPNDP +A ++  + T  N E  +        +FFRL     EF F++E+++ RS RFR+++LRN  V EF     IPL D ++P +L +DYE +          +  +  +++  +++++VR+ V+++F  +     L ++V EE+IP++  +   LF +    RPL+   + RK ++  N+ + +++++V + RA ++PV                                      V +  + PFV+V+FQ     T   +G NP W+ EL LPF+ P +     SL +++D + INV+D+   ++  D   + H +H R ERHWLGS+ IPF TIY  ++I+G F ++ P  +             GY++   +     +++FIT++P++ P + +++    KF+S ED  L+   +++Q+E   ++P R    TV ++      +TRYI  L PP+ELL    N  Q   +++A +VSLI F+ D + F GI ++WST DQFL +L GDE+EHAVLLCNYF  + +   K +L +G A+PEG T YVLT E N  + +WN STG  +   D  C +  +G L+N  N+W NTQQ   P  + FD S    W P F  +     L +VQP+ ++Y+        + Q  +E  L+  IM+WR    T +       +   L  LE+N G ++ E    +++  +  Y+  GFPI++ + E+  ++  + +TG+  +  P VEFALAVY+  YP  + S+W+YVASLVRN
Sbjct:  244 FIELLPA-EYEGYRNQL-QKELDCFFIPSIQPVPTSKKVPENMQPRFLEDEGLYTGERPKITQTNQNILENRILRQEESKKWFGDDGKILALANPIKQSSTRPPIFSLH-EGIDQALETIYVKAGPPKEENRYA-VGSGE----YQLDIDISGIVFTHHPLFSREHVLASKLAQLYDQYLGRKQKNLSGLLTDKLHALRNAVQNIYGIRAANSSRTFVEQS-----ISEYKLEIRQTRKLRDTEQQKDRMLLKSIIKVWKEMKSLRDFQKFTNTSMKLFLRKEDVNKKSDEEAHEAEIQAEIQELIEEYMEDYEKDMVQYKSDLQKWKSWRKAQKLKKKKKK-------------------------EGADEEEELGASHTGEELPKPVPPEIIDKKDVEQQVREKAAHIRRKPGEPILIPEMNLSGAVTPNELCPRVEVQRREDIQKHSLFIRILFNNKEVSRTIAKRLGSDFRVHLGEIFNLQIFNLPESIKLEIYETVRHGATT-LLADAFIPIPETTVHTGRAPVEEIEFSSNQRVMHDHEGVGS-DVPFSFEA-DG--SNKMI--LMTSGKVSYAASWGVGDNGVPLVPPILQYNTGIQRAFNNMDAVASIGASGLTDMKKLAKW-AAESKLDPNDPNNAALMQLVMTASNGEASV-------PEFFRLEHLQKEFNFTSEEELRRSKRFRLLQLRNQEVAEFRNYKQIPLKDREIPDKLFQDYEKKLREQDTITAESHLDKHRVLVAKYLQRVRESVINRFLVAKHHFILSDLVIEEDIPSLGILGMSLFKLAEPKRPLKPRRKERKKVTAQNLSDGDIKVLVNVIRAYDIPVRKQVTSKPAQQPRSARSFNEMFTSAASPQGQTPTPESTVNQVLVRPFVEVSFQRTVCQTTTADGPNPNWNEELVLPFRAPNSDYSTASLQSVKDDVFINVFDEVSYDILEDDRERGHGIHTRIERHWLGSVRIPFTTIYFQARIDGTFLIETPPVLLGYSKQRSAGIEGGYDATRGLSQGSFLTLFITIEPQLVPGEPVRE----KFESREDEKLLQAAEKYQSEGVQKYPNRQCLTTVTDINGTTVFVTRYIKPLNPPQELLDAHPNNTQAASELVAHYVSLIPFLPDNVSFAGICNLWSTADQFLDLLAGDEEEHAVLLCNYFLAMGK---KAWLLIGNAVPEGPTTYVLTLEQNQYI-IWNPSTGRFYGQYDTFCPLQSVGCLINADNIWFNTQQYDAPVSMTFDTSRTNMWKPFFSRSYPHPGLSSVQPEELMYQRIDKAAAAELQDRIEKILKEKIMEWRPRHPTRWNRFCTSTLRHFLPLLELNRGRDVEEDHRAELQRQLGDYRFSGFPIHMAFSEVRPLIEAVYSTGVQNSEVPNVEFALAVYVHPYPKNIYSVWVYVASLVRN 1593          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Xenopus
Match: dhcr7 (7-dehydrocholesterol reductase [Source:Xenbase;Acc:XB-GENE-920362])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 423/1371 (30.85%), Postives = 711/1371 (51.86%), Query Frame = 2
Query: 1088 RNLEEEGLYVGRRPFINTTNERKLASRI-QKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHL---QEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGE----PVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYES--SGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPK-----LFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLT-------------------------------------PFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTT---VTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFV------------QGYESDEYMESFPMMSVFITLDPEIHPPQSLKDR----NITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCG-EMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            R LE+EGLY G RP I  TN+  L +RI ++E    WFG+DG+I  L +P+K+   RP +++     + +G+    L       T+    SG+    +Q+ I++  + F+HH LFS EHVLA ++ QL+  Y    ++        ++ +L++A+Q++   +   S++    QS     I  Y+ EIR TR  R+ E+   R L  SIIK WK++KS R+    T T + + ++K+  +   D    E +I  +I E  E +  +Y K+M  Y++  Q +    K +   + ++                          + A++ + LG    GE    PV P+  D++ + +++R +    RR PGEP + P + + G+++ NE   + E+ RR  +QK+  +I + FNNK+V  T  K L  DF V   E   + I   PE I L++YE+   G T+  L+ A + +P     +    +E   F +NQ ++H + GVGS +  F  E+ DG  S ++I  L TSG +     W V  +G  ++P     +       +N D + ++G + + D+++  +W + ES LDPNDP +A ++    +N E  +        +FFRL     EF F++E+++ RS RFR+++LRN  V EF     IPL D ++P +L +DYE +          +  +  +++  +++++VR+ V+++F  +     L ++V EE+IP++           LF +    RPL+   + RK ++  N+ + +++++V + RA ++PV   R+ +T                                     PFV+V+FQ     T   +G NP W+ EL LPF+ P +     SL +++D + INV+D+   ++  D   + H +H R ERHWLGS+ IPF TIY  ++I+G F ++ P  +             GY++   +     +++FIT++P++ P + ++++    ++  F+S ED  L+   +++Q+E   ++P R    TV ++      +TRYI  L PP+ELL    N  Q   +++A +VSLI F+ D + F GI ++WST DQFL +L GDE+EHAVLLCNYF  + +   K +L +G A+PEG T YVLT E N  + +WN STG  +   D  C +  +G L+N  N+W NTQQ   P  + FD S    W P F  +     L +VQP+ ++Y+        + Q  +E  L+  IM+WR    T +       +   L  LE+N G ++ E    +++  +  Y+  GFPI++ + E+  ++  + +TG+  +  P VEFALAVY+  YP  + S+W+YVASLVRN
Sbjct:   89 RFLEDEGLYTGERPKITQTNQNILENRILRQEESKKWFGDDGKILALANPIKQSSTRPPIFS-----LHEGM----LNLYKKCKTF---GSGE----YQLDIDISGIVFTHHPLFSREHVLASKLAQLYDQYLGRKQKNLSGLLTDKLHALRNAVQNIYGIRAANSSRTFVEQS-----ISEYKLEIRQTRKLRDTEQQKDRMLLKSIIKVWKEMKSLRDFQKFTNTSMKLFLRKEDVNKKSDEEAHEAEIQAEIQELIEEYMEDYEKDMVQYKSDLQKWKSWRKAQLKKKKKK--------------------------EGADEEEELGASHTGEELPKPVPPEIIDKKDVEQQVREKAAHIRRKPGEPILIPEMNLSGAVTPNELCPRVEVQRREDIQKHSLFIRILFNNKEVSRTIAKRLGSDFRVHLGEIFNLQIFNLPESIKLEIYETVRHGATT-LLADAFIPIPETTVHTGRAPVEEIEFSSNQRVMHDHEGVGS-DVPFSFEA-DG--SNKMI--LMTSGKVSYAASWGVGDNGVPLVPPILQYNTGIQRAFNNMDAVASIGASGLTDMKKLAKW-AAESKLDPNDPNNAALMQLTASNGEASV-------PEFFRLEHLQKEFNFTSEEELRRSKRFRLLQLRNQEVAEFRNYKQIPLKDREIPDKLFQDYEKKLREQDTITAESHLDKHRVLVAKYLQRVRESVINRFLVAKHHFILSDLVIEEDIPSLGSGGSGILGMSLFKLAEPKRPLKPRRKERKKVTAQNLSDGDIKVLVNVIRAYDIPV---RKQVTSKPAQQPRSARSFNEMFTSAASPQGQTPTPESTVLVRPFVEVSFQRTVCQTTTADGPNPNWNEELVLPFRAPNSDYSTASLQSVKDDVFINVFDEVSYDILEDDRERGHGIHTRIERHWLGSVRIPFTTIYFQARIDGTFLIETPPVLLGYSKQRSAGIEGGYDATRGLSQGSFLTLFITIEPQLVPGEPVREKLHSDSLVSFESREDEKLLQAAEKYQSEGVQKYPNRQCLTTVTDINGTTVFVTRYIKPLNPPQELLDAHPNNTQAASELVAHYVSLIPFLPDNVSFAGICNLWSTADQFLDLLAGDEEEHAVLLCNYFLAMGK---KAWLLIGNAVPEGPTTYVLTLEQNQYI-IWNPSTGRFYGQYDTFCPLQSVGCLINADNIWFNTQQYDAPVSMTFDTSRTNMWKPFFSRSYPHPGLSSVQPEELMYQRIDKAAAAELQDRIEKILKEKIMEWRPRHPTRWNRFCTSTLRHFLPLLELNRGRDVEEDHRAELQRQLGDYRFSGFPIHMAFSEVRPLIEAVYSTGVQNSEVPNVEFALAVYVHPYPKNIYSVWVYVASLVRN 1390          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Xenopus
Match: dhcr7 (7-dehydrocholesterol reductase [Source:Xenbase;Acc:XB-GENE-920362])

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 436/1416 (30.79%), Postives = 729/1416 (51.48%), Query Frame = 2
Query:  965 FLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRI-QKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLK--PIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHL---QEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGE----PVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYES--SGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHT--NEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPK-----LFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV-------------------------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTT---VTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFV------------QGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCG-EMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            F++ LPA +   Y   L ++E    F P +  +      P     R LE+EGLY G RP I  TN+  L +RI ++E    WFG+DG+I  L +P+K+   RP +++     +   L+T  +K  P      Y  + SG+    +Q+ I++  + F+HH LFS EHVLA ++ QL+  Y    ++        ++ +L++A+Q++   +   S++    QS     I  Y+ EIR TR  R+ E+   R L  SIIK WK++KS R+    T T + + ++K+  +   D    E +I  +I E  E +  +Y K+M  Y++  Q +    K +   + +++                         + A++ + LG    GE    PV P+  D++ + +++R +    RR PGEP + P + + G+++ NE   + E+ RR  +QK+  +I + FNNK+V  T  K L  DF V   E   + I   PE I L++YE+   G T+  L+ A + +P     +    +E   F +NQ ++H + GVGS +  F  E+ DG  S ++I  L TSG +     W V  +G  ++P     +       +N D + ++G + + D+++  +W + ES LDPNDP +A ++  + T  N E  +        +FFRL     EF F++E+++ RS RFR+++LRN  V EF     IPL D ++P +L +DYE +          +  +  +++  +++++VR+ V+++F  +     L ++V EE+IP++           LF +    RPL+   + RK ++  N+ + +++++V + RA ++PV                                      V +  + PFV+V+FQ     T   +G NP W+ EL LPF+ P +     SL +++D + INV+D+   ++  D   + H +H R ERHWLGS+ IPF TIY  ++I+G F ++ P  +             GY++   +     +++FIT++P++ P + +++    KF+S ED  L+   +++Q+E   ++P R    TV ++      +TRYI  L PP+ELL    N  Q   +++A +VSLI F+ D + F GI ++WST DQFL +L GDE+EHAVLLCNYF  + +   K +L +G A+PEG T YVLT E N  + +WN STG  +   D  C +  +G L+N  N+W NTQQ   P  + FD S    W P F  +     L +VQP+ ++Y+        + Q  +E  L+  IM+WR    T +       +   L  LE+N G ++ E    +++  +  Y+  GFPI++ + E+  ++  + +TG+  +  P VEFALAVY+  YP  + S+W+YVASLVRN
Sbjct:  244 FIELLPA-EYEGYRNQL-QKELDCFFIPSIQPVPTSKKVPENMQPRFLEDEGLYTGERPKITQTNQNILENRILRQEESKKWFGDDGKILALANPIKQSSTRPPIFSLH-EGIDQALETIYVKAGPPKEENRYA-VGSGE----YQLDIDISGIVFTHHPLFSREHVLASKLAQLYDQYLGRKQKNLSGLLTDKLHALRNAVQNIYGIRAANSSRTFVEQS-----ISEYKLEIRQTRKLRDTEQQKDRMLLKSIIKVWKEMKSLRDFQKFTNTSMKLFLRKEDVNKKSDEEAHEAEIQAEIQELIEEYMEDYEKDMVQYKSDLQKWKSWRKAQKLKKKKKK-------------------------EGADEEEELGASHTGEELPKPVPPEIIDKKDVEQQVREKAAHIRRKPGEPILIPEMNLSGAVTPNELCPRVEVQRREDIQKHSLFIRILFNNKEVSRTIAKRLGSDFRVHLGEIFNLQIFNLPESIKLEIYETVRHGATT-LLADAFIPIPETTVHTGRAPVEEIEFSSNQRVMHDHEGVGS-DVPFSFEA-DG--SNKMI--LMTSGKVSYAASWGVGDNGVPLVPPILQYNTGIQRAFNNMDAVASIGASGLTDMKKLAKW-AAESKLDPNDPNNAALMQLVMTASNGEASV-------PEFFRLEHLQKEFNFTSEEELRRSKRFRLLQLRNQEVAEFRNYKQIPLKDREIPDKLFQDYEKKLREQDTITAESHLDKHRVLVAKYLQRVRESVINRFLVAKHHFILSDLVIEEDIPSLGSGGSGILGMSLFKLAEPKRPLKPRRKERKKVTAQNLSDGDIKVLVNVIRAYDIPVRKQVTSKPAQQPRSARSFNEMFTSAASPQGQTPTPESTVNQVLVRPFVEVSFQRTVCQTTTADGPNPNWNEELVLPFRAPNSDYSTASLQSVKDDVFINVFDEVSYDILEDDRERGHGIHTRIERHWLGSVRIPFTTIYFQARIDGTFLIETPPVLLGYSKQRSAGIEGGYDATRGLSQGSFLTLFITIEPQLVPGEPVRE----KFESREDEKLLQAAEKYQSEGVQKYPNRQCLTTVTDINGTTVFVTRYIKPLNPPQELLDAHPNNTQAASELVAHYVSLIPFLPDNVSFAGICNLWSTADQFLDLLAGDEEEHAVLLCNYFLAMGK---KAWLLIGNAVPEGPTTYVLTLEQNQYI-IWNPSTGRFYGQYDTFCPLQSVGCLINADNIWFNTQQYDAPVSMTFDTSRTNMWKPFFSRSYPHPGLSSVQPEELMYQRIDKAAAAELQDRIEKILKEKIMEWRPRHPTRWNRFCTSTLRHFLPLLELNRGRDVEEDHRAELQRQLGDYRFSGFPIHMAFSEVRPLIEAVYSTGVQNSEVPNVEFALAVYVHPYPKNIYSVWVYVASLVRN 1598          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Xenopus
Match: cep76 (centrosomal protein 76kDa [Source:NCBI gene;Acc:549585])

HSP 1 Score: 71.633 bits (174), Expect = 8.269e-12
Identity = 76/326 (23.31%), Postives = 131/326 (40.18%), Query Frame = 2
Query: 4085 ARFVSLISF-MADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKF-------------KSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPF------LKEVQDFQLTLENQLRSNIMDWR--FGLTT------NFIIAPRREMVEILKCLEINCG--EMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATG-----IHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            ARFV+++ +  A  +   G  + W T   FL    GD ++H  LLC+       D    ++C+G      +  +V+T   +G +  W + TG ++             +   P      IG + N +   AN+Q         FDL  ++ W P+ +  I      P +I    PF      L +       +E QLR  +++ R   GLTT      +++++P     EI +   I+ G  E  + I   V D   G+   GFPI+  +       +    +      I    D ++  A+ V + +YP    ++WI  A   R+
Sbjct:  342 ARFVNVLGYERAPTVGGGGKQEQWCTLLAFLCRNKGDCEDHCNLLCSLLLGFGLD---AYVCVGTKGRGQAHTWVMTCGTDGAITFWESLTGHRYVHKPINPDDPPMVEQPKPLYPYKTIGCVFNHKRFLANSQPLDAVEVCVFDLHDESRWKPMSEEAIK-SVCSPGSIASLPPFPPLCGSLLDAATESNEIELQLRVLVLEHRKDLGLTTVWDDQLSYLLSPALASYEIERTTGISAGNEEFQDCIRRAVPD---GHTFKGFPIHFVHRNARRAFATCLRSPFCDEIISCRGD-QMRLAVRVRVYTYPEAACAVWIMFACKYRS 659          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Mouse
Match: Cc2d2a (coiled-coil and C2 domain containing 2A [Source:MGI Symbol;Acc:MGI:1924487])

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 438/1396 (31.38%), Postives = 730/1396 (52.29%), Query Frame = 2
Query: 1016 IEEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRIQ-KENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEH-IDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQS--EILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFK--LSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVT--GFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTIND-----IFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVD-----------------VERRTLTP--------------------FVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGY------------ESDEYMESFPMMSVFITLDPEIHPPQSLKDRN---ITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            +++E  +LF P  + +  +   P     R LE+EGLY+G RP +  TNE  + +R+  +E    WFG+DGRI  LP P+K  P RP +   + +P   GL+T   K      + +H I SGDP  +FQ+ I++  L F+HH  FS EHVLA ++ QL+  Y    ++    F   ++ +L+ A+Q       N     QS       I+ Y+ EIR TR  R+ E+   R L  +IIK WK++KS R     T T + + ++K+  D   D   +E +I  +I E  E     Y  +M+ Y    Q +    K +   + ++++   +    +  +      E                  + +P+ P+P D   + +++R +    RR PGEP + P L + G+++ N+   + E++RR  +++   Y+++ FN+K+V  T ++ L  DF V F +   + I  +PE ++L++YE+ G +   L  AE+ +P+P    ++    +E   F +NQ++   + GVGSG    P  S +   S ++   L TSG +     WAV  +G  +IP     +  F +     D + ++G + + D+++  +W + ES LDPNDP  A ++  +     +    E+ +  DFFRL     EF F +E++++RS RFR++ LR+  VPEF     IP YD ++  ++ +DYE R  +    +I T    +  +    +++++VR+ V+++F T+     L ++V EEE+P I+      +   LF +    RPL+   + RK ++  N+ + +++++V I RA ++PV                   E++T +P                    FV+V+FQ     T   EG NP+W+ EL LPF+ P    +  SL +++D + IN++D+ + ++  D   +   +H R ERHWLG ++IPF+TIY  ++I+G F++  P  + GY            +S   +     +++FIT++P++ P + ++++    + KFD+ ED  L+   +++Q E  ++FP+R    TV +M  +   ITRY+  L PP+ELL V  N  Q   +++AR+VSLI F+ D++ F G+ D+WST DQFL +L GDE+EHAVLLCNYF +L +   K +L +G AIPEG TAYVLT E N  + +WN  +G  +   D  C +  +G L+   N+W N Q    P  + FD++    W   F  ++    L +VQP+ +IY+        + Q  +E  L+  IMDWR    T +       +   L  LE + GE + +    ++   +  Y+  GFP+++PY E+  ++  + +TG+H    P VEFALAVYI  YP  VLS+WIYVASLVRN
Sbjct:  279 LQKEKEILFTPSRLTVPTYKKLPENIQPRFLEDEGLYIGARPEVARTNENIMENRLLIQEPGSKWFGDDGRILALPSPIKPFPSRPSLTTREQSPKA-GLETLYKKAEKYVHSRQHMIGSGDPPGNFQLDIDISGLIFTHHPCFSREHVLASKLAQLYDQYLARQQRNKTKFLTDKLQALRKAVQ----TSLNPEKPHQSLDTTQKTINEYKSEIRQTRKLRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKVDPKLDEDAYEAEIQAEIHELLEEHMEEYATKMEEYRTSHQQWKAWRKAQRAKKKKKKQTTEEHLEEEEAEESFPEEE------------------VTKPIPPEPTDPAVIEQQVRERAAHSRRRPGEPTLIPELSLAGNVTPNDQCPRVEVSRREDVRRRSVYLKVVFNSKEVSRTVSRPLGADFRVHFGQIFNLQIFNWPESLMLQVYETIGHSGTTLL-AEVFLPIPETTLVTGRAPIEEVEFSSNQHVTLDHEGVGSG---VPF-SFEADGSNQLT--LMTSGKVSHSVAWAVGENGIPLIPPLSQQNIGFRSALRRADAISSIGTSGLTDMKKLAKW-AAESKLDPNDPNHAPLMQLI----SVATSGESYVP-DFFRLEQLQQEFNFVSEEELNRSKRFRLLHLRSQEVPEFRNYKQIPAYDREIMEKVFQDYEKR--LRDRNVIETKDHLDMHRATVAKYLQQVREAVVNRFLTAKHHFLLTDLVVEEEVPNISSEGSGILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIIRAYDIPVRKPVVSKFQQPSRSSRTFSEKQTASPSTHSPLHNADYPLGQVLVRPFVEVSFQRTICHTTTAEGPNPSWNEELELPFRAPNGDYSTASLQSVKDDVYINIFDEVLYDILEDDRERGSGIHTRIERHWLGCVKIPFSTIYFQARIDGTFKIDIPPVLLGYSKERNIIMERAFDSARSLSEGSYITLFITIEPQLVPGEPMREKMSDMLKKFDTQEDEKLLQATEKFQAECALKFPQRQCLTTVTDMTGKTVFITRYLKPLNPPQELLHVYPNNPQATAELVARYVSLIPFLPDSVSFAGVCDLWSTSDQFLDLLAGDEEEHAVLLCNYFLFLGK---KAWLVMGSAIPEGPTAYVLTWEKNYYL-IWNPCSGHCYGQFDAFCPLKSVGCLIGPDNIWFNIQHHDSPLRINFDVTKPKLWKSFFSRSLPYPGLSSVQPEELIYQHTDKAVAAELQDRIEKILKEKIMDWRPRHLTRWNRYCTSTLRHFLPLLERSQGEDIEDDHRAELLKQLGDYRFSGFPLHMPYSEVKPLVEAVYSTGVHNIDLPNVEFALAVYIHPYPKNVLSVWIYVASLVRN 1632          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Mouse
Match: Cc2d2a (coiled-coil and C2 domain containing 2A [Source:MGI Symbol;Acc:MGI:1924487])

HSP 1 Score: 555.058 bits (1429), Expect = 3.677e-170
Identity = 389/1255 (31.00%), Postives = 657/1255 (52.35%), Query Frame = 2
Query: 1016 IEEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRIQ-KENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEH-IDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQS--EILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFK--LSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVT--GFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVD-----------------VERRTLT--------------------PFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGY------------ESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYE 4561
            +++E  +LF P  + +  +   P     R LE+EGLY+G RP +  TNE  + +R+  +E    WFG+DGRI  LP P+K  P RP +   + +P   GL+T   K      + +H I SGDP  +FQ+ I++  L F+HH  FS EHVLA ++ QL+  Y    ++    F   ++ +L+ A+Q       N     QS       I+ Y+ EIR TR  R+ E+   R L  +IIK WK++KS R     T T + + ++K+  D   D   +E +I  +I E  E     Y  +M+ Y    Q +    K +   + ++++   +    +  +      E                  + +P+ P+P D   + +++R +    RR PGEP + P L + G+++ N+   + E++RR  +++   Y+++ FN+K+V  T ++ L  DF V F +   + I  +PE ++L++YE+ G +   L  AE+ +P+P    ++    +E   F +NQ++   + GVGSG    P  S +   S ++   L TSG +     WAV  +G  +IP     +  F +     D + ++G + + D+++  +W + ES LDPNDP  A ++  +     +    E+ +  DFFRL     EF F +E++++RS RFR++ LR+  VPEF     IP YD ++  ++ +DYE R  +    +I T    +  +    +++++VR+ V+++F T+     L ++V EEE+P I+ +   LF +    RPL+   + RK ++  N+ + +++++V I RA ++PV                   E++T +                    PFV+V+FQ     T   EG NP+W+ EL LPF+ P    +  SL +++D + IN++D+ + ++  D   +   +H R ERHWLG ++IPF+TIY  ++I+G F++  P  + GY            +S   +     +++FIT++P++ P + +++    KFD+ ED  L+   +++Q E  ++FP+R    TV +M  +   ITRY+  L PP+ELL V  N  Q   +++AR+VSLI F+ D++ F G+ D+WST DQFL +L GDE+EHAVLLCNYF +L +   K +L +G AIPEG TAYVLT E N  + +WN  +G  +   D  C +  +G L+   N+W N Q    P  + FD++    W   F  ++    L +VQP+ +IY+
Sbjct:  230 LQKEKEILFTPSRLTVPTYKKLPENIQPRFLEDEGLYIGARPEVARTNENIMENRLLIQEPGSKWFGDDGRILALPSPIKPFPSRPSLTTREQSPKA-GLETLYKKAEKYVHSRQHMIGSGDPPGNFQLDIDISGLIFTHHPCFSREHVLASKLAQLYDQYLARQQRNKTKFLTDKLQALRKAVQ----TSLNPEKPHQSLDTTQKTINEYKSEIRQTRKLRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKVDPKLDEDAYEAEIQAEIHELLEEHMEEYATKMEEYRTSHQQWKAWRKAQRAKKKKKKQTTEEHLEEEEAEESFPEEE------------------VTKPIPPEPTDPAVIEQQVRERAAHSRRRPGEPTLIPELSLAGNVTPNDQCPRVEVSRREDVRRRSVYLKVVFNSKEVSRTVSRPLGADFRVHFGQIFNLQIFNWPESLMLQVYETIGHSGTTL-LAEVFLPIPETTLVTGRAPIEEVEFSSNQHVTLDHEGVGSG---VPF-SFEADGSNQLT--LMTSGKVSHSVAWAVGENGIPLIPPLSQQNIGFRSALRRADAISSIGTSGLTDMKKLAKW-AAESKLDPNDPNHAPLMQLI----SVATSGESYV-PDFFRLEQLQQEFNFVSEEELNRSKRFRLLHLRSQEVPEFRNYKQIPAYDREIMEKVFQDYEKR--LRDRNVIETKDHLDMHRATVAKYLQQVREAVVNRFLTAKHHFLLTDLVVEEEVPNISILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIIRAYDIPVRKPVVSKFQQPSRSSRTFSEKQTASPSTHSPLHNADYPLGQVLVRPFVEVSFQRTICHTTTAEGPNPSWNEELELPFRAPNGDYSTASLQSVKDDVYINIFDEVLYDILEDDRERGSGIHTRIERHWLGCVKIPFSTIYFQARIDGTFKIDIPPVLLGYSKERNIIMERAFDSARSLSEGSYITLFITIEPQLVPGEPMRE----KFDTQEDEKLLQATEKFQAECALKFPQRQCLTTVTDMTGKTVFITRYLKPLNPPQELLHVYPNNPQATAELVARYVSLIPFLPDSVSFAGVCDLWSTSDQFLDLLAGDEEEHAVLLCNYFLFLGK---KAWLVMGSAIPEGPTAYVLTWEKNYYL-IWNPCSGHCYGQFDAFCPLKSVGCLIGPDNIWFNIQHHDSPLRINFDVTKPKLWKSFFSRSLPYPGLSSVQPEELIYQ 1438          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Mouse
Match: Cc2d2b (coiled-coil and C2 domain containing 2B [Source:MGI Symbol;Acc:MGI:3645359])

HSP 1 Score: 442.58 bits (1137), Expect = 4.377e-130
Identity = 298/956 (31.17%), Postives = 506/956 (52.93%), Query Frame = 2
Query: 2216 NLTKEEL---NRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFK--LSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDA----KVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRN-NNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVRE-EEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV---------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYE-SDEYM-----------ESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDR-DLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAV---DENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNIN---LQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            NL+K  L    RR  MQK +Y+I++F+NNK+V  TS   L  DF V F++   + +  +PE I L++YE S  ++  +   ++ +PLP K  L     +E   F +++ ++  + GVGS   + P  +L  +   E+   L TSG L     WA++ +G  + P+S   S  + ++  N D     GL  I++ Q+  EW   ++ +DP++P  +     ++   H  +E+           +FRL    DEF F +E++++RS RF++++LRN   +  FL  P+PLYD+++P  + ++YE++   +     V    A+++    F++KVR  ++ +    + K +L ++V + EEI + + +   +       R L+   + R+ ++  +I + +++I+V I RA N+P           V + T+ PF++V+FQ+    T++  G +P W+ E+++ F  P    + +SL  I+D + IN++D+ VI  + D   K  + H   +++WLGS+  PF+ +    +I G F++  P  + GY  S+ Y+           +    +++F T++P+I    S    N  K D   D+ D++     +       FP R    TV N      L+TRYI  L PP++LL +   D N    +IARFVSLI F A+ +     SDIW T +  + + IG+++EHA+LLCN+F Y  +   K  + LG ++ EG  AYVLT+E + +  LWN STG   K  DP C +  +  L N++NVW N QQ   P  ++FD S ++ W  L   N+     Q+VQP+ I+Y +     V+D +  +E  L+  +M+WR    T +       + +IL  LE   G      +  ++ L+  Y V GFPI +PY ++  V+  +  TG+H +  P+ EFALAVYI  YPN +LS+W+Y+ASL R+
Sbjct:  478 NLSKCSLYEQKRRAKMQKLKYFIKIFYNNKQVSRTSVSPLQFDFKVMFQQIFNIQLIYWPETICLEVYEVSKRSTLLV---KLYLPLPNKTELKGKTVLEYTEFSSDKLVIPMDGGVGS---NVPF-NLKESEDEELC--LLTSGKLSYSLSWALDENGIPLTPVSQSLSSAYCSVLRNVDARGVPGLPWIVNSQKLCEWAD-DARIDPHNPDYSDITEHIMCLRHKGQEI---------PKYFRLEQLQDEFNFVSEEEMERSKRFQLLQLRNAGQLDLFLLQPMPLYDNEIPDIVFQEYESQAQKDIPISDVNSITAQRINSVNFLKKVRRLIMKRI-VKVNKFNLSDIVADYEEIVSTSQLTDAICKFIEPRRKLKPQRKERRKVTAQSISDGDMKILVRILRAYNIPTRKTVSYSVYSVFQDTVHPFIEVSFQHTVYQTNIANGSHPCWNEEIKVDFISPGHDYSFSSLSKIKDNIHINIFDEVVIEKHEDHCLKSCSAHSYIQKNWLGSISFPFSALLQQPEISGTFQVNIPPILLGYTWSNTYVPPREDCSGQNPKECTFLNIFATIEPQI----SYVTYN-PKVDEFSDQIDILQRAQTFTRNCKAMFPNRRVVATVFNGEGMHILVTRYIKALNPPQQLLDIFLHDSNATLDLIARFVSLIPFAAETLDENDGSDIWMTSECCISLAIGNKEEHAILLCNFFLYFGK---KALVTLGTSVLEGHVAYVLTQETD-ECLLWNPSTGQCHKQFDPFCPLQSVDCLFNDKNVWFNIQQNNTPMAVQFDYSKESFWKQLLPKNVQGTKAQSVQPEEIVYSDTNKSMVEDLKSRIERALKCKMMEWRPKHPTRWNRQCTSVLRQILPKLEFYPGSFASFEDSDLERLLQFYWVTGFPIQMPYTDVQAVIDAVYQTGLHASEFPQTEFALAVYIHPYPNNILSVWVYLASLARH 1404          

HSP 2 Score: 67.781 bits (164), Expect = 1.275e-10
Identity = 72/234 (30.77%), Postives = 113/234 (48.29%), Query Frame = 2
Query: 1088 RNLEEEGLYVGRRPFINTTNERKLASRIQ--KENKMDWFGEDGRIKILPDPLK-EIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKK 1780
            R LE+EGLYV ++P        K+ +R+   +E K  WF E G I  LP P++    +R  M  E  NP    +  + +K  +     + +D       +Q+ +N+  L+FSHH LFS EHVL  R+ +L  + Q   +Q       +++ +LK A      KL +KN          + +Y ++I +T+     E      L  S+++TWKQIKS R   G T T V V+  +
Sbjct:  185 RILEDEGLYVQKKPETYKKICNKMENRLLSLQEGKC-WFEESGEIMSLPSPIRPSWNYRLCMSKESLNPALKTIHRKAVKSDVGCCFRDRMDGQ--REMYQLDLNIVGLQFSHHPLFSQEHVLCARLLRLCESLQDRQRQSVSQLLYEKLRALKDAT-----KLISKNPELSQFTTKSLQDYYRQISDTKQLYEAEREKDHSLLHSVLQTWKQIKSLRQKQGFTSTPVKVQFHR 410          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Mouse
Match: Cc2d2b (coiled-coil and C2 domain containing 2B [Source:MGI Symbol;Acc:MGI:3645359])

HSP 1 Score: 207.994 bits (528), Expect = 7.728e-54
Identity = 176/636 (27.67%), Postives = 292/636 (45.91%), Query Frame = 2
Query: 2735 NRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITAL----HTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRN-NNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYE-SDEYM-----------ESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDR-DLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAV---DENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNIN---LQTVQPDAIIYEEPF 4570
            N D     GL  I++ Q+  EW   ++ +DP++P  + +   +    H  +E+           +FRL    DEF F +E++++RS RF++++LRN   +  FL  P+PLYD+++P                 I+   F+ R+LI +  ++      ++KF  S +     E+V   ++    D   K     R  +P ++    R+ ++  +I + +++I+V I RA N+P    R+T++                    +P  D           + +SL  I+D + IN++D+ VI                 E+H                +I G F++  P  + GY  S+ Y+           +    +++F T++P+I    S    N  K D   D+ D++     +       FP R    TV N      L+TRYI  L PP++LL +   D N    +IARFVSLI F A+ +     SDIW T +  + + IG+++EHA+LLCN+F Y  +   K  + LG ++ EG  AYVLT+E + +  LWN STG   K  DP C +  +  L N++NVW N QQ   P  ++FD S ++ W  L   N+     Q+VQ      + P+
Sbjct:  488 NVDARGVPGLPWIVNSQKLCEWAD-DARIDPHNPDYSDITEHIMCLRHKGQEI---------PKYFRLEQLQDEFNFVSEEEMERSKRFQLLQLRNAGQLDLFLLQPMPLYDNEIP----------------DIV---FQVRRLIMKRIVK------VNKFNLSDIVADYEEIVSTSQL---TDAICKFIEPRRKLKPQRK---ERRKVTAQSISDGDMKILVRILRAYNIPT---RKTVS------------------YSSPGHDY----------SFSSLSKIKDNIHINIFDEVVI-----------------EKH----------------EISGTFQVNIPPILLGYTWSNTYVPPREDCSGQNPKECTFLNIFATIEPQI----SYVTYN-PKVDEFSDQIDILQRAQTFTRNCKAMFPNRRVVATVFNGEGMHILVTRYIKALNPPQQLLDIFLHDSNATLDLIARFVSLIPFAAETLDENDGSDIWMTSECCISLAIGNKEEHAILLCNFFLYFGK---KALVTLGTSVLEGHVAYVLTQETD-ECLLWNPSTGQCHKQFDPFCPLQSVDCLFNDKNVWFNIQQNNTPMAVQFDYSKESFWKQLLPKNVQGTKAQSVQVTGFPIQMPY 1009          

HSP 2 Score: 78.5666 bits (192), Expect = 6.319e-14
Identity = 31/62 (50.00%), Postives = 45/62 (72.58%), Query Frame = 2
Query: 4772 KVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            +V GFPI +PY ++  V+  +  TG+H +  P+ EFALAVYI  YPN +LS+W+Y+ASL R+
Sbjct:  999 QVTGFPIQMPYTDVQAVIDAVYQTGLHASEFPQTEFALAVYIHPYPNNILSVWVYLASLARH 1060          

HSP 3 Score: 67.3958 bits (163), Expect = 1.744e-10
Identity = 72/234 (30.77%), Postives = 113/234 (48.29%), Query Frame = 2
Query: 1088 RNLEEEGLYVGRRPFINTTNERKLASRIQ--KENKMDWFGEDGRIKILPDPLK-EIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKK 1780
            R LE+EGLYV ++P        K+ +R+   +E K  WF E G I  LP P++    +R  M  E  NP    +  + +K  +     + +D       +Q+ +N+  L+FSHH LFS EHVL  R+ +L  + Q   +Q       +++ +LK A      KL +KN          + +Y ++I +T+     E      L  S+++TWKQIKS R   G T T V V+  +
Sbjct:  185 RILEDEGLYVQKKPETYKKICNKMENRLLSLQEGKC-WFEESGEIMSLPSPIRPSWNYRLCMSKESLNPALKTIHRKAVKSDVGCCFRDRMDGQ--REMYQLDLNIVGLQFSHHPLFSQEHVLCARLLRLCESLQDRQRQSVSQLLYEKLRALKDAT-----KLISKNPELSQFTTKSLQDYYRQISDTKQLYEAEREKDHSLLHSVLQTWKQIKSLRQKQGFTSTPVKVQFHR 410          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Mouse
Match: Cep76 (centrosomal protein 76 [Source:MGI Symbol;Acc:MGI:1923401])

HSP 1 Score: 77.7962 bits (190), Expect = 7.175e-14
Identity = 100/423 (23.64%), Postives = 168/423 (39.72%), Query Frame = 2
Query: 3791 MESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISF-MADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKF-------------KSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPF---LKEVQDFQLT---LENQLRSNIMDWR--FGLTT------NFIIAPRREMVEILKCLEINCG--EMNESINEKVKDLMTGYKVFGFPINLPY----MEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            +E +P +S   TL  E+   Q   +R  T   + ++R  + +  +W  E     P    R+  +  +  E  I R + +   P     + +  +Q   ARFV+++ +  A  I   G  + W T   FL    GD ++HA LLC+    L     + F+C+G        A+V+T   +G +  W + TG ++             +   P      IG + N +    N Q         FDL+ ++ W P+ +  I      P A     PF        D  +T   +E QLR  + + R   GLTT      +++++P     E  +   I+ G  E  ++I   V D   G+   GFPI+  Y          L       I      +V  A+ V + +YP +  ++WI  A   R+
Sbjct:  250 LEMYPPLSQ--TLSQEVVNTQLALERQKT---AEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQ-DENGINRPVCSYVKPLRAGRLLDTPRQA--ARFVNVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSL---LLGYGLEAFVCVGTKAKGAPHAWVMTCGTDGTIMFWESLTGHRYIHKPTNPDGPPLAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCIFDLNDESKWKPMSEEAIK-SVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWEDQLSYLLSPALASYEFERTTSISAGNEEFQDAIRRAVPD---GHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYRS 657          
BLAST of Coiled-coil and C2 domain containing 2A vs. UniProt/SwissProt
Match: sp|Q9P2K1|C2D2A_HUMAN (Coiled-coil and C2 domain-containing protein 2A OS=Homo sapiens OX=9606 GN=CC2D2A PE=1 SV=3)

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 442/1403 (31.50%), Postives = 734/1403 (52.32%), Query Frame = 2
Query:  965 FLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRI-QKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEH-IDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFK--LSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVT--GFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV-------------------------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYM------------ESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            F+   PA     ++ L +E E  +LF P    +  +   P     R LE+EGLY G RP +  TN+  + +R+  ++ +  WFG+DGRI  LP+P+K  P RP +  ++   +   L+T   K +    + +H I SGDP  +FQ+ I++  L F+HH  FS EHVLA ++ QL+  Y    ++    F   ++ +L++A+Q   +    K   +   I   I+ Y+ EIR TR  R+ E+   R L  +IIK WK++KS R     T T + + ++K+ AD   D   +E +I  +I+E  E     Y ++M+ Y    Q +    K++   +                    KR +  E     E  +   E D+ +P  P+P D   + +E+R +    RR P EP + P L + GS++ N+   + E++RR  ++K   Y+++ FNNK+V  T ++ L  DF V F +   + I  +PE + L++YE+ G +S  L  AE+ +P+P    ++     E   F +NQ++   + GVGSG    P  S +   S ++   L TSG +     WA+  +G  +IP     +  F +     D + ++G + + D+++  +W + ES LDPNDP +A ++  +     +    E+ +  DFFRL     EF F ++ +++RS RFR++ LR+  VPEF     +P+YD ++  ++ +DYE R  +    +I T    +  + I  +++++VR+ V+++F  +     L +M+ EEE+P I+ +   LF +    RPL+   + RK ++  N+ + +++++V I RA ++PV                                      + +  + PFV+V+FQ     T   EG NP+W+ EL LPF+ P    +  SL +++D + IN++D+ + ++  D   +   +H R ERHWLG +++PF+TIY  ++I+G F++  P  + GY  +  M                 +++FIT++P++ P +S+++    KF+S ED  L+   +++Q E  ++FP R    TV+++  +   ITRY+  L PP+ELL V  N  Q   +++AR+VSLI F+ D + F GI D+WST DQFL +L GDE+EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E  G   +WN  +G  +   D  C +  +G L+   N+W N Q+   P  + FD++    W   F  ++    L +VQP+ +IY+        + Q  +E  L+  IMDWR    T +       +   L  LE + GE + +    ++   +  Y+  GFP+++PY E+  ++  + +TG+H    P VEFALAVYI  YP  VLS+WIYVASL+RN
Sbjct:  264 FVAVRPADYESIHDRLQMERE--MLFIPSRQTVPTYKKLPENVQPRFLEDEGLYTGVRPEVARTNQNIMENRLLMQDPERRWFGDDGRILALPNPIKPFPSRPPVLTQE-QSIKAELETLYKKAVKYVHSSQHVIRSGDPPGNFQLDIDISGLIFTHHPCFSREHVLAAKLAQLYDQYLARHQRNKAKFLTDKLQALRNAVQTGLD--PEKPHQSLDTIQKTINEYKSEIRQTRKFRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKADQKADEEAYEAEIQAEISELLEEHTEEYAQKMEEYRTSLQQWKAWRKVQRAKK-------------------KKRKQAAEEHPGDEIAEPYPEEDLVKPSPPEPTDRAVIEQEVRERAAQSRRRPWEPTLVPELSLAGSVTPNDQCPRAEVSRREDVKKRSVYLKVLFNNKEVSRTVSRPLGADFRVHFGQIFNLQIVNWPESLTLQVYETVGHSSPTLL-AEVFLPIPETTVVTGRAPTEEVEFSSNQHVTLDHEGVGSG---VPF-SFEADGSNQLT--LMTSGKVSHSVAWAIGENGIPLIPPLSQQNIGFRSALKKADAISSIGTSGLTDMKKLAKW-AAESKLDPNDPNNAPLMQLI----SVATSGESYVP-DFFRLEQLQQEFNFVSDQELNRSKRFRLLHLRSQEVPEFRNYKQVPVYDREIMEKVFQDYEKR--LRDRNVIETKEHIDTHRAIVAKYLQQVRESVINRFLIAKQYFLLADMIVEEEVPNISILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIVRAYDIPVRKPAVSKFQQPSRSSRMFSEKHAASPSTYSPTHNADYPLGQVLVRPFVEVSFQRTVCHTTTAEGPNPSWNEELELPFRAPNGDYSTASLQSVKDVVFINIFDEVLHDVLEDDRERGSGIHTRIERHWLGCVKMPFSTIYFQARIDGTFKIDIPPVLLGYSKERNMILERGFDSVRSLSEGSYITLFITIEPQLVPGESIRE----KFESQEDEKLLQATEKFQAECALKFPNRQCLTTVIDISGKTVFITRYLKPLNPPQELLNVYPNNLQATAELVARYVSLIPFLPDTVSFGGICDLWSTSDQFLDLLAGDEEEHAVLLCNYFLSLGK---KAWLLMGNAIPEGPTAYVLTWE-QGRYLIWNPCSGHFYGQFDTFCPLKNVGCLIGPDNIWFNIQRYESPLRINFDVTRPKLWKSFFSRSLPYPGLSSVQPEELIYQRSDKAAAAELQDRIEKILKEKIMDWRPRHLTRWNRYCTSTLRHFLPLLEKSQGEDVEDDHRAELLKQLGDYRFSGFPLHMPYSEVKPLIDAVYSTGVHNIDVPNVEFALAVYIHPYPKNVLSVWIYVASLIRN 1619          
BLAST of Coiled-coil and C2 domain containing 2A vs. UniProt/SwissProt
Match: sp|Q8CFW7|C2D2A_MOUSE (Coiled-coil and C2 domain-containing protein 2A OS=Mus musculus OX=10090 GN=Cc2d2a PE=1 SV=1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 438/1396 (31.38%), Postives = 730/1396 (52.29%), Query Frame = 2
Query: 1016 IEEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRIQ-KENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEH-IDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQS--EILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSIS-NENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFK--LSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVT--GFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTIND-----IFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVD-----------------VERRTLTP--------------------FVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGY------------ESDEYMESFPMMSVFITLDPEIHPPQSLKDRN---ITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ---KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            +++E  +LF P  + +  +   P     R LE+EGLY+G RP +  TNE  + +R+  +E    WFG+DGRI  LP P+K  P RP +   + +P   GL+T   K      + +H I SGDP  +FQ+ I++  L F+HH  FS EHVLA ++ QL+  Y    ++    F   ++ +L+ A+Q       N     QS       I+ Y+ EIR TR  R+ E+   R L  +IIK WK++KS R     T T + + ++K+  D   D   +E +I  +I E  E     Y  +M+ Y    Q +    K +   + ++++   +    +  +      E                  + +P+ P+P D   + +++R +    RR PGEP + P L + G+++ N+   + E++RR  +++   Y+++ FN+K+V  T ++ L  DF V F +   + I  +PE ++L++YE+ G +   L  AE+ +P+P    ++    +E   F +NQ++   + GVGSG    P  S +   S ++   L TSG +     WAV  +G  +IP     +  F +     D + ++G + + D+++  +W + ES LDPNDP  A ++  +     +    E+ +  DFFRL     EF F +E++++RS RFR++ LR+  VPEF     IP YD ++  ++ +DYE R  +    +I T    +  +    +++++VR+ V+++F T+     L ++V EEE+P I+      +   LF +    RPL+   + RK ++  N+ + +++++V I RA ++PV                   E++T +P                    FV+V+FQ     T   EG NP+W+ EL LPF+ P    +  SL +++D + IN++D+ + ++  D   +   +H R ERHWLG ++IPF+TIY  ++I+G F++  P  + GY            +S   +     +++FIT++P++ P + ++++    + KFD+ ED  L+   +++Q E  ++FP+R    TV +M  +   ITRY+  L PP+ELL V  N  Q   +++AR+VSLI F+ D++ F G+ D+WST DQFL +L GDE+EHAVLLCNYF +L +   K +L +G AIPEG TAYVLT E N  + +WN  +G  +   D  C +  +G L+   N+W N Q    P  + FD++    W   F  ++    L +VQP+ +IY+        + Q  +E  L+  IMDWR    T +       +   L  LE + GE + +    ++   +  Y+  GFP+++PY E+  ++  + +TG+H    P VEFALAVYI  YP  VLS+WIYVASLVRN
Sbjct:  279 LQKEKEILFTPSRLTVPTYKKLPENIQPRFLEDEGLYIGARPEVARTNENIMENRLLIQEPGSKWFGDDGRILALPSPIKPFPSRPSLTTREQSPKA-GLETLYKKAEKYVHSRQHMIGSGDPPGNFQLDIDISGLIFTHHPCFSREHVLASKLAQLYDQYLARQQRNKTKFLTDKLQALRKAVQ----TSLNPEKPHQSLDTTQKTINEYKSEIRQTRKLRDAEQEKDRTLLKTIIKVWKEMKSLREFQRFTNTPLKLVLRKEKVDPKLDEDAYEAEIQAEIHELLEEHMEEYATKMEEYRTSHQQWKAWRKAQRAKKKKKKQTTEEHLEEEEAEESFPEEE------------------VTKPIPPEPTDPAVIEQQVRERAAHSRRRPGEPTLIPELSLAGNVTPNDQCPRVEVSRREDVRRRSVYLKVVFNSKEVSRTVSRPLGADFRVHFGQIFNLQIFNWPESLMLQVYETIGHSGTTLL-AEVFLPIPETTLVTGRAPIEEVEFSSNQHVTLDHEGVGSG---VPF-SFEADGSNQLT--LMTSGKVSHSVAWAVGENGIPLIPPLSQQNIGFRSALRRADAISSIGTSGLTDMKKLAKW-AAESKLDPNDPNHAPLMQLI----SVATSGESYVP-DFFRLEQLQQEFNFVSEEELNRSKRFRLLHLRSQEVPEFRNYKQIPAYDREIMEKVFQDYEKR--LRDRNVIETKDHLDMHRATVAKYLQQVREAVVNRFLTAKHHFLLTDLVVEEEVPNISSEGSGILGLSLFKLAEQKRPLRPRRKGRKKVTAQNLSDGDIKLLVNIIRAYDIPVRKPVVSKFQQPSRSSRTFSEKQTASPSTHSPLHNADYPLGQVLVRPFVEVSFQRTICHTTTAEGPNPSWNEELELPFRAPNGDYSTASLQSVKDDVYINIFDEVLYDILEDDRERGSGIHTRIERHWLGCVKIPFSTIYFQARIDGTFKIDIPPVLLGYSKERNIIMERAFDSARSLSEGSYITLFITIEPQLVPGEPMREKMSDMLKKFDTQEDEKLLQATEKFQAECALKFPQRQCLTTVTDMTGKTVFITRYLKPLNPPQELLHVYPNNPQATAELVARYVSLIPFLPDSVSFAGVCDLWSTSDQFLDLLAGDEEEHAVLLCNYFLFLGK---KAWLVMGSAIPEGPTAYVLTWEKNYYL-IWNPCSGHCYGQFDAFCPLKSVGCLIGPDNIWFNIQHHDSPLRINFDVTKPKLWKSFFSRSLPYPGLSSVQPEELIYQHTDKAVAAELQDRIEKILKEKIMDWRPRHLTRWNRYCTSTLRHFLPLLERSQGEDIEDDHRAELLKQLGDYRFSGFPLHMPYSEVKPLVEAVYSTGVHNIDLPNVEFALAVYIHPYPKNVLSVWIYVASLVRN 1632          
BLAST of Coiled-coil and C2 domain containing 2A vs. UniProt/SwissProt
Match: sp|Q6DHV5|C2D2B_HUMAN (Protein CC2D2B OS=Homo sapiens OX=9606 GN=CC2D2B PE=2 SV=4)

HSP 1 Score: 420.239 bits (1079), Expect = 3.542e-121
Identity = 290/974 (29.77%), Postives = 504/974 (51.75%), Query Frame = 2
Query: 2231 ELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLP--FKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRN-NNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVRE-EEIPTINDIFPKLFNVNRFSRPLQRLP---EPRKPISVHNIYEMNVEIVVVIQRATNLPV-----------------------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGY------------ESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAV---DENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNIN---LQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEM--NESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            E  RR  +QK +Y+I++F+NNK+V  TS   L  DF V F++   + +  +PEVI L++YE S  TS     A++ +PLP   +L     ++   F +++ ++  +  VGS   + P   L+G  + E+   L TSG L     W+++ +G  +IP+       + ++  N D     G+  +++ Q+  EW + E  +DPN+P  + ++ ++      G D        +FRL    DEF F +E+++ +S RF++++LRN   +  FL   +PL+D ++P  + ++YE++K    +   V    A+++    F++KVR  ++ +    + K +L ++V + EEI + + +      V +F  P ++L    + RK ++   I + +++I+V I RA N+P                                     +   T+ PFV+V+FQ+    T+   G +P W+ E+++ F  P    + +SL  I+D + IN++D+ +   + D   K  + H    ++WLG +  PF+ +   S+I G F++  P  + GY             +++ ++    +++F T++P+I    S    N T    ++  +++     ++      FP R    TV N    + L+TRYI  L PP++LL +   + N    +IARFVSLI F+ +       SDIW T +  + + IG+++EHA+LLCN+F Y  +   K  + LG ++ EG  AYV+T+E N +  LWN STG  +K  DP C +  +  L ++RNVW N QQ   P  + FD S ++ W  L   N+    +Q++QP+ IIY E     V+D +  +E  L+S +M+WR    T++       + +IL  LE   G    +E  NE  + ++  Y V GFPI +PY+++  ++  +  TGIH    P+ EFALAVYI  YPN +LS+W+Y+ASLV++
Sbjct:  491 EQKRRAKIQKLKYFIKIFYNNKQVSCTSVSPLQFDFKVMFQQIFNIQLMYWPEVICLEVYEKSKRTSLL---AKLYIPLPNYTELKGKTALQYVEFSSDKLVMPADGEVGS---NVPF-LLEGNGTEELC--LLTSGKLSYSLSWSLDENGLPLIPMPQSLRSSYCSMLRNVDARSVPGIPWLMNEQKLFEWAN-EVRIDPNNPEYSDLMESVTYMRLKGQDI-----PKYFRLEQLQDEFNFVSEEEMAKSKRFQLLQLRNAGQLDNFLLQQMPLHDTEIPDLVFQEYESQKEKEVSVSDVNSITAQRINSANFLKKVRRLIMKRI-VKISKCNLSDIVNDYEEIVSTSQLTDA---VCKFVEPRRKLKPQRKERKKVTAQAISDGDIKILVRIVRAYNIPTRKTTINGSLDMPTCLKSSISCLRHRETIKSVASDETLHEDTVHPFVEVSFQHTVYKTNTASGSHPCWNEEIKVDFVSPGHDYSFSSLSKIKDNIYINIFDEMMTEKHEDHCLKSCSGHSYIRKNWLGCIVFPFSALLQQSEISGTFQVTIPPVLLGYTWSNTYVFPKEDSNEQNLKECTFLNIFATIEPQI----SYVTCNPTLDKFLDQTEVLQRAQIFKKNCKAMFPNRRIVTTVFNDEGIQFLVTRYIKALNPPQQLLDIFLHNSNATFDLIARFVSLIPFVPNTPDENDGSDIWMTSEHCISLAIGNKEEHAILLCNFFLYFGK---KALVLLGTSVLEGHVAYVVTQETN-EYLLWNPSTGQCYKQFDPFCPLKSVDCLFDDRNVWFNIQQNNTPMAVFFDYSKESFWKQLLPKNVQGTKIQSIQPEEIIYFETDKSMVEDLRNRIERTLKSKVMEWRPKHPTHWNRQCTFILRQILPKLEFGIGSFVSSEGDNE-FERILQFYWVTGFPIQMPYIDVQSIIDAVYQTGIHSAEFPQTEFALAVYIHPYPNNILSVWVYLASLVQH 1436          

HSP 2 Score: 88.5817 bits (218), Expect = 5.125e-16
Identity = 90/280 (32.14%), Postives = 138/280 (49.29%), Query Frame = 2
Query: 1088 RNLEEEGLYVGRRPFINTTNERKLASRIQK-ENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSF-----------QMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKK-QLADADEDYRLWERDISDQIAEEKEYFENNYRKEMK 1888
            R LE+EG Y+ R+P I      K+ +R+ K E    WFGE G I  LP P+K+       WN + N     ++ E L P++  T Y      D  SSF           Q+ +N+  L+FSHHHLF+ E VL  R+ QL+  +Q   +Q       +++ +L  A      KLSN+N+         + +Y  +I NT+   + E G    L  SI++TWKQIKS R+  G T T + +++++ ++   DE          +QI+E  E  + N  KE+K
Sbjct:  192 RILEDEGFYIQRKPEIYKKTCNKMENRLLKLEEGKCWFGESGEIMSLPTPIKQ------SWNFRLN-----VRKEPLNPLLK-TIYRKAVKYDLGSSFMNKMEGSREIYQLDLNIVGLQFSHHHLFNQEQVLCARLLQLYECFQDRQQQNVSQLLYEKLKALTDAT-----KLSNENSEINQLTRKSLQDYYWQISNTKQMYDLERGKDLSLLHSILRTWKQIKSLRHGQGFTSTPIKLQVQRIKMNKCDEQ---------EQISEMSETEKKNEGKELK 445          
BLAST of Coiled-coil and C2 domain containing 2A vs. UniProt/SwissProt
Match: sp|A1ZAV1|C2D2A_DROME (Coiled-coil and C2 domain-containing protein 2A OS=Drosophila melanogaster OX=7227 GN=Cc2d2a PE=1 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 1.017e-37
Identity = 130/525 (24.76%), Postives = 238/525 (45.33%), Query Frame = 2
Query: 3443 PFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYE-----------SDEYMESFPMMSVFITLDPEIHPPQS-LKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPK--RFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKE-MNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTT--NFIIAPRREMVEILKCLE----INCGEMNESI-NEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLV 4951
            PFV +++      +   EG NP W+ +L+L  +     +    +RD L I+++D+ +    SD  S    +++R + +WLG   +P N++  +   EG   L  P  + GY+           +D+Y E    + ++  L   I P    L   +       E  +L  ++D  + E+    P+  R+    V   + +   +TR +  +  P   +   EN  +  I R+VSL+S +       G   +W      L        +  VLLCNY   L  +    +L LG + P G  ++VL ++    +++L + +TG +++  D  C + +I  +V ++N++ N Q   +     F+L   A WFPLF+  +         + Y      E+   Q  +E ++   I  WR    T  N    PR  + +IL  +E     + G  +E I +E+++     Y+++GF +N  Y  +  +  RI  + IH   D  VEF +AV++ ++ N VLS+W+++ S+V
Sbjct:  824 PFVTLSYGQRLCRSRTAEGSNPTWNEQLQLQIQ-----SQFGDLRDDLKISLFDELIEQQYSDEASD---VYQRVQCNWLGEFRVPINSLLASRTFEGCIELAMPKVLVGYKRPLIDSVTNMPTDQYPEFKEAVHLWFYLS--IEPGGGDLAPLHSCALACAEKPELQQYLDERRLELQQLLPQPQRYVEPLVCTAQGKRVCLTRLMDPVPLPPAAVPSGENPLEICI-RYVSLLSHLRSYDPCQGFRGVWLDNQSLLDSTWCSVKDLGVLLCNYMLSLGLE---CWLILGVSCPHGECSFVLFRQPETAELFLVSPATGKRYQLQDVHCPLRRIYCVVGKQNIYFNIQTETRVSMTHFNLQDGACWFPLFRRRVPAPQSGVQKLDYAYKRSYELSQLQKHIERKIMKKISAWRTTRKTIWNRAFQPR--LHKILCDMEDLSTFSRGRYDEPIFSEQLEREFPNYRLYGFTLNFAYTNLAAISERIRTSCIHYNHDASVEFCVAVHLHAHANDVLSVWLFLLSMV 1332          
BLAST of Coiled-coil and C2 domain containing 2A vs. UniProt/SwissProt
Match: sp|Q0VEJ0|CEP76_MOUSE (Centrosomal protein of 76 kDa OS=Mus musculus OX=10090 GN=Cep76 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.019e-13
Identity = 100/423 (23.64%), Postives = 168/423 (39.72%), Query Frame = 2
Query: 3791 MESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISF-MADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKF-------------KSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPF---LKEVQDFQLT---LENQLRSNIMDWR--FGLTT------NFIIAPRREMVEILKCLEINCG--EMNESINEKVKDLMTGYKVFGFPINLPY----MEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            +E +P +S   TL  E+   Q   +R  T   + ++R  + +  +W  E     P    R+  +  +  E  I R + +   P     + +  +Q   ARFV+++ +  A  I   G  + W T   FL    GD ++HA LLC+    L     + F+C+G        A+V+T   +G +  W + TG ++             +   P      IG + N +    N Q         FDL+ ++ W P+ +  I      P A     PF        D  +T   +E QLR  + + R   GLTT      +++++P     E  +   I+ G  E  ++I   V D   G+   GFPI+  Y          L       I      +V  A+ V + +YP +  ++WI  A   R+
Sbjct:  250 LEMYPPLSQ--TLSQEVVNTQLALERQKT---AEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQ-DENGINRPVCSYVKPLRAGRLLDTPRQA--ARFVNVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSL---LLGYGLEAFVCVGTKAKGAPHAWVMTCGTDGTIMFWESLTGHRYIHKPTNPDGPPLAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCIFDLNDESKWKPMSEEAIK-SVCAPGATTSLPPFPPLCASTIDASVTSNEIEMQLRLLVSEHRKDLGLTTVWEDQLSYLLSPALASYEFERTTSISAGNEEFQDAIRRAVPD---GHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYRS 657          
BLAST of Coiled-coil and C2 domain containing 2A vs. TrEMBL
Match: A0A2R2MMQ1 (coiled-coil and C2 domain-containing protein 2A-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106172714 PE=4 SV=1)

HSP 1 Score: 750.355 bits (1936), Expect = 0.000e+0
Identity = 485/1468 (33.04%), Postives = 805/1468 (54.84%), Query Frame = 2
Query:  767 TEKQSFDFFCRQWPVAPKQEKRKSLPVEGD-------------IENAE-RRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDM----SYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKE--NKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSG-DPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQ----SEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEA-EDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVL-KVGSISNEN-LTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLP-----------------VDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESF-----------------PMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDE--NMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKS---NINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIM-DWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVR 4954
            T  +++DFF R W   P++ KR  LP   +              + AE   E QE  +   L+++++ D    I          + A  +P  E   I++E  + F P ++ +       +    R LEEEGLYVG RP +  TN+ K+  R+ +E      WFGEDG+I  LP+P+KE P RP +  +    +P  LQT+  K I       +ID   +    +Q+ ++V +L   HHHLFS EHVLA R+ QL+  Y   +K+  +D+  +++ +LK A  HL+E + N  A       S++  R+ +YR EI+ TRN R+ E+   R L  SII+TW++IKS R +   T T V ++IKK+  +  ED   W RD+ +++ E KE     Y +++ +Y+ Q + + +Q K K +A  R++ + ++    +  +  N    E E F++A +D ++L + ++ +P  P    E ++   ++ +    +R PGEP ++P L    +I+  N + + E  RR  + KY+ ++++ FNNK+V  T  + LN +F V+F +   + I Q+P+ + L+++ES G ++  L+     VP     ++  ++E   F ++  + H + GVGSG    P      T  G     L T+G+L     W V+++G  ++P +  N  +  +     D + A+G + ++D+++  +W + ES LDPNDP +A ++  +   +    D        +FRL    +EF F+T++++D   RFR+IRLR   VP F    IP  +  +P +   +YE ++   +        E+ +    +F+++VR++VL +FR +  +KS  ++V EEE+P I  +   L  +    RPL+ + + RK +S  N+ E +V  V+ +QRA ++P                 V V +  + PF++  FQ I+  T V +G NP+W+  +RLPF+P     + ++L TIRD L +N++D+ V ++ S+  +    +H+R E++WLGSL IPF+T+Y NS I+G FR+  P+ + GY  D    S                    +S+FIT++P++  P+ +++    KFDS ED  LI   D W   +  +FPKR  + TV+++  +   ITRY  +LKPP+E+L  +     + +++AR+VS+I F++D++VFPG+ DIWSTCDQFL+ML GDE+EHAVLLCNYF  L +   + +LCLG AIPEG TAYVLTKE NG + +WN STG  +   +P C +  IG LVN+ N+WAN Q   QP  + +D+   + W P F +   N  L ++QP+ ++Y       V D Q  +E  +R   M DWR    T +    ++    +L  +E   G+ M +    +++ ++  YK+ GFP+ +P+ EI +++  + ATG+    +  VEFALAV+I +YPN+VL++W+YVASL+R
Sbjct:  271 TVDEAYDFFTRNWDPEPEEVKR-PLPTPREPTEGEAAEGEEEAQQPAEVTEEPQESSEEKALLEDYD-DTGRNIV--------IVSAEYVPHQEK--IQKEEAIYFVPSIIPIPPAEKIGDSAEPRYLEEEGLYVGTRPAVAITNQNKMEHRLLREPGKGSRWFGEDGKIIALPNPIKETPSRPHVPED----IPYMLQTDYRKAITKEFDSRYIDGSIEGKGRYQLDVDVNTLTLIHHHLFSREHVLATRLTQLYAQYIGRTKKNIVDYLTEKLRALKGAAAHLEENILNLKAKNSNVNISDLEQRLQDYRYEIKQTRNLRDTEQHSDRALLKSIIRTWQEIKSLRQLQNFTNTSVKLRIKKEEVNRAEDEEQWRRDMEEEVQELKEEKSREYDEKLALYQKQLEAFKQQLKAKKEAARRKKLRLKRVARAEQDQDEN----EAETFEQANKDDEILAQENLTKPEKPAKVTEANIREIVKEKAIRNKRSPGEPKLYPELTNTATITPTNQVPRAEQQRREDLGKYKMFVKVLFNNKEVSRTHVRPLNQEFRVSFAQIFNIQIMQWPQSVRLQVFESVGLSNSMLAEIYAAVPEATVTADTVQLEEMEFSSDITVTHVHEGVGSG---IPFSF---TADGSNPQSLMTTGILLMSVSWGVDTNGLPLVPPTSSNVNQAFSAMKGLDAVAAIGASAMVDMEKLSKWIA-ESRLDPNDPSNADLVYMMKPMK----DGTGLQMPSYFRLEHLQEEFNFTTDEELDMHRRFRLIRLREEEVPLFKNKQIPALEKDIPQDAFLEYEKKEKEKEQLREDKDIESHRAAVAQFMQRVREQVLQRFRLAAHQKSFHDVVFEEEVPNIGTLAINLQQLGEPRRPLRPVRKERKKVSAQNVSEADV--VINVQRAYDVPIRTDAVPKADGRGQRVKVPVTQILVRPFIEAVFQGISSKTPVADGPNPSWNYNIRLPFRPENGDFSPSNLQTIRDHLYLNLFDEVVTDMASNQATSGQEVHQRIEKNWLGSLYIPFSTLYQNSLIDGTFRINSPSILLGYTHDGSRTSIDPTGAGGVEVGRGNAEDTYISLFITIEPQLSSPEHIRE----KFDSNEDPKLILAADAWIEALQKKFPKREYKTTVIDVNGKSVFITRYFKSLKPPDEILNQNTAPQAQAELVARYVSMIPFVSDSVVFPGLCDIWSTCDQFLQMLAGDEEEHAVLLCNYFLQLGK---QAWLCLGTAIPEGGTAYVLTKEANGYL-IWNGSTGESYSHTNPFCPLQSIGCLVNQENIWANVQPNDQPSRIDYDVHNTSSWRPFFNNSFPNPGLASIQPENLLYFPTDKNYVVDLQDKIERTVRQRFMEDWRPQSITRWNRLCQQTFRNLLPKMEETRGKGMGQQHASELESVLGAYKLSGFPLCMPFTEIQNIVESVHATGVWDNNNEGVEFALAVHIHAYPNSVLAVWVYVASLLR 1697          
BLAST of Coiled-coil and C2 domain containing 2A vs. TrEMBL
Match: A0A2R2MMM0 (coiled-coil and C2 domain-containing protein 2A-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106172714 PE=4 SV=1)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 486/1475 (32.95%), Postives = 806/1475 (54.64%), Query Frame = 2
Query:  767 TEKQSFDFFCRQWPVAPKQEKRKSLPVEGD-------------IENAE-RRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDM----SYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKE--NKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSG-DPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQ----SEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEA-EDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVL-KVGSISNEN-LTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLP-----------------VDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNS-------KIEGNFRLKQPAFVQGYESDEYMESF-----------------PMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDE--NMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKS---NINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIM-DWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVR 4954
            T  +++DFF R W   P++ KR  LP   +              + AE   E QE  +   L+++++ D    I          + A  +P  E   I++E  + F P ++ +       +    R LEEEGLYVG RP +  TN+ K+  R+ +E      WFGEDG+I  LP+P+KE P RP +  +    +P  LQT+  K I       +ID   +    +Q+ ++V +L   HHHLFS EHVLA R+ QL+  Y   +K+  +D+  +++ +LK A  HL+E + N  A       S++  R+ +YR EI+ TRN R+ E+   R L  SII+TW++IKS R +   T T V ++IKK+  +  ED   W RD+ +++ E KE     Y +++ +Y+ Q + + +Q K K +A  R++ + ++    +  +  N    E E F++A +D ++L + ++ +P  P    E ++   ++ +    +R PGEP ++P L    +I+  N + + E  RR  + KY+ ++++ FNNK+V  T  + LN +F V+F +   + I Q+P+ + L+++ES G ++  L+     VP     ++  ++E   F ++  + H + GVGSG    P      T  G     L T+G+L     W V+++G  ++P +  N  +  +     D + A+G + ++D+++  +W + ES LDPNDP +A ++  +   +    D        +FRL    +EF F+T++++D   RFR+IRLR   VP F    IP  +  +P +   +YE ++   +        E+ +    +F+++VR++VL +FR +  +KS  ++V EEE+P I  +   L  +    RPL+ + + RK +S  N+ E +V  V+ +QRA ++P                 V V +  + PF++  FQ I+  T V +G NP+W+  +RLPF+P     + ++L TIRD L +N++D+ V ++ S+  +    +H+R E++WLGSL IPF+T+Y NS       KI+G FR+  P+ + GY  D    S                    +S+FIT++P++  P+ +++    KFDS ED  LI   D W   +  +FPKR  + TV+++  +   ITRY  +LKPP+E+L  +     + +++AR+VS+I F++D++VFPG+ DIWSTCDQFL+ML GDE+EHAVLLCNYF  L +   + +LCLG AIPEG TAYVLTKE NG + +WN STG  +   +P C +  IG LVN+ N+WAN Q   QP  + +D+   + W P F +   N  L ++QP+ ++Y       V D Q  +E  +R   M DWR    T +    ++    +L  +E   G+ M +    +++ ++  YK+ GFP+ +P+ EI +++  + ATG+    +  VEFALAV+I +YPN+VL++W+YVASL+R
Sbjct:  271 TVDEAYDFFTRNWDPEPEEVKR-PLPTPREPTEGEAAEGEEEAQQPAEVTEEPQESSEEKALLEDYD-DTGRNIV--------IVSAEYVPHQEK--IQKEEAIYFVPSIIPIPPAEKIGDSAEPRYLEEEGLYVGTRPAVAITNQNKMEHRLLREPGKGSRWFGEDGKIIALPNPIKETPSRPHVPED----IPYMLQTDYRKAITKEFDSRYIDGSIEGKGRYQLDVDVNTLTLIHHHLFSREHVLATRLTQLYAQYIGRTKKNIVDYLTEKLRALKGAAAHLEENILNLKAKNSNVNISDLEQRLQDYRYEIKQTRNLRDTEQHSDRALLKSIIRTWQEIKSLRQLQNFTNTSVKLRIKKEEVNRAEDEEQWRRDMEEEVQELKEEKSREYDEKLALYQKQLEAFKQQLKAKKEAARRKKLRLKRVARAEQDQDEN----EAETFEQANKDDEILAQENLTKPEKPAKVTEANIREIVKEKAIRNKRSPGEPKLYPELTNTATITPTNQVPRAEQQRREDLGKYKMFVKVLFNNKEVSRTHVRPLNQEFRVSFAQIFNIQIMQWPQSVRLQVFESVGLSNSMLAEIYAAVPEATVTADTVQLEEMEFSSDITVTHVHEGVGSG---IPFSF---TADGSNPQSLMTTGILLMSVSWGVDTNGLPLVPPTSSNVNQAFSAMKGLDAVAAIGASAMVDMEKLSKWIA-ESRLDPNDPSNADLVYMMKPMK----DGTGLQMPSYFRLEHLQEEFNFTTDEELDMHRRFRLIRLREEEVPLFKNKQIPALEKDIPQDAFLEYEKKEKEKEQLREDKDIESHRAAVAQFMQRVREQVLQRFRLAAHQKSFHDVVFEEEVPNIGTLAINLQQLGEPRRPLRPVRKERKKVSAQNVSEADV--VINVQRAYDVPIRTDAVPKADGRGQRVKVPVTQILVRPFIEAVFQGISSKTPVADGPNPSWNYNIRLPFRPENGDFSPSNLQTIRDHLYLNLFDEVVTDMASNQATSGQEVHQRIEKNWLGSLYIPFSTLYQNSLEPHPNNKIDGTFRINSPSILLGYTHDGSRTSIDPTGAGGVEVGRGNAEDTYISLFITIEPQLSSPEHIRE----KFDSNEDPKLILAADAWIEALQKKFPKREYKTTVIDVNGKSVFITRYFKSLKPPDEILNQNTAPQAQAELVARYVSMIPFVSDSVVFPGLCDIWSTCDQFLQMLAGDEEEHAVLLCNYFLQLGK---QAWLCLGTAIPEGGTAYVLTKEANGYL-IWNGSTGESYSHTNPFCPLQSIGCLVNQENIWANVQPNDQPSRIDYDVHNTSSWRPFFNNSFPNPGLASIQPENLLYFPTDKNYVVDLQDKIERTVRQRFMEDWRPQSITRWNRLCQQTFRNLLPKMEETRGKGMGQQHASELESVLGAYKLSGFPLCMPFTEIQNIVESVHATGVWDNNNEGVEFALAVHIHAYPNSVLAVWVYVASLLR 1704          
BLAST of Coiled-coil and C2 domain containing 2A vs. TrEMBL
Match: A0A1S3JEY9 (coiled-coil and C2 domain-containing protein 2A-like isoform X3 OS=Lingula unguis OX=7574 GN=LOC106172714 PE=4 SV=1)

HSP 1 Score: 744.962 bits (1922), Expect = 0.000e+0
Identity = 486/1475 (32.95%), Postives = 806/1475 (54.64%), Query Frame = 2
Query:  767 TEKQSFDFFCRQWPVAPKQEKRKSLPVEGD-------------IENAE-RRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDM----SYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKE--NKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSG-DPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQ----SEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEA-EDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVL-KVGSISNEN-LTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLP-----------------VDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNS-------KIEGNFRLKQPAFVQGYESDEYMESF-----------------PMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDE--NMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKS---NINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIM-DWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVR 4954
            T  +++DFF R W   P++ KR  LP   +              + AE   E QE  +   L+++++ D    I          + A  +P  E   I++E  + F P ++ +       +    R LEEEGLYVG RP +  TN+ K+  R+ +E      WFGEDG+I  LP+P+KE P RP +  +    +P  LQT+  K I       +ID   +    +Q+ ++V +L   HHHLFS EHVLA R+ QL+  Y   +K+  +D+  +++ +LK A  HL+E + N  A       S++  R+ +YR EI+ TRN R+ E+   R L  SII+TW++IKS R +   T T V ++IKK+  +  ED   W RD+ +++ E KE     Y +++ +Y+ Q + + +Q K K +A  R++ + ++    +  +  N    E E F++A +D ++L + ++ +P  P    E ++   ++ +    +R PGEP ++P L    +I+  N + + E  RR  + KY+ ++++ FNNK+V  T  + LN +F V+F +   + I Q+P+ + L+++ES G ++  L+     VP     ++  ++E   F ++  + H + GVGSG    P      T  G     L T+G+L     W V+++G  ++P +  N  +  +     D + A+G + ++D+++  +W + ES LDPNDP +A ++  +   +    D        +FRL    +EF F+T++++D   RFR+IRLR   VP F    IP  +  +P +   +YE ++   +        E+ +    +F+++VR++VL +FR +  +KS  ++V EEE+P I  +   L  +    RPL+ + + RK +S  N+ E +V  V+ +QRA ++P                 V V +  + PF++  FQ I+  T V +G NP+W+  +RLPF+P     + ++L TIRD L +N++D+ V ++ S+  +    +H+R E++WLGSL IPF+T+Y NS       KI+G FR+  P+ + GY  D    S                    +S+FIT++P++  P+ +++    KFDS ED  LI   D W   +  +FPKR  + TV+++  +   ITRY  +LKPP+E+L  +     + +++AR+VS+I F++D++VFPG+ DIWSTCDQFL+ML GDE+EHAVLLCNYF  L +   + +LCLG AIPEG TAYVLTKE NG + +WN STG  +   +P C +  IG LVN+ N+WAN Q   QP  + +D+   + W P F +   N  L ++QP+ ++Y       V D Q  +E  +R   M DWR    T +    ++    +L  +E   G+ M +    +++ ++  YK+ GFP+ +P+ EI +++  + ATG+    +  VEFALAV+I +YPN+VL++W+YVASL+R
Sbjct:  262 TVDEAYDFFTRNWDPEPEEVKR-PLPTPREPTEGEAAEGEEEAQQPAEVTEEPQESSEEKALLEDYD-DTGRNIV--------IVSAEYVPHQEK--IQKEEAIYFVPSIIPIPPAEKIGDSAEPRYLEEEGLYVGTRPAVAITNQNKMEHRLLREPGKGSRWFGEDGKIIALPNPIKETPSRPHVPED----IPYMLQTDYRKAITKEFDSRYIDGSIEGKGRYQLDVDVNTLTLIHHHLFSREHVLATRLTQLYAQYIGRTKKNIVDYLTEKLRALKGAAAHLEENILNLKAKNSNVNISDLEQRLQDYRYEIKQTRNLRDTEQHSDRALLKSIIRTWQEIKSLRQLQNFTNTSVKLRIKKEEVNRAEDEEQWRRDMEEEVQELKEEKSREYDEKLALYQKQLEAFKQQLKAKKEAARRKKLRLKRVARAEQDQDEN----EAETFEQANKDDEILAQENLTKPEKPAKVTEANIREIVKEKAIRNKRSPGEPKLYPELTNTATITPTNQVPRAEQQRREDLGKYKMFVKVLFNNKEVSRTHVRPLNQEFRVSFAQIFNIQIMQWPQSVRLQVFESVGLSNSMLAEIYAAVPEATVTADTVQLEEMEFSSDITVTHVHEGVGSG---IPFSF---TADGSNPQSLMTTGILLMSVSWGVDTNGLPLVPPTSSNVNQAFSAMKGLDAVAAIGASAMVDMEKLSKWIA-ESRLDPNDPSNADLVYMMKPMK----DGTGLQMPSYFRLEHLQEEFNFTTDEELDMHRRFRLIRLREEEVPLFKNKQIPALEKDIPQDAFLEYEKKEKEKEQLREDKDIESHRAAVAQFMQRVREQVLQRFRLAAHQKSFHDVVFEEEVPNIGTLAINLQQLGEPRRPLRPVRKERKKVSAQNVSEADV--VINVQRAYDVPIRTDAVPKADGRGQRVKVPVTQILVRPFIEAVFQGISSKTPVADGPNPSWNYNIRLPFRPENGDFSPSNLQTIRDHLYLNLFDEVVTDMASNQATSGQEVHQRIEKNWLGSLYIPFSTLYQNSLEPHPNNKIDGTFRINSPSILLGYTHDGSRTSIDPTGAGGVEVGRGNAEDTYISLFITIEPQLSSPEHIRE----KFDSNEDPKLILAADAWIEALQKKFPKREYKTTVIDVNGKSVFITRYFKSLKPPDEILNQNTAPQAQAELVARYVSMIPFVSDSVVFPGLCDIWSTCDQFLQMLAGDEEEHAVLLCNYFLQLGK---QAWLCLGTAIPEGGTAYVLTKEANGYL-IWNGSTGESYSHTNPFCPLQSIGCLVNQENIWANVQPNDQPSRIDYDVHNTSSWRPFFNNSFPNPGLASIQPENLLYFPTDKNYVVDLQDKIERTVRQRFMEDWRPQSITRWNRLCQQTFRNLLPKMEETRGKGMGQQHASELESVLGAYKLSGFPLCMPFTEIQNIVESVHATGVWDNNNEGVEFALAVHIHAYPNSVLAVWVYVASLLR 1695          
BLAST of Coiled-coil and C2 domain containing 2A vs. TrEMBL
Match: A0A210PQ36 (Coiled-coil and C2 domain-containing protein 2A OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08964 PE=4 SV=1)

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 473/1382 (34.23%), Postives = 765/1382 (55.35%), Query Frame = 2
Query: 1013 LIEEESGLLFYPGVV----DMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKE-NKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDG----LQTEDLKPIISSTTYEHIDSGDPNSSF-QMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKL----SNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAE-DIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGS--ISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGE-LMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV----------------DVERRTLT--------------PFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYM-----------ESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMK-QKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI--NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNES--INEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVR 4954
            L ++E+ + F P V     +     ++  R LE+EG YVG RP  +  N  K+  R+ KE +   WFGEDGR+  LPDPL+  P RP        P+PD     L+T     I+     ++ID    NS F Q+ +++ S+  SHHHL+S EHVLA R+++L++ +     +   ++  +++ +LK +  HL++ +    S    A +S    R+ +Y+ E R  R  R+ EE   R++   II TWK+I+++R+    + T V ++IKK+  D + D  +W +++ +++ E +E    +Y+ +MK Y+ +K+  D+Q K KA+A  RQ+++  K          +K + E +  +E + DI ++ E D+ EP +P  FDE +    I+ +    RR PGEP + P L   +  I      + E  RR  +   + +I++ FNNK+V  T  K L+ +F VTF +   + I Q+PE I  +++E+ G+ ++ L+     +P     S+  ++E   F  +  + H N GVGSG  +F      GT +   +  L T+G L     WAV+ + + L+ P+S    +   +     DP+ A+  +  +D++R  +W   ES LDPNDP +A ++  L      G D       D+FRL    +EF  +T+++I+ + RF++++LR+N V EF     +PL   ++P +   +YE +K       +    E+ +    +F+++VR++V+ +FR     K L ++V EE +P I  I   L  V    RPL+   + RK ++   +    V+I+V I RA  +P+                   R T T              PFV+V FQ+ +  T V +G NP+++ EL++PFK P    +  +L TI D L +N++D+ V+++  D  ++  TLH+R E+ WLG L IPF+TIY N KIEG F LK P  + GY  D+ M           E    +S+FIT++P + P + +K+R    F + E  DL+ + ++WQ E+  +FPKR  + +V+N+  +   ITRY   LKPPEEL+A  +N K  +V+A FV++I F++D++VFPG+ DIWSTC QFL+M+ GDE+EHAVLL NYF  + +   K +L +G AIPEG TAYV+T+E N D+W+WNA TG+ +  +D  C +  +G LV+  N++AN QQ  +P +LRFD+   +DW P F  +   +L ++QP+A+ Y        +D Q  +EN L++ IM+WR    T +     + M +IL  LE N G+  ++  ++E  K   T YKV GFPIN+P+  +  +  R+ +TG+H      VEFALAVY+ +YPN+V S+W+YVASL+R
Sbjct:  423 LQKKEAEIYFVPSVTTVPSEQKVSEEQQPRFLEDEGFYVGTRPDPSGWNVNKMEHRLLKEQDGRRWFGEDGRMLALPDPLRLTPSRP--------PVPDEKEPYLETVFKGAIMREFDSKYIDGSMDNSGFYQLDVDINSIVMSHHHLYSREHVLAARLQELYSIFLSRQIKNMTEYLTEKLKALKSSALHLKDHMLAHKSEHGFADRSNYERRLRDYKLETRRARELRDKEEQTDRQILKGIIHTWKEIRAQRDTQKYSNTSVKLQIKKEEVDKNRDMMIWRQEMEEEVDEVREAHAEDYQIKMKEYQERKKDKDQQIKAKAEAAKRQKKRGSKASKASRGSRASKLSGEDQSPEERQKDIDIINEEDLPEPELPDEFDETATRERIKIKVMEIRRRPGEPKLQPELTNTNTIIPTAQCPRGEQQRREALSGCKIFIKVLFNNKEVSRTLPKPLSQEFKVTFAQIFNIKIVQWPESIKFQIFETIGYNTEILAELYASIPEVSITSQGVQLENLDFSCDHRVNHSNEGVGSG-VAFSY----GTKTDNEMITLMTTGELCCSVAWAVDENNQPLVPPISNAGKDNVFSAIKKMDPMQAVSPSGKVDIERLSKWFE-ESRLDPNDPSNADLVYMLKPK---GGDLTHLKPPDYFRLEQLQEEFNMTTDEEIENNKRFQLLQLRDNEVQEFRNYRMVPLKVKEIPRDTFTEYEKKKREETKLEVKDDIESHRADRAKFMQRVREQVIQRFRILAHMKRLEDVVLEEAVPNIAMIGTSLLRVTERRRPLRPERKERKKVTAQVLKGDEVKILVNITRALYVPIRTGSSIHADESKASGSATARGTETDQAVKSIVGDTLVRPFVEVVFQHSSMRTVVGDGPNPSFNEELQIPFKAPNDDYSSNNLQTITDELYLNLFDEVVVDIQEDDRNRGTTLHQRIEKRWLGDLTIPFSTIYFNGKIEGTFCLKSPPVLLGYSHDQNMGGESDINIGSKEENTYLSLFITIEPPLSPAEPMKER----FSTNEAEDLLQYAEKWQTELEEKFPKREFKTSVINVNGKSVFITRYFKELKPPEELVADLKNQKADEVVAHFVAMIPFVSDSVVFPGLCDIWSTCSQFLQMMAGDEEEHAVLLANYFMSMQK---KTWLIIGTAIPEGPTAYVMTEEGN-DLWIWNAGTGLHYSVHDNYCPLQTVGCLVDAENIYANIQQYDKPSQLRFDVKSTSDWRPFFTRSFSRSLPSIQPEALRYINADPNGARDIQEKIENMLKNRIMEWRSRYITRWNRHCTQIMRKILPILEDNLGKPPDAQHLSELEKQFST-YKVSGFPINMPFTGLDYINERVYSTGVHAHETSDVEFALAVYVHAYPNSVASVWVYVASLIR 1778          
BLAST of Coiled-coil and C2 domain containing 2A vs. TrEMBL
Match: X1Z7B6 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=4 SV=1)

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 488/1403 (34.78%), Postives = 752/1403 (53.60%), Query Frame = 2
Query: 1016 IEEESGLLFYPGVVDMSYFNDRPL-----RNLEEEGLYVGRRPFINTTNERKLASRIQKE---NKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNS--SFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLS----NKNAAAQSEIL-ARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVG-SISNEN-LTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEK-SFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDS--ETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRK-GVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTL---------------------------------------TPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYM----------ESFPM---------MSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKV--IARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKS---NINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTT---NFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVR 4954
            I +E  +LF P +   +   DR +     R LEEEG YVG RP +  TN  ++ +R+ +E      DWFGEDG +  LP+PLKE   RP +  E+  P+   LQTE  K  +       ID     S   +Q+ ++V SL F+HHHLFS EHVLA RI   +  Y    K++  +   +++ +LK A  H+QE ++    +KN     E    R+  Y +EI+ TR  R+ E    R L   II+TWK+IKS R     T T V + IKK+  D  ++   WE +I +++ E +   +  Y   ++ Y    + + KQ   KA                     R+K+    +     +D  +L E DI +P  PK F++  L  ++  ++   +R PGEP IH  L  G SI+  N   K E +RRN + +Y+ ++++ FN K+V  TS K L  DF+V F +   + I ++PE I +++YE++G +   LS     +P      +N +++   F ++Q L H + GVGS    SF  E+         I  L TSG L     WAVN +G  ++P S + +   +  +   DP+ A+G+  + D+ +  +W + ES LDPNDP +A ++   H    +G D+   T      F L    +EF F+T+ ++++S RFRM++LR     EF    +P  + ++P ++  +YE +K  V K K +    E+ ++   +F+++VR++V+ +FR +  +K+L E+V E+ +P I  I P L  +    RPL+ + + RK ++  N+  M+V+I++ I RA  +PV  ++ ++                                        PF++V FQ     T + EG NP+W+ EL +PFKPP    + T+L TIRD +  N++D+ V  +  D   +  T+  + E+ WLG+++IPF+TIY NS+I+G FRL +P  + GY+ +             E   M         +++F+T++P + P +  K+    KFDS ED  L+   ++WQ+E+  RFP R  + TVV++  +   ITRY  +LKPPEEL + +E+  +KV  +AR+VS+I F++D++VFPG+ DIWSTCDQFL+ML GDE+EHAVLL NYF  + +     FL LG AIPEG TAYVLTKE   D W+WNASTG  +   D  C +  +G LVN  N+WAN Q   QP  + FDLS  ++W P F     N  L +VQP+ +IY       V D Q  +E QL+  IM+WR    T    + +   R ++  L+    N G   +  +E +  ++  YK+ GFPINLPY E+  ++  + ATG+H      VEFALAV++  YPN+VLS+WIYVASL R
Sbjct:   99 ITKEDEVLFSPRI-RAAKLEDRLVEGTAPRYLEEEGFYVGTRPAVAPTNLHRMENRLLEEPGEEAKDWFGEDGVLIALPNPLKEYAERPPIV-EEVAPL---LQTEYKKAFLIELDGRCIDPAAEGSVGHYQLDVDVNSLFFTHHHLFSREHVLASRITNQYQQYLSRCKRQAAELLTEKLKALKAATLHVQENIAAMEGDKNCRVGFETQQKRLQEYNEEIKLTRKLRDAELAADRALLKHIIQTWKEIKSLRQFQNFTNTPVKLVIKKEPTDKAKEDEEWEAEIEEEMEEMRLESQIEYTTLLQTYHTDLEAWKKQKLEKA-------------------LKRSKKRGRRQSQGTDKDQDLLDEEDIPKPEKPKAFNDVELRTQVFDKYSQIKRKPGEPKIHFELSNGASITPTNSCPKGEQSRRNEVNRYKVFVKVLFNGKEVSRTSPKPLGQDFAVNFAQIFNIEIMRWPESIKMEIYEAAGLSVTLLSEVYAAIPPSNLTVDNVQLDVLDFSSDQRLSHSHEGVGSNVAFSFDKENAH-------IFSLLTSGQLSCVAAWAVNEEGGALVPPSLIPNT--VTARRRMDPVAALGVAGMSDMDKLSKWIA-ESRLDPNDPTNADLM--FHMKPIIGGDTLVPTHHMPVHFHLEQMQEEFNFATDQEMEKSRRFRMLQLRQQEAAEFKNKIVPALEKEIPEDIFLEYEKKKRDVEKLKSMDEA-ESHRVAVAKFMQRVREQVMLRFRIASHQKTLPEVVFEDAVPNIGTIIPNLLKITEPRRPLKPIRKERKKVTAQNLQTMDVKILINIVRAFGIPVRSDQPSVHEFHFSRASNAPGGTQNMEGTASARPPGIPKSMAAQTQVRPFIEVTFQRSTVATTIAEGPNPSWNEELTIPFKPPNNDYSATNLQTIRDVVFFNLFDEYVTEIVQDDRERGTTVVRKIEKKWLGTIKIPFSTIYFNSRIDGTFRLNKPPVLLGYQHEAKARKQTPGQLGEEPLDMAVGSSDNTFLTMFVTIEPALTPAEPAKE----KFDSNEDEKLLEVSEKWQSEIASRFPTRECKTTVVDINGKSVFITRYFKSLKPPEELFSGEESGNEKVELVARYVSMIPFVSDSVVFPGLCDIWSTCDQFLQMLQGDEEEHAVLLTNYFLSMGK---TAFLLLGSAIPEGPTAYVLTKE-ERDYWVWNASTGEHYSFRDNFCPVQSVGCLVNADNIWANIQPNDQPSRITFDLSNTSNWRPFFHKGCPNPGLSSVQPENLIYFTTEKSSVIDIQERIERQLKEKIMEWRPRYITRWNRYCMQTFRRLLTKLEISRHNQGTQQQHSSE-LDQILGQYKMCGFPINLPYTEMDPIIDAVYATGVHNIETSDVEFALAVHVHPYPNSVLSVWIYVASLSR 1455          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Cavefish
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 445/1366 (32.58%), Postives = 723/1366 (52.93%), Query Frame = 2
Query: 1088 RNLEEEGLYVGRRPFINTTNERKLASRIQKENKMD--WFGEDGRIKILPDPLKEIPFRPLMWN--EQFNPMPDGLQTEDLKPIISSTTYEHIDS-GDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEG--LDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIA----EEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGS-ISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTL-PIPLYDDKVPLELIKDYENRKGVNKNKIIVTG--FEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVD------------------------------------VERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMES------------FPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQK---VIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIY---EEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCG-EMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            R LE+EGLYVG RP +  +N+  L +RI KE+     WFG+DGRI  LPDP+KE   RP +++  E+ +P    LQT   KP+ S     +I   GD    +Q+ ++V  L FSHH LFS EHVL  R+ QL+   QY+S+Q          ++  L++ I+++ E  S +  +  ++   RI  Y+QE+ +TR  R+ E+   R L  SIIK WK++KS R   G T T   + I+++      D +  E +I  ++A    E +E +E    +  + +E  K    KQ  LK   + R+++ +  +E  +  +   +   E     EA +     +PDI             L +++R +    RR PGEP + P L   + I+       E++RR  + K   ++++ +N+K+V  T ++ LN DF V F +   + I  +PE I L++YE    +S  L+   + VP    L+ +   E   F +NQ +   + GVGS   SF       T  G  I  L TSG L     WAV  D   + P S  +      L+   D +  +G + + D++R  +W + ES LDPNDP +A ++  L       +     ++ D+FRL    +EF F ++++++RS RFR+IRLR+   PEF     IP  + ++  ++ ++Y+ R  + + ++I T    +A + +  ++++KVR+ V+++F  S     L ++V EEE+P+I  +   LF +    RPL+   + RK ++  N+ + +++++V I R  ++P+                                     + +  + PFV+V+FQ     T   EG NP W+ EL LPF  P    + +SL  +RD + I+++D+ + ++  D   +  ++H R ERHWLGS++IPF+TIY+ S+I+G F+L  P  + GY  +  + S               +++FIT++P++ P  S+++    KFD+ E   L+   + ++ +   R+P R    TVV++  +   ITR+I  L PP+ELL    N  Q+   ++ R+VSLI F+ D++ F GI D+WSTCDQFL +L GDE+EHAVLLCNYF  + +   K +L +G AIPEG TAYVLT+E N    +WN STG  +  +D  C +  +G LVN  NVW N Q    P  + FD++    W P F  +     L +VQP+ ++Y   ++ +  E+QD    +E  LR  IM+WR    T +       + + L  LE++ G E+ E    +++ L+  Y++ GFP++LP+ EI  ++  + +TG+H    P VEFALAVY+  YP+ VLS+W+Y+ASLVR 
Sbjct:  259 RYLEDEGLYVGERPPVALSNQNILENRILKEDGQGKKWFGDDGRILALPDPIKESSSRPPLYHLEEELDP---ALQTVYRKPLKSKYVNRYIAGVGDTQGDYQLDVDVSGLIFSHHPLFSKEHVLGARLAQLYD--QYLSRQHKNLTCLLTDKLNGLRNTIRNMLELHSGEGISHVTQ--QRIAEYKQEV-HTRQLRDTEQEKDRTLLKSIIKVWKELKSLREDKGCTNTPYKLYIRREEIQRALDEQEQEAEILAEVAELQAESEEDYERKLNEYKRKHEGWKSWKKKQKTLKKKQKQRRQQSQDVDEEEEEDEHSEEELGEEPVKPEAPE-----KPDIA-----------GLEQQVREKAAKIRRKPGEPVLVPELTASNPITPNEACPGEISRREDVSKRSLFVKVLYNDKEVSRTDSRSLNMDFRVHFGQIFNLKIVNWPESIKLQIYEGVSSSSSLLAEVCVPVPESSVLTGSTPSEELEFSSNQRVTFNHEGVGSVPVSF-------TNDGSNIQTLLTSGKLSCCVSWAVGEDDIPLAPPSTQHGAGMHGLRQ-MDAIACIGASGLNDMKRLGKW-AAESRLDPNDPNNASIMQLLSVASGGEV-----VAPDYFRLEQLQEEFNFLSDEELERSRRFRLIRLRSQEEPEFRNFKTIPATEREISEKVFEEYDRR--LKEGEVIDTKEHIDAHRALVAKYLQKVRESVINRFLISKHHYILSDLVVEEEVPSIV-LGLNLFKLAEPKRPLKPRRKERKKVTAQNLSDGDIKLLVNIIRGYDIPIRKPHTKPAAGSKGARSYTETFTAASTSQTALQASEWPLGQPVIRPFVEVSFQRTLLQTSTAEGPNPCWNEELVLPFSAPNGDYSTSSLQAVRDEVFISIFDEVLHDV--DERERGSSVHTRIERHWLGSIKIPFSTIYMQSRIDGTFKLGTPPVLLGYSKERSLGSEGGYDAIRSLSEGTFLTLFITIEPQLVPGDSIRE----KFDTQEVERLLLACEIFEKDAGQRYPDRPCVTTVVDINGKTVFITRFIRPLPPPQELLDAFPNNSQEATELVVRYVSLIPFLPDSVSFVGICDLWSTCDQFLTLLAGDEEEHAVLLCNYFLSMGK---KAWLIIGTAIPEGPTAYVLTQEQN-RYLIWNPSTGQYYGQHDTFCPLQTVGCLVNADNVWFNIQLYATPIRMSFDVTKPKFWKPFFSRSFPDPGLSSVQPEDLVYRRTDKAYAAELQD----IEKILREKIMEWRPRHPTRWNRYCTSTLRQFLPKLEMSGGREVAEEHRLELQSLLGDYRISGFPLHLPFSEIRPIIEAVYSTGVHNVEAPNVEFALAVYVHPYPSNVLSVWVYIASLVRT 1569          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Cavefish
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:103041156])

HSP 1 Score: 67.781 bits (164), Expect = 7.149e-11
Identity = 105/498 (21.08%), Postives = 193/498 (38.76%), Query Frame = 2
Query: 3581 TLLINVYDQ-QVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEG-NFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETL---ITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGI-SDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSN-------------DPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPF----LKEVQDFQLT--LENQLRSNIMDWR--FGLTT------NFIIAPRREMVEILKCLEINCG--EMNESINEKVKDLMTGYKVFGFPINLPY----MEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            T ++++ D   ++ + +D +    TL   Y   W   L  P     ++ ++ G     K PA V   +    +E +P +S   TL PE+   Q   +R  T   + ++R  + +  +W  E     P    ++  +  + +  +   +  Y+  L+    L    E+ +Q   ARFVSL+      +V  G   + W T   FL    GD ++HA LLC+       D    ++C+G         +V+T   +G V  W + T  ++                 PT     IG + N +   AN Q         F+ +  + W  + +  +      P +     P        VQ  + +  LE ++R  + + R   GL T      +++++      E+ +C  ++CG  E  +++   V D   G+   GFPI+  +          L       I       V  A+ V + +YP +  ++WI  A   R+
Sbjct:  165 TTMLSICDPVHMVMIKTDTSGDT-TLVSSYFLDWRSVLSAPSGKTTVSVELLGVGSECKVPAGVLNIK----LEMYPPLSE--TLSPEVISTQQSLERQKT---AEKERLFLVYAKQWWREFLEIRPSHQSKLVKIFAQDENGVNRPVCSYVRVLRAGRLL----ESPRQA--ARFVSLLVQERAPVVGGGARQEQWCTMMAFLCRNKGDCEDHATLLCSLLLGFGLD---AYVCVGTKSKNTPHTWVMTCGTDGTVTFWESLTAHRYLHQPIDPEAPPMVPQPKPTYPYRTIGCVFNHKTFLANCQPSDSVELCVFEFTDGSRWKAMSEDAVR-SVCAPGSTSSLPPLPPLCSSSVQTSEASNQLELEMRFLLAEHRKDLGLATVWDDHLSYLLSSALAAYELERCTGVSCGNEEFQDAVRRAVPD---GHTFKGFPIHFLHRNARRAFATCLRSPFCEEIVCCRGDHVRLAVRVRVFAYPESACAVWIMFACKYRS 639          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Cavefish
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:103041156])

HSP 1 Score: 67.781 bits (164), Expect = 7.361e-11
Identity = 105/498 (21.08%), Postives = 193/498 (38.76%), Query Frame = 2
Query: 3581 TLLINVYDQ-QVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEG-NFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETL---ITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGI-SDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSN-------------DPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPF----LKEVQDFQLT--LENQLRSNIMDWR--FGLTT------NFIIAPRREMVEILKCLEINCG--EMNESINEKVKDLMTGYKVFGFPINLPY----MEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            T ++++ D   ++ + +D +    TL   Y   W   L  P     ++ ++ G     K PA V   +    +E +P +S   TL PE+   Q   +R  T   + ++R  + +  +W  E     P    ++  +  + +  +   +  Y+  L+    L    E+ +Q   ARFVSL+      +V  G   + W T   FL    GD ++HA LLC+       D    ++C+G         +V+T   +G V  W + T  ++                 PT     IG + N +   AN Q         F+ +  + W  + +  +      P +     P        VQ  + +  LE ++R  + + R   GL T      +++++      E+ +C  ++CG  E  +++   V D   G+   GFPI+  +          L       I       V  A+ V + +YP +  ++WI  A   R+
Sbjct:  168 TTMLSICDPVHMVMIKTDTSGDT-TLVSSYFLDWRSVLSAPSGKTTVSVELLGVGSECKVPAGVLNIK----LEMYPPLSE--TLSPEVISTQQSLERQKT---AEKERLFLVYAKQWWREFLEIRPSHQSKLVKIFAQDENGVNRPVCSYVRVLRAGRLL----ESPRQA--ARFVSLLVQERAPVVGGGARQEQWCTMMAFLCRNKGDCEDHATLLCSLLLGFGLD---AYVCVGTKSKNTPHTWVMTCGTDGTVTFWESLTAHRYLHQPIDPEAPPMVPQPKPTYPYRTIGCVFNHKTFLANCQPSDSVELCVFEFTDGSRWKAMSEDAVR-SVCAPGSTSSLPPLPPLCSSSVQTSEASNQLELEMRFLLAEHRKDLGLATVWDDHLSYLLSSALAAYELERCTGVSCGNEEFQDAVRRAVPD---GHTFKGFPIHFLHRNARRAFATCLRSPFCEEIVCCRGDHVRLAVRVRVFAYPESACAVWIMFACKYRS 642          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Cavefish
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:103041156])

HSP 1 Score: 67.781 bits (164), Expect = 8.186e-11
Identity = 105/498 (21.08%), Postives = 193/498 (38.76%), Query Frame = 2
Query: 3581 TLLINVYDQ-QVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEG-NFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETL---ITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGI-SDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSN-------------DPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPF----LKEVQDFQLT--LENQLRSNIMDWR--FGLTT------NFIIAPRREMVEILKCLEINCG--EMNESINEKVKDLMTGYKVFGFPINLPY----MEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            T ++++ D   ++ + +D +    TL   Y   W   L  P     ++ ++ G     K PA V   +    +E +P +S   TL PE+   Q   +R  T   + ++R  + +  +W  E     P    ++  +  + +  +   +  Y+  L+    L    E+ +Q   ARFVSL+      +V  G   + W T   FL    GD ++HA LLC+       D    ++C+G         +V+T   +G V  W + T  ++                 PT     IG + N +   AN Q         F+ +  + W  + +  +      P +     P        VQ  + +  LE ++R  + + R   GL T      +++++      E+ +C  ++CG  E  +++   V D   G+   GFPI+  +          L       I       V  A+ V + +YP +  ++WI  A   R+
Sbjct:  186 TTMLSICDPVHMVMIKTDTSGDT-TLVSSYFLDWRSVLSAPSGKTTVSVELLGVGSECKVPAGVLNIK----LEMYPPLSE--TLSPEVISTQQSLERQKT---AEKERLFLVYAKQWWREFLEIRPSHQSKLVKIFAQDENGVNRPVCSYVRVLRAGRLL----ESPRQA--ARFVSLLVQERAPVVGGGARQEQWCTMMAFLCRNKGDCEDHATLLCSLLLGFGLD---AYVCVGTKSKNTPHTWVMTCGTDGTVTFWESLTAHRYLHQPIDPEAPPMVPQPKPTYPYRTIGCVFNHKTFLANCQPSDSVELCVFEFTDGSRWKAMSEDAVR-SVCAPGSTSSLPPLPPLCSSSVQTSEASNQLELEMRFLLAEHRKDLGLATVWDDHLSYLLSSALAAYELERCTGVSCGNEEFQDAVRRAVPD---GHTFKGFPIHFLHRNARRAFATCLRSPFCEEIVCCRGDHVRLAVRVRVFAYPESACAVWIMFACKYRS 660          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Sea Lamprey
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 577.4 bits (1487), Expect = 1.313e-179
Identity = 421/1403 (30.01%), Postives = 705/1403 (50.25%), Query Frame = 2
Query: 1019 EEESGLLFYPGVVDMSYFNDRP----LRNLEEEGLYVGRRPFINTTNERKLASRIQK-ENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQE--GLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILA-----RIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQK---QLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLK-VGSISNEN-LTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIP-LSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEA---RKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTI------NDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDV-----ERRT----------------------------------LTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGY--ESDEYMESF--PM-------MSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ----KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNG--DVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVR 4954
            E E  +L+ P  + +      P    +R LE+EG YVG+RP +  TN+  +  R+ K     DWFG+DGR+  LPDPLK    RPL  + ++     GL+    KP +       + +       Q+ ++V  + F HH LFS EH LA R+ QL+   QY+++QE    D    ++ +L+ A+         KN +   E+L      R+  Y  EIR TR   + E    R L  S++KTWK+IK+ R     T T + + I+++     ED   +E++I+ ++ E ++ F+  + K M  Y  Q    +L+ K+ + +                      + KR ++ E   +A    +  EP   +P  P+ FD  +  + +R +    RR PGEP I   L    +++  N   + E  RR  +Q+Y  ++++ FNNK+V  T+++ LN DFS+ F +   + I  +PE I L L+E+ G ++  L+     +P    ++ N  ++   F +  ++   + G+GS   + P+    G      ++ L TSG L     W V SDG  + P L+  + +   +  +  D + ++G + + D+ +   W + ES LDPNDP +A ++  +       + S     +D+FRL    +EF F+TE+++  S R  ++++R+  VPEF     +P  D ++P ++ ++YE ++   + K IV   E     + I   +++K+R+ V+S+F  +     L ++V EEE+P I      + +   LF +    RPL+   + RK ++  N+ + ++ ++V I RA ++P+        +R+                                  + PFV+V+FQ   R T   +G NP W+ EL LPFK      +   L++ RD + IN++D+ V ++  +     + +H R ER+WLGS+ IPF TIY  S+I+G F L  P  + GY  E++   +S   P+       +++FIT +P++ P + +++    KFDS ED  L+   D +  +    FP R    TV ++  Q   + R+I  ++PP ELL  +    Q     ++AR+VSLI F+ D++ F G+ D+WST DQFL++  GDE+EHAVLLCN+F  L Q   K +L LG A+PEGSTAYVLT+E        +WN STG  +  +D  C +  +G L++  N+W N Q    P  + F +S  + W P F  +    NL +VQP  + +  P      + Q  +E  L+  +M+WR    T +       + ++L  LE   G  + E    ++   +  Y+V GFPI++ + E+  ++  +  +G+H    P  EFALAVY+  Y N V+S+W+YVASLVR
Sbjct:   62 ENEQKMLYIPSAMAVPVSQKMPPDQEVRYLEDEGFYVGQRPMVTLTNQNIMEHRLLKMPGGKDWFGDDGRVLALPDPLKPEATRPL--DTEWEARDQGLELVFQKPELQEADTGGVTAPGTCGRCQLDMDVCGVTFLHHALFSREHALASRLSQLYA--QYLARQEERRADMLGDKLRALRSAV---------KNISTNMEVLVPATRKRVQEYTNEIRQTRRLNDIELEKDRNLLKSLLKTWKEIKNLREFQKYTNTQLKLYIRREEKRRQEDESQYEQEIAHEVDEMEQEFQEEFEKRMHEYRLQCDVWKLWRKKQRAR--------------------LKKKKREDDEEEGGDAGAEPLDEEPP--KPQKPETFDRAAAEQMVREKAARIRRKPGEPLITLELSNTATVTPTNQCPRPEQQRRQALQRYSLFVKVLFNNKEVSRTTSRPLNADFSIHFGQIFNIQIVHWPESIKLLLFETVGVSTVRLAEMFTRLPDLNVVAGNCPLQELEFSSEHHVSFPHEGIGS---NVPVTL--GVDKESTVT-LLTSGKLACSVAWGVGSDGIPLAPALASQHGDGLHSAANQVDAIASIGASALTDVNKLAAW-AKESRLDPNDPSNAALMQLITV-----VTSGEVEVTDYFRLEQLQEEFNFATEEEMSMSRRLHLLQMRSREVPEFRNYRLVPPLDREIPEKVFQEYEKKQ---REKDIVDTTEQLIRYRAIAAIYMKKIRESVMSRFVLARHHYVLSDLVLEEEMPNIGCRHGSSTLGLGLFKLTEARRPLKPQRKERKRVTAQNLTDGDITLLVNIVRAYDIPMRTMATKSSKRSRIGPGQYLDGQHARNICQSYNIPHNFTYSSGMVLVRPFVEVSFQREVRRTTTADGPNPNWNEELVLPFKACNGDYSAAGLNSTRDDIFINMFDEIVYDIQENDREAGNVIHTRVERNWLGSIRIPFTTIYFQSRIDGTFMLDSPPVLLGYSHENEGRWDSMAPPLAAGDATYLTLFITTEPQLIPAEPVRE----KFDSQEDEKLLRMADAFGAQCQAVFPTRRLATTVADLNGQAVFVCRFIRPIQPPAELLQANPGNLQLTATNLLARYVSLIPFIPDSVSFSGVCDLWSTSDQFLELQCGDEEEHAVLLCNFF--LAQG-IKAWLLLGTAVPEGSTAYVLTQEEGSYNQFVIWNPSTGRSYNQHDHFCPLQSVGCLISADNIWFNIQLYDLPARMNFAVSNASLWKPFFTRSFPIPNLPSVQPAELNHVPPDKTSAMELQARIEKILKERMMEWRPRQPTRWNRHVTAALRDLLPALERGMGRAVEEQHRAELAHTLADYRVSGFPIHMAFTELQRLVEAVYGSGVHSIDLPGTEFALAVYVHPYANHVMSVWVYVASLVR 1407          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Sea Lamprey
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 243.432 bits (620), Expect = 1.743e-71
Identity = 135/368 (36.68%), Postives = 204/368 (55.43%), Query Frame = 2
Query: 3875 TKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQ--KVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNG--DVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVR 4954
            ++FDS ED  L+   D +  +    FP R    TV ++  Q   + R+I  ++PP ELL  +    Q   ++AR+VSLI F+ D++ F G+ D+WST DQFL++  GDE+EHAVLLCN+F  L Q   K +L LG A+PEGSTAYVLT+E        +WN STG  +  +D  C +  +G L++  N+W N Q    P  + F +S  + W P F  +    NL +VQP  + +  P      + Q  +E  L+  +M+WR    T +       + ++L  LE   G  + E    ++   +  Y+V GFPI++ + E+  ++  +  +G+H    P  EFALAVY+  Y N V+S+W+YVASLVR
Sbjct:    6 SQFDSQEDEKLLRMADAFGAQCQAVFPTRRLATTVADLNGQAVFVCRFIRPIQPPAELLQANPGNLQLTALLARYVSLIPFIPDSVSFSGVCDLWSTSDQFLELQCGDEEEHAVLLCNFF--LAQG-IKAWLLLGTAVPEGSTAYVLTQEEGSYNQFVIWNPSTGRSYNQHDHFCPLQSVGCLISADNIWFNIQLYDLPARMNFAVSNASLWKPFFTRSFPIPNLPSVQPAELNHVPPDKTSAMELQARIEKILKERMMEWRPRQPTRWNRHVTAALRDLLPALERGMGRAVEEQHRAELAHTLADYRVSGFPIHMAFTELQRLVEAVYGSGVHSIDLPGTEFALAVYVHPYANHVMSVWVYVASLVR 370          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Sea Lamprey
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:564926])

HSP 1 Score: 68.5514 bits (166), Expect = 9.157e-12
Identity = 75/328 (22.87%), Postives = 124/328 (37.80%), Query Frame = 2
Query: 4076 KVIARFVSLISF-MADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKS-----NDPTCSMFK----------IGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLK----EVQDFQLTLENQLRSNIMDWR--FGLTT------NFIIAPRREMVEILKCLEINCG--EMNESINEKVKDLMTGYKVFGFPINL----PYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            +  ARFVSL+ +  A A+      ++WS+   FL    GD ++HA LLC+       D    F+C+G        A+V T+  +G    W + TG ++       +DP     +          +G   N R  +AN            DL+    W  + +  +   T    A     P L+    +  D    +E +LR  + D R   GL T       ++++P     E  + + +  G  E  +++   V D   G+   GFPI+L        +   L       I       V  A+   +  YP    ++WI  A   R+
Sbjct:  349 RQAARFVSLLGYERAQAVGGGARHEMWSSAFAFLCRGKGDCEDHANLLCSLLLGFGLD---AFVCVGTKAKGEPHAWVATRSTDGTATFWESLTGHRYAHRPINLDDPPLPRAQQHQQHHPYRTLGCAYNHRAFYANCGPTHAVDATHLDLADGTRWKAMSRDAVASVTTAGLATSALAPPLRPPSIDPADAARRVETELRLLVEDHRKDLGLQTAWDPALAYLLSPALAAYECERAVGVAPGNDEFQDAVRRFVPD---GHTFKGFPIHLLSRNARRALATALRSPFCDEIVSCRGDEVRLAVRTRVFVYPENACAVWIMFACTYRS 670          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Nematostella
Match: EDO29032 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4T2])

HSP 1 Score: 348.977 bits (894), Expect = 3.891e-104
Identity = 214/682 (31.38%), Postives = 357/682 (52.35%), Query Frame = 2
Query: 3077 IKDYENR-KGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTL--TPFVQVNFQNINRTTDV-------------------LEGINPAWDIELRLPF----------KPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYM-------ESFPMMSVFITLDPEIHPPQSLKDR----NITKFDSVEDRDLITHVDRWQNEMNMRFPKRFR------RVTVVNMRCQETLITRYISTLKPPEELLAVDEN-MKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGY--KVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            ++ YE R +G    +       A ++   +F+ KVR+EV  +   +  +  L +M+ E+E+P I +    +  +    RPL+   + RK +   N+   +V+++V I R  ++PV    R +  TP V + ++   RTT                     L+   P  +   +L F          K   +  +L T+ D L +N++D++V ++  D   +  ++H+R ERHWLGS+EIPF+T+Y N K++G FR+  P+ + GYE  +          S  ++++F+T++P + P Q + +R     + K     D ++   +   Q     + P + R      R    ++  ++  ITRYI + KPPE+LL   +  M ++++AR+VSL+ +++D+  FP + DIW+T +QFL+ML GDE+EHA+LLCNYF   ++   K ++ LG  IPEGSTAYVL+  ++G   LWNA TG +F  +DP C +  IG + NE N+WAN QQ  +P+ L FDL+    W P F        L +VQ + + Y     + V   Q  +   L   IM WR    T +     +    +L  L ++  E++    +    L+     ++ GFPIN+P+ ++P V+  + +TG+H   DP VEFALA +I  +P+ V+S+WIYV +L R 
Sbjct:    5 LQAYEKRQRGEQAEEETEDELCAHRMAVTKFLNKVREEVTQRSLVAKRQMELRDMIIEDEVPDIRNFCVGIGQLFSPRRPLRPTRKERKVVGTQNLTIRDVKLLVNIVRGLDIPVRNNARNVVNTPSVLLGYEYQKRTTGPGTSSRSDTLLTMFVTIEPPLQPSQPMAERPFKLMFHTLLLSSRAPKDDYSPENLQTVDDVLFLNLFDEKVYDILQDERQRGTSVHQRLERHWLGSIEIPFSTVYFNGKVDGTFRVNTPSVLLGYEYQKRTTGPGTSSRSDTLLTMFVTIEPPLQPSQPMAERVRINRVEKHAVWCDENMDKSLKSSQILTTKKLPTKQRDMRLADRALATDLTGKKVFITRYIRSQKPPEDLLGQSQKEMVRELLARYVSLVPYVSDSAAFPDLCDIWATSEQFLQMLAGDEEEHAILLCNYFT--HRGRGKAYVVLGTGIPEGSTAYVLSI-VDGKKQLWNAHTGRQFDVHDPHCPLTSIGCVFNEENIWANVQQFEEPFRLDFDLTKPKLWLPFFSQKYPRPALSSVQKENLFYRPVDREYVARTQDRVGKLLMDKIMAWRPRFVTRWNRYCTQTFRNLLH-LTVHTAELDTDPRQTSLILLILLSRQLSGFPINMPFTDVPPVVDAVYSTGVHTIEDPDVEFALATHIHPFPHGVMSLWIYVGTLKRK 682          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Nematostella
Match: EDO30922 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZE6])

HSP 1 Score: 59.6918 bits (143), Expect = 9.238e-9
Identity = 73/322 (22.67%), Postives = 127/322 (39.44%), Query Frame = 2
Query: 4085 ARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKF--------------KSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQL-------TLENQLRSNIMDWR--FGLTTNF------IIAPRREMVEILKCLEINCG--EMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVL-----SRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVA 4942
            ARFVSL+ +     V  G +++WS+    L    GD ++HA LLC   + L       ++C G      +  +V+T    G+   W + T  ++              +   P      +G + N +  +AN+Q        +F+L  +A W  +  S   L+++    I+   P L  +    +        +E++LR  + D R   GL+T++      I++P     E+     ++ G  E   +I   + D   G+   GFPI   +            S I    I    D  V  A+ V + +YP    + WI  A
Sbjct:  334 ARFVSLLGYERTPSVGGGKAEMWSSFHALLCKRKGDCEDHATLLC---SLLLGFGLNAYVCGGTKSKGVAHTWVVTISPEGEATFWESLTAHRYVHRPINPDDPPLDKQQARPVHPYHTVGCVFNHQEFYANSQPTDVVEVCQFELHNEALWKAM--SEDALKSICGTKILPPMPPLPPLFPPTIDSALISNDMEHELRGLVADHRKDLGLSTSWDDELCHILSPALASYELEHSTGVSVGNEEFQHAIRRAIPD---GHTFKGFPIQFVHRNARRAFATCLRSPICEEIISCRGD-NVRLAVRVRVFTYPENACATWIMFA 646          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Nematostella
Match: EDO26822 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAZ5])

HSP 1 Score: 52.373 bits (124), Expect = 7.609e-8
Identity = 34/109 (31.19%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 2906 SSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENR-KGVNKNKIIVTGFEARKLIHQEFIEKVR---DEVLSKFRTSLM 3217
            +  +FRLN    E  F T+D++DRS R ++I LR+  VPEF     IP  +  +P  + + YE R +G    +       A ++   +F+ KVR    +++S   T L+
Sbjct:    9 APKYFRLNQLEGETEFVTQDELDRSRRVKLISLRDQGVPEFKNYKMIPARERDIPANVFEAYEKRQRGEQAEEETEDELCAHRMAVTKFLNKVRAMPHQIISNQNTKLL 117          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Medaka
Match: ENSORLT00000005880.2 (coiled-coil and C2 domain-containing protein 2A-like [Source:NCBI gene;Acc:101160942])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 458/1510 (30.33%), Postives = 787/1510 (52.12%), Query Frame = 2
Query:  647 QSLPGQ-ISTRFDVEAMNSTRFSLAPEPDIPWE-----TLKE------QEMITEKQSFDFFCRQWPVAPKQEK-----RKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTF-FLQTLPATKLPSYETLLIEEESGLLFYPGV----VDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQK-ENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEG--LDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSISNENLT-KEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLN-SEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPL-QRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV---------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYE---------SDEYMESFP---MMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQK---VIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            QSL G+  +TRFD E  +S +   A + D+P         KE      Q + T K+++DFF   +   P ++      +     EG  E  +  E +   + ++L  N E   ++ I   S + FL+T  A  +   +    E +S LLF P        +        R +E+EGLYVG+RP ++ TNE  L +R+ K E  ++WFG+DG+I  LPDP+KE   RP +++ + + +P GLQT   K    +  Y+    GDP   +Q+ + V  L FSHH LFS EHVL  R+ QL+   QY+++Q+         ++  L++ + ++ +   ++  +    +  RI  Y  E+RNTR  R++E+   R L   IIK W +IK+ R     T T   + ++++  D   D +++E +I  ++ E +   E +Y++ +  Y  + + + K  + K  A+ +++EK ++++     +   ++  ++E   E          D+  P  P+  D +++ +++R +    RR PGE  + PVL   G+I++  L  + E++RR  + ++  +I++ +N K V  T ++ L  DF V F +   + I   P+ I L+++E +G +   L+   + VP P  ++    +E + F ++Q ++  + GVGS     PL S +   S ++I  L TSG+L     W +  +G  + P + L+   +   L H  D + ++G + + D++R  EW + +S LDPNDP++A V   L    E+    E   + ++FRL    +EF F T++++D+S RFR++RLRN  V EF     IP Y+ ++P  + ++YE R    +        E+ + +   +++K+++ + ++   +  +  L ++V E+EI +   +   LF +    RP  QR  + R+ ++  N+ + +V+++V I RA ++PV                      + +  + PFV+V+FQ     T   +G NP W+ EL+LPF  P    + ++L +++D + IN++D+ V     +   +  ++    E+HWLGS+ IPFNTIY  S I+G F++  PA + GY           D++++       +++FI + P++ P +S+    + KFDS E   L+     ++ +   R+P R    TV+++  Q   ITRYI  L PP+E L    N  Q+   ++ARFVSLI  ++      GI D+W+TC+QFL +L GDE EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E +    +WN S+G  +   D  C +  +G LV+  NVW N Q+   P  + FD+S +  W P F  +     L +VQP+ ++Y           Q  +EN L+  IM+WR    T +       +   L  LE + G+ M E    +++ L+  +++ GFP+++P+ EI  ++  + +TG+H      VEFALAVY+  YPN +LS+W+Y+ASLVR 
Sbjct:   71 QSLRGKDRTTRFDRET-DSVK---AEDDDVPASLSTKVKFKEAAKRVGQGLPTPKEAYDFFTFNFESEPAEDTEELSWKNREQKEGTDEPRDEDEEEHQPEETRLYPNGE---DFFIVDQSAWDFLETAKAEYVGIRKR--AERDSKLLFTPSFRKAPTSVKLSEKVKPRYIEDEGLYVGKRPSVSLTNEAILENRLLKMEEGLEWFGDDGKILALPDPIKESSTRPRVFSMKED-LPPGLQTVFRK----AQKYD----GDPERVYQLDVEVLGLIFSHHPLFSREHVLTSRLCQLYD--QYLTRQQNDLTRHLTDKLNGLRNVLGNMMK--IHREKSLTPSLQQRISEYSLEVRNTRQLRDSEQEKDRTLLKKIIKVWNEIKALREFQKFTSTPYKLFLRRENVDRASDQQIYEEEILAEVMELEVEKEQDYQRSLAEYRKELEEW-KLWRRKKKAKGKKKEKRKEQDDPTEEEDEEQQGSKLEGPSE----------DLPNPQPPERPDFDAIEQQVREKAAKIRRKPGEAILIPVLSASGNITDSELCPRVEISRRQGVLRHSLFIKILYNGKIVSRTESRPLGTDFRVYFGQIFNLKIKNCPQSINLEVFEDTGSSCSLLAQVYVPVPEPSVVTSGTPLEDFEFSSDQRVMFDHEGVGS---DVPL-SFEADGSNKVI--LLTSGMLTCCVSWGIGDNGVPLAPTASLHPGVRHSGLGHV-DAVTSIGASGLHDMKRIGEW-AKQSRLDPNDPKNASVRQLL----EVASSGEVT-APEYFRLEHLQEEFNFVTDEELDKSKRFRLLRLRNQGVKEFRNYKFIPAYEHEIPDNVFEEYERRLKDEETVDTREHLESHRALLVNYLQKIQESITNRLVLAKNRFILSDLVVEDEIQSNRILGINLFKLTEPKRPKPQR--KKREKVTAQNLSDRDVKLLVKIIRACDIPVRRSQSEKAGQPSQRAIHSNDWSLHQVQVRPFVEVSFQRTVLQTTTADGPNPTWNEELQLPFSAPNGDHSTSNLQSLKDEVFINIFDEMVHKTGVNDKERGPSIQIHVEKHWLGSVRIPFNTIYSQSSIDGTFKVNTPAVLLGYSKEPSHSAYSGDDFLQRVSEGVYITLFIAIKPQLVPEESI----MEKFDSQEHERLLQAAKTFETKAAKRYPDRRCITTVIDLNGQTVFITRYIRPLNPPQEFLDAFPNNPQEATMLVARFVSLIPSIS------GIYDLWTTCNQFLTLLAGDEKEHAVLLCNYFLSLGK---KAWLVIGTAIPEGPTAYVLTHEQS-RYLIWNPSSGQLYGQKDRFCPLQAVGCLVDADNVWFNIQEYASPMRMSFDVSKRKLWKPFFSESFPHPGLSSVQPEELVYSRTDAAAAAKLQDRIENILKEKIMEWRPRHPTRWNRYCTTTLKRFLPKLEQSRGQDMAEGHCHELQRLLGNFRISGFPLHMPFSEIQPLIEAVHSTGVHNIQGSNVEFALAVYVHPYPNNILSVWVYLASLVRT 1518          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Medaka
Match: ENSORLT00000036721.1 (coiled-coil and C2 domain-containing protein 2A-like [Source:NCBI gene;Acc:101160942])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 457/1511 (30.24%), Postives = 788/1511 (52.15%), Query Frame = 2
Query:  647 QSLPGQ-ISTRFDVEAMNSTRFSLAPEPDIPWE-----TLKE------QEMITEKQSFDFFCRQWPVAPKQEK-----RKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTF-FLQTLPATKLPSYETLLIEEESGLLFYPGV----VDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQK-ENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEG--LDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSISNENLT-KEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLN-SEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPL-QRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPV---------------------DVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYE---------SDEYMESFP---MMSVFITLDPEIHPPQSLKDR-NITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQK---VIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            QSL G+  +TRFD E  +S +   A + D+P         KE      Q + T K+++DFF   +   P ++      +     EG  E  +  E +   + ++L  N E   ++ I   S + FL+T  A  +   +    E +S LLF P        +        R +E+EGLYVG+RP ++ TNE  L +R+ K E  ++WFG+DG+I  LPDP+KE   RP +++ + + +P GLQT   K    +  Y+    GDP   +Q+ + V  L FSHH LFS EHVL  R+ QL+   QY+++Q+         ++  L++ + ++ +   ++  +    +  RI  Y  E+RNTR  R++E+   R L   IIK W +IK+ R     T T   + ++++  D   D +++E +I  ++ E +   E +Y++ +  Y  + + + K  + K  A+ +++EK ++++     +   ++  ++E   E          D+  P  P+  D +++ +++R +    RR PGE  + PVL   G+I++  L  + E++RR  + ++  +I++ +N K V  T ++ L  DF V F +   + I   P+ I L+++E +G +   L+   + VP P  ++    +E + F ++Q ++  + GVGS     PL S +   S ++I  L TSG+L     W +  +G  + P + L+   +   L H  D + ++G + + D++R  EW + +S LDPNDP++A V   L    E+    E   + ++FRL    +EF F T++++D+S RFR++RLRN  V EF     IP Y+ ++P  + ++YE R    +        E+ + +   +++K+++ + ++   +  +  L ++V E+EI +   +   LF +    RP  QR  + R+ ++  N+ + +V+++V I RA ++PV                      + +  + PFV+V+FQ     T   +G NP W+ EL+LPF  P    + ++L +++D + IN++D+ V     +   +  ++    E+HWLGS+ IPFNTIY  S I+G F++  PA + GY           D++++       +++FI + P++ P +S+ ++    +FDS E   L+     ++ +   R+P R    TV+++  Q   ITRYI  L PP+E L    N  Q+   ++ARFVSLI  ++      GI D+W+TC+QFL +L GDE EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E +    +WN S+G  +   D  C +  +G LV+  NVW N Q+   P  + FD+S +  W P F  +     L +VQP+ ++Y           Q  +EN L+  IM+WR    T +       +   L  LE + G+ M E    +++ L+  +++ GFP+++P+ EI  ++  + +TG+H      VEFALAVY+  YPN +LS+W+Y+ASLVR 
Sbjct:   71 QSLRGKDRTTRFDRET-DSVK---AEDDDVPASLSTKVKFKEAAKRVGQGLPTPKEAYDFFTFNFESEPAEDTEELSWKNREQKEGTDEPRDEDEEEHQPEETRLYPNGE---DFFIVDQSAWDFLETAKAEYVGIRKR--AERDSKLLFTPSFRKAPTSVKLSEKVKPRYIEDEGLYVGKRPSVSLTNEAILENRLLKMEEGLEWFGDDGKILALPDPIKESSTRPRVFSMKED-LPPGLQTVFRK----AQKYD----GDPERVYQLDVEVLGLIFSHHPLFSREHVLTSRLCQLYD--QYLTRQQNDLTRHLTDKLNGLRNVLGNMMK--IHREKSLTPSLQQRISEYSLEVRNTRQLRDSEQEKDRTLLKKIIKVWNEIKALREFQKFTSTPYKLFLRRENVDRASDQQIYEEEILAEVMELEVEKEQDYQRSLAEYRKELEEW-KLWRRKKKAKGKKKEKRKEQDDPTEEEDEEQQGSKLEGPSE----------DLPNPQPPERPDFDAIEQQVREKAAKIRRKPGEAILIPVLSASGNITDSELCPRVEISRRQGVLRHSLFIKILYNGKIVSRTESRPLGTDFRVYFGQIFNLKIKNCPQSINLEVFEDTGSSCSLLAQVYVPVPEPSVVTSGTPLEDFEFSSDQRVMFDHEGVGS---DVPL-SFEADGSNKVI--LLTSGMLTCCVSWGIGDNGVPLAPTASLHPGVRHSGLGHV-DAVTSIGASGLHDMKRIGEW-AKQSRLDPNDPKNASVRQLL----EVASSGEVT-APEYFRLEHLQEEFNFVTDEELDKSKRFRLLRLRNQGVKEFRNYKFIPAYEHEIPDNVFEEYERRLKDEETVDTREHLESHRALLVNYLQKIQESITNRLVLAKNRFILSDLVVEDEIQSNRILGINLFKLTEPKRPKPQR--KKREKVTAQNLSDRDVKLLVKIIRACDIPVRRSQSEKAGQPSQRAIHSNDWSLHQVQVRPFVEVSFQRTVLQTTTADGPNPTWNEELQLPFSAPNGDHSTSNLQSLKDEVFINIFDEMVHKTGVNDKERGPSIQIHVEKHWLGSVRIPFNTIYSQSSIDGTFKVNTPAVLLGYSKEPSHSAYSGDDFLQRVSEGVYITLFIAIKPQLVPEESIMEKIKELEFDSQEHERLLQAAKTFETKAAKRYPDRRCITTVIDLNGQTVFITRYIRPLNPPQEFLDAFPNNPQEATMLVARFVSLIPSIS------GIYDLWTTCNQFLTLLAGDEKEHAVLLCNYFLSLGK---KAWLVIGTAIPEGPTAYVLTHEQS-RYLIWNPSSGQLYGQKDRFCPLQAVGCLVDADNVWFNIQEYASPMRMSFDVSKRKLWKPFFSESFPHPGLSSVQPEELVYSRTDAAAAAKLQDRIENILKEKIMEWRPRHPTRWNRYCTTTLKRFLPKLEQSRGQDMAEGHCHELQRLLGNFRISGFPLHMPFSEIQPLIEAVHSTGVHNIQGSNVEFALAVYVHPYPNNILSVWVYLASLVRT 1523          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Medaka
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:NCBI gene;Acc:101169598])

HSP 1 Score: 511.146 bits (1315), Expect = 3.640e-153
Identity = 308/1001 (30.77%), Postives = 547/1001 (54.65%), Query Frame = 2
Query: 2105 DEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSISNENLT-KEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNR----DPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVD---------------------VERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMES------------FPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQK---VIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            D +++ +++R +    RR PGE  + PVL   G+I++  L  + EL RR  + ++  ++++  N KKV  T  + L  DF V F +   + I   P+ I L+++E +G +   L+   + VP P  ++ +  +E + F ++Q ++  + GVGS     PL S +   S +++  L TSG L     W +  D   + P    ++ +   ++H+     D + ++G + + D++R  EW + +S LDPNDP++A ++  L    ++ +  E   + ++FRL    +EF F T++++D+S RFR++RLRN  V EF     IP  ++++  ++ ++YE R    +        ++ + +  ++++K+++ + ++   +  +  L ++V E+EIP+I  +   LF +    RPL+   + RK ++  N+ + +V+++V I RA ++PV                      + +  + PFV+V+FQ     T   +G NP+W+ EL+LPF  P    + ++L +++D + IN++D+ V     +   +  ++H + E+HWLGS+ IPF+TIY  S+I+G F++  PA + GY  +    +               +++FIT++P++ P +S+++    KFDS E   L+   ++++ +   R P R    TV+++  +   +TRYI  L PP+E L    N  Q+   ++ARFVSLI  + D + F G+ D+W+TC+QF  +L GDE+EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E +    +WN S+G  +   D  C +  +G LV+  NVW N Q+   P  + FD+S +  W P F  +     L +VQP+ ++Y         + Q  +E  L+  IM+WR    T +       + + L  LE + G+ + E    +++ L+  Y++ GFP+++P+ +I  ++  + +TG+H      VEFALAVY+  YPN VLS+W+Y+ASLVR 
Sbjct:  626 DFDAIEQQVREKAAKIRRKPGEAILIPVLSASGNITDSELCPRVELARRQEVLRHSLFVKILCNGKKVSRTDGRPLGTDFRVHFGQIFNLKIMNCPQSINLQVFEDTGSSCSLLAQVFVPVPEPSVVTGSASLEDFEFSSDQRVMFDHEGVGS---DVPL-SFEADGSNKVL--LLTSGKLTCCVSWGIGDDDVPLAP----SASQHPGVRHSGLGHVDAVTSIGASGLYDMKRIGEW-AKQSRLDPNDPKNASIMQLL----KVAVSGEVT-APEYFRLEHLQEEFNFVTDEELDKSRRFRLLRLRNQGVKEFRNYKFIPALENEISDKVFQEYERRLKDGETVDTREHLDSHRALVAKYLQKIQESITNRLLLARHRFILSDLVVEDEIPSIGILGINLFRLAEPKRPLKPQRKERKKVTAQNLSDGDVKLLVNIIRAYDIPVRRPQGENAGQSSQPAIHGSDWYLHQVQVRPFVEVSFQRTVLQTTTADGPNPSWNEELQLPFSAPNCDYSTSTLQSVKDDVFINIFDEMVHETGVNDKERGPSIHTQVEKHWLGSVRIPFSTIYSQSRIDGTFKVNTPAVLLGYSKERSHSANSGYDFSRSVSEGAFITLFITIEPQLVPGESIRE----KFDSQEQERLLQAAEKFERKAAERHPDRPCITTVIDLNGKTVFVTRYIRPLNPPQEFLDAFPNNPQEATTLVARFVSLIPSLPDQVSFSGVCDLWTTCNQFFTLLAGDEEEHAVLLCNYFLSLGK---KAWLVIGTAIPEGPTAYVLTHEQS-RYLIWNPSSGQFYGQYDTFCPLQAVGCLVDADNVWFNIQEYASPMRMSFDVSKRKLWKPFFSGSFPHPGLSSVQPEELVYSHTDAAAAAELQDRIEKILKEKIMEWRPRHPTRWNRYCNTTLKQFLPKLEQSRGQDVAEGHRHELQRLLGEYRISGFPLHMPFSDIRPLIEAVHSTGVHNIQGSNVEFALAVYVHPYPNNVLSVWVYLASLVRT 1602          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Medaka
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:NCBI gene;Acc:101169598])

HSP 1 Score: 510.76 bits (1314), Expect = 5.315e-153
Identity = 308/1002 (30.74%), Postives = 548/1002 (54.69%), Query Frame = 2
Query: 2105 DEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSISNENLT-KEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNR----DPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVD---------------------VERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMES------------FPMMSVFITLDPEIHPPQSLKDR-NITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQK---VIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            D +++ +++R +    RR PGE  + PVL   G+I++  L  + EL RR  + ++  ++++  N KKV  T  + L  DF V F +   + I   P+ I L+++E +G +   L+   + VP P  ++ +  +E + F ++Q ++  + GVGS     PL S +   S +++  L TSG L     W +  D   + P    ++ +   ++H+     D + ++G + + D++R  EW + +S LDPNDP++A ++  L    ++ +  E   + ++FRL    +EF F T++++D+S RFR++RLRN  V EF     IP  ++++  ++ ++YE R    +        ++ + +  ++++K+++ + ++   +  +  L ++V E+EIP+I  +   LF +    RPL+   + RK ++  N+ + +V+++V I RA ++PV                      + +  + PFV+V+FQ     T   +G NP+W+ EL+LPF  P    + ++L +++D + IN++D+ V     +   +  ++H + E+HWLGS+ IPF+TIY  S+I+G F++  PA + GY  +    +               +++FIT++P++ P +S++++    KFDS E   L+   ++++ +   R P R    TV+++  +   +TRYI  L PP+E L    N  Q+   ++ARFVSLI  + D + F G+ D+W+TC+QF  +L GDE+EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E +    +WN S+G  +   D  C +  +G LV+  NVW N Q+   P  + FD+S +  W P F  +     L +VQP+ ++Y         + Q  +E  L+  IM+WR    T +       + + L  LE + G+ + E    +++ L+  Y++ GFP+++P+ +I  ++  + +TG+H      VEFALAVY+  YPN VLS+W+Y+ASLVR 
Sbjct:  626 DFDAIEQQVREKAAKIRRKPGEAILIPVLSASGNITDSELCPRVELARRQEVLRHSLFVKILCNGKKVSRTDGRPLGTDFRVHFGQIFNLKIMNCPQSINLQVFEDTGSSCSLLAQVFVPVPEPSVVTGSASLEDFEFSSDQRVMFDHEGVGS---DVPL-SFEADGSNKVL--LLTSGKLTCCVSWGIGDDDVPLAP----SASQHPGVRHSGLGHVDAVTSIGASGLYDMKRIGEW-AKQSRLDPNDPKNASIMQLL----KVAVSGEVT-APEYFRLEHLQEEFNFVTDEELDKSRRFRLLRLRNQGVKEFRNYKFIPALENEISDKVFQEYERRLKDGETVDTREHLDSHRALVAKYLQKIQESITNRLLLARHRFILSDLVVEDEIPSIGILGINLFRLAEPKRPLKPQRKERKKVTAQNLSDGDVKLLVNIIRAYDIPVRRPQGENAGQSSQPAIHGSDWYLHQVQVRPFVEVSFQRTVLQTTTADGPNPSWNEELQLPFSAPNCDYSTSTLQSVKDDVFINIFDEMVHETGVNDKERGPSIHTQVEKHWLGSVRIPFSTIYSQSRIDGTFKVNTPAVLLGYSKERSHSANSGYDFSRSVSEGAFITLFITIEPQLVPGESIREKIKDLKFDSQEQERLLQAAEKFERKAAERHPDRPCITTVIDLNGKTVFVTRYIRPLNPPQEFLDAFPNNPQEATTLVARFVSLIPSLPDQVSFSGVCDLWTTCNQFFTLLAGDEEEHAVLLCNYFLSLGK---KAWLVIGTAIPEGPTAYVLTHEQS-RYLIWNPSSGQFYGQYDTFCPLQAVGCLVDADNVWFNIQEYASPMRMSFDVSKRKLWKPFFSGSFPHPGLSSVQPEELVYSHTDAAAAAELQDRIEKILKEKIMEWRPRHPTRWNRYCNTTLKQFLPKLEQSRGQDVAEGHRHELQRLLGEYRISGFPLHMPFSDIRPLIEAVHSTGVHNIQGSNVEFALAVYVHPYPNNVLSVWVYLASLVRT 1607          
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Medaka
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:NCBI gene;Acc:101169598])

HSP 1 Score: 496.123 bits (1276), Expect = 1.800e-147
Identity = 311/1043 (29.82%), Postives = 550/1043 (52.73%), Query Frame = 2
Query: 2105 DEESLSREIRSQFELCRRLPGEPFIHPVLKV-GSISNENLT-KEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNR----DPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLP-IPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKL------------------------------------FNVNRF-----SRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVD---------------------VERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPT---TVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMES------------FPMMSVFITLDPEIHPPQSLKDR-NITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQK---VIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNI---NLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGE-MNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN 4957
            D +++ +++R +    RR PGE  + PVL   G+I++  L  + EL RR  + ++  ++++  N KKV  T  + L  DF V F +   + I   P+ I L+++E +G +   L+   + VP P  ++ +  +E + F ++Q ++  + GVGS     PL S +   S +++  L TSG L     W +  D   + P    ++ +   ++H+     D + ++G + + D++R  EW + +S LDPNDP++A ++  L    ++ +  E   + ++FRL    +EF F T++++D+S RFR++RLRN  V EF     IP  ++++  ++ ++YE R    +        ++ + +  ++++K+++ + ++   +  +  L ++V E+EIP+I    PKL                                      +N F      RPL+   + RK ++  N+ + +V+++V I RA ++PV                      + +  + PFV+V+FQ     T   +G NP+W+ EL+LPF  P    + ++L +++D + IN++D+ V     +   +  ++H + E+HWLGS+ IPF+TIY  S+I+G F++  PA + GY  +    +               +++FIT++P++ P +S++++    KFDS E   L+   ++++ +   R P R    TV+++  +   +TRYI  L PP+E L    N  Q+   ++ARFVSLI  + D + F G+ D+W+TC+QF  +L GDE+EHAVLLCNYF  L +   K +L +G AIPEG TAYVLT E +    +WN S+G  +   D  C +  +G LV+  NVW N Q+   P  + FD+S +  W P F  +     L +VQP+ ++Y         + Q  +E  L+  IM+WR    T +       + + L  LE + G+ + E    +++ L+  Y++ GFP+++P+ +I  ++  + +TG+H      VEFALAVY+  YPN VLS+W+Y+ASLVR 
Sbjct:  626 DFDAIEQQVREKAAKIRRKPGEAILIPVLSASGNITDSELCPRVELARRQEVLRHSLFVKILCNGKKVSRTDGRPLGTDFRVHFGQIFNLKIMNCPQSINLQVFEDTGSSCSLLAQVFVPVPEPSVVTGSASLEDFEFSSDQRVMFDHEGVGS---DVPL-SFEADGSNKVL--LLTSGKLTCCVSWGIGDDDVPLAP----SASQHPGVRHSGLGHVDAVTSIGASGLYDMKRIGEW-AKQSRLDPNDPKNASIMQLL----KVAVSGEVT-APEYFRLEHLQEEFNFVTDEELDKSRRFRLLRLRNQGVKEFRNYKFIPALENEISDKVFQEYERRLKDGETVDTREHLDSHRALVAKYLQKIQESITNRLLLARHRFILSDLVVEDEIPSIGSKKPKLPAQLKTERLDSWENLEHPCQHVREKFRADMNHRLKILGINLFRLAEPKRPLKPQRKERKKVTAQNLSDGDVKLLVNIIRAYDIPVRRPQGENAGQSSQPAIHGSDWYLHQVQVRPFVEVSFQRTVLQTTTADGPNPSWNEELQLPFSAPNCDYSTSTLQSVKDDVFINIFDEMVHETGVNDKERGPSIHTQVEKHWLGSVRIPFSTIYSQSRIDGTFKVNTPAVLLGYSKERSHSANSGYDFSRSVSEGAFITLFITIEPQLVPGESIREKIKDLKFDSQEQERLLQAAEKFERKAAERHPDRPCITTVIDLNGKTVFVTRYIRPLNPPQEFLDAFPNNPQEATTLVARFVSLIPSLPDQVSFSGVCDLWTTCNQFFTLLAGDEEEHAVLLCNYFLSLGK---KAWLVIGTAIPEGPTAYVLTHEQS-RYLIWNPSSGQFYGQYDTFCPLQAVGCLVDADNVWFNIQEYASPMRMSFDVSKRKLWKPFFSGSFPHPGLSSVQPEELVYSHTDAAAAAELQDRIEKILKEKIMEWRPRHPTRWNRYCNTTLKQFLPKLEQSRGQDVAEGHRHELQRLLGEYRISGFPLHMPFSDIRPLIEAVHSTGVHNIQGSNVEFALAVYVHPYPNNVLSVWVYLASLVRT 1648          

HSP 2 Score: 120.939 bits (302), Expect = 8.280e-27
Identity = 97/278 (34.89%), Postives = 155/278 (55.76%), Query Frame = 2
Query: 1088 RNLEEEGLYVGRRPFINTTNERKLASRIQK-ENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDS---GDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEG--LDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQ 1903
            R +E+EGLYVG+RP ++ TNE  L +R+ K E  + WFG+DGRI  LPDP+KE   RP +++ +           DL P I +  ++   S    DP   +Q+ + V  L FSHH LFS EHVLA R+ QL+   QY+++Q+         ++  L++A+ ++  K+  + +  QS +  RI  Y  E+RNTR  R++E+   R L  ++IK WK+IK+ R     T T   + ++K+  D   D + +E +I  ++ E +   E +Y+K +  Y  Q
Sbjct:  305 RYIEDEGLYVGKRPSVSLTNETILENRLLKMEEGLKWFGDDGRILALPDPIKESSTRPPVFSME----------GDLHPAIQTVFWKAQKSKYAADPEGDYQLDVEVFGLIFSHHPLFSREHVLASRLCQLYQ--QYLTRQQNNLTRHLTDKLNGLRNALGNMM-KIHREESLTQS-LQQRISEYSLEVRNTRQLRDSEQEKDRTLLKALIKVWKEIKALREFQKFTNTPYKLLLRKENGDRASDQQEYEEEILAEVMELEAEKEEDYQKSLAEYRKQ 568          
BLAST of Coiled-coil and C2 domain containing 2A vs. Planmine SMEST
Match: SMESG000048372.1 (SMESG000048372.1)

HSP 1 Score: 3069.64 bits (7957), Expect = 0.000e+0
Identity = 1614/1623 (99.45%), Postives = 1617/1623 (99.63%), Query Frame = 2
Query:   95 MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKLQTREDTXXXXXXXXXXXXXXXAGSIVDDPTISXXXXXXXXXXXXXXXXXVDDKPLXXXXXXXXXXXXXXXXPSGTNETEEIKAVSSQMQSEELVSRPKHXXXXXXXXXXXXXXXXXXXVEMQESMKEDDYNMTKQSLPGQISTRFDVEAMNSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRNNK 4963
            MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKLQTREDTKSQLELEKKRLSSSLAGSIVDDPTISQEKRRQERRARRNKAENVDDKPLEKEKVKRKSRKKKTEEPSGTNETEEIKAVSSQMQSEELVSRPKHIDRAAIAAAIREKRKRDKEVEMQESMKEDDYNMTK+S PGQISTRFDVEAMNSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVESLEFSHHHLFSFEHVLAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADARLRQEEKERKEESIKSRKTRNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYL+HRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKF NLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDR    FDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN+K
Sbjct:    1 MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKLQTREDTKSQLELEKKRLSSSLAGSIVDDPTISQEKRRQERRARRNKAENVDDKPLEKEKVKRKSRKKKTEEPSGTNETEEIKAVSSQMQSEELVSRPKHIDRAAIAAAIREKRKRDKEVEMQESMKEDDYNMTKKSFPGQISTRFDVEAMNSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVESLEFSHHHLFSFEHVLAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADARLRQEEKERKEESIKSRKTRNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLVHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFKNLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDR----FDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRNSK 1619          
BLAST of Coiled-coil and C2 domain containing 2A vs. Planmine SMEST
Match: SMESG000048372.1 (SMESG000048372.1)

HSP 1 Score: 3058.86 bits (7929), Expect = 0.000e+0
Identity = 1614/1646 (98.06%), Postives = 1617/1646 (98.24%), Query Frame = 2
Query:   95 MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKLQTREDTXXXXXXXXXXXXXXXAGSIVDDPTISXXXXXXXXXXXXXXXXXVDDKPLXXXXXXXXXXXXXXXXPSGTNETEEIKAVSSQMQSEELVSRPKHXXXXXXXXXXXXXXXXXXXVEMQESMKEDDYNMTKQSLPGQISTRFDVEA-----------------------MNSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRNNK 4963
            MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKLQTREDTKSQLELEKKRLSSSLAGSIVDDPTISQEKRRQERRARRNKAENVDDKPLEKEKVKRKSRKKKTEEPSGTNETEEIKAVSSQMQSEELVSRPKHIDRAAIAAAIREKRKRDKEVEMQESMKEDDYNMTK+S PGQISTRFDVEA                       MNSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVESLEFSHHHLFSFEHVLAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADARLRQEEKERKEESIKSRKTRNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYL+HRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKF NLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDR    FDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN+K
Sbjct:    1 MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKLQTREDTKSQLELEKKRLSSSLAGSIVDDPTISQEKRRQERRARRNKAENVDDKPLEKEKVKRKSRKKKTEEPSGTNETEEIKAVSSQMQSEELVSRPKHIDRAAIAAAIREKRKRDKEVEMQESMKEDDYNMTKKSFPGQISTRFDVEAIQSDSSLSIEVIPTNEGVIHGKNMNSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVESLEFSHHHLFSFEHVLAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADARLRQEEKERKEESIKSRKTRNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLVHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFKNLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDR----FDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRNSK 1642          
BLAST of Coiled-coil and C2 domain containing 2A vs. Planmine SMEST
Match: SMESG000048372.1 (SMESG000048372.1)

HSP 1 Score: 3009.94 bits (7802), Expect = 0.000e+0
Identity = 1597/1646 (97.02%), Postives = 1601/1646 (97.27%), Query Frame = 2
Query:   95 MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKLQTREDTXXXXXXXXXXXXXXXAGSIVDDPTISXXXXXXXXXXXXXXXXXVDDKPLXXXXXXXXXXXXXXXXPSGTNETEEIKAVSSQMQSEELVSRPKHXXXXXXXXXXXXXXXXXXXVEMQESMKEDDYNMTKQSLPGQISTRFDVEA-----------------------MNSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVXXXXXXXXXXXXXXXXXAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADAXXXXXXXXXXXXXXXXXXXXNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRNNK 4963
            MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKLQTREDTKSQLELEKKRLSSSLAGSIVDDPTISQEKRRQERRARRNKAENVDDKPLEKEKVKRKSRKKKTEEPSGTNETEEIKAVSSQMQSEELVSRPKHIDRAAIAAAIREKRKRDKEVEMQESMKEDDYNMTK+S PGQISTRFDVEA                       MNSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVESLEFSHHHLFSFEHVLAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADARLRQEEKERKEESIKSRKTRNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYL+HRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKF NLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDR    FDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLR+                PRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRN+K
Sbjct:    1 MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKLQTREDTKSQLELEKKRLSSSLAGSIVDDPTISQEKRRQERRARRNKAENVDDKPLEKEKVKRKSRKKKTEEPSGTNETEEIKAVSSQMQSEELVSRPKHIDRAAIAAAIREKRKRDKEVEMQESMKEDDYNMTKKSFPGQISTRFDVEAIQSDSSLSIEVIPTNEGVIHGKNMNSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLPVEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKLPSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTTNERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPDGLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVESLEFSHHHLFSFEHVLAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQSEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITGMTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIYENQKQLYDKQSKLKADARLRQEEKERKEESIKSRKTRNKRNEEVEYFQEAEDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLKVGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSVTFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEEMETYSFKTNQYLVHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLFARTVWAVNSDGELMIPLSYLNSEKFKNLKHNRDPLLAMGLTRILDLQRRQEWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDEFAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYENRKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVREEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVIQRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKPPTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLEIPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIHPPQSLKDR----FDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRCQETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGISDIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGSTAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQQRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQLTLENQLRT----------------PRREMVEILKCLEINCGEMNESINEKVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVYIKSYPNTVLSIWIYVASLVRNSK 1626          
The following BLAST results are available for this feature:
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CC2D2A0.000e+031.50coiled-coil and C2 domain containing 2A [Source:HG... [more]
CC2D2A0.000e+031.50coiled-coil and C2 domain containing 2A [Source:HG... [more]
CC2D2A0.000e+031.33coiled-coil and C2 domain containing 2A [Source:HG... [more]
CC2D2A1.252e-13132.28coiled-coil and C2 domain containing 2A [Source:HG... [more]
CC2D2B7.376e-12229.77coiled-coil and C2 domain containing 2B [Source:HG... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mks-62.055e-3926.05MecKel-Gruber Syndrome (MKS) homolog [Source:UniP... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cc2d2a1.014e-3824.76gene:FBgn0263113 transcript:FBtr0307337[more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cc2d2a1.201e-15833.53coiled-coil and C2 domain containing 2A [Source:ZF... [more]
cc2d2a1.471e-15833.53coiled-coil and C2 domain containing 2A [Source:ZF... [more]
cep764.812e-921.20centrosomal protein 76 [Source:NCBI gene;Acc:56492... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhcr70.000e+031.007-dehydrocholesterol reductase [Source:Xenbase;Acc... [more]
dhcr70.000e+030.907-dehydrocholesterol reductase [Source:Xenbase;Acc... [more]
dhcr70.000e+030.857-dehydrocholesterol reductase [Source:Xenbase;Acc... [more]
dhcr70.000e+030.797-dehydrocholesterol reductase [Source:Xenbase;Acc... [more]
cep768.269e-1223.31centrosomal protein 76kDa [Source:NCBI gene;Acc:54... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cc2d2a0.000e+031.38coiled-coil and C2 domain containing 2A [Source:MG... [more]
Cc2d2a3.677e-17031.00coiled-coil and C2 domain containing 2A [Source:MG... [more]
Cc2d2b4.377e-13031.17coiled-coil and C2 domain containing 2B [Source:MG... [more]
Cc2d2b7.728e-5427.67coiled-coil and C2 domain containing 2B [Source:MG... [more]
Cep767.175e-1423.64centrosomal protein 76 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P2K1|C2D2A_HUMAN0.000e+031.50Coiled-coil and C2 domain-containing protein 2A OS... [more]
sp|Q8CFW7|C2D2A_MOUSE0.000e+031.38Coiled-coil and C2 domain-containing protein 2A OS... [more]
sp|Q6DHV5|C2D2B_HUMAN3.542e-12129.77Protein CC2D2B OS=Homo sapiens OX=9606 GN=CC2D2B P... [more]
sp|A1ZAV1|C2D2A_DROME1.017e-3724.76Coiled-coil and C2 domain-containing protein 2A OS... [more]
sp|Q0VEJ0|CEP76_MOUSE5.019e-1323.64Centrosomal protein of 76 kDa OS=Mus musculus OX=1... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MMQ10.000e+033.04coiled-coil and C2 domain-containing protein 2A-li... [more]
A0A2R2MMM00.000e+032.95coiled-coil and C2 domain-containing protein 2A-li... [more]
A0A1S3JEY90.000e+032.95coiled-coil and C2 domain-containing protein 2A-li... [more]
A0A210PQ360.000e+034.23Coiled-coil and C2 domain-containing protein 2A OS... [more]
X1Z7B60.000e+034.78Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cc2d2a0.000e+032.58coiled-coil and C2 domain containing 2A [Source:ZF... [more]
cep767.149e-1121.08centrosomal protein 76 [Source:NCBI gene;Acc:10304... [more]
cep767.361e-1121.08centrosomal protein 76 [Source:NCBI gene;Acc:10304... [more]
cep768.186e-1121.08centrosomal protein 76 [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cc2d2a1.313e-17930.01coiled-coil and C2 domain containing 2A [Source:ZF... [more]
cc2d2a1.743e-7136.68coiled-coil and C2 domain containing 2A [Source:ZF... [more]
cep769.157e-1222.87centrosomal protein 76 [Source:NCBI gene;Acc:56492... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO290323.891e-10431.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309229.238e-922.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO268227.609e-831.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000005880.20.000e+030.33coiled-coil and C2 domain-containing protein 2A-li... [more]
ENSORLT00000036721.10.000e+030.24coiled-coil and C2 domain-containing protein 2A-li... [more]
cc2d2a3.640e-15330.77coiled-coil and C2 domain containing 2A [Source:NC... [more]
cc2d2a5.315e-15330.74coiled-coil and C2 domain containing 2A [Source:NC... [more]
cc2d2a1.800e-14729.82coiled-coil and C2 domain containing 2A [Source:NC... [more]
back to top
BLAST of Coiled-coil and C2 domain containing 2A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000048372.10.000e+099.45SMESG000048372.1[more]
SMESG000048372.10.000e+098.06SMESG000048372.1[more]
SMESG000048372.10.000e+097.02SMESG000048372.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026237 ID=SMED30026237|Name=Coiled-coil and C2 domain containing 2A|organism=Schmidtea mediterranea sexual|type=transcript|length=4995bp
AATGAATTTGTTTTAAAACTCAAATACTAAGGACGCAGATTAATGTCAAT
TTTGAAATAAATTTTTATTGACAATCATTTTAAAATAAGCATTAATGGAC
ACAACAATAAAAAATGATGATTATTTAGATACATTATGCAATTCATCTGA
ATATCCATCCGATGCTGAAGCTGAAATCGTGAAAGCAGAATTTACCGAAA
AGCATCGTCGAACCAAGAAAAAATTGGATGAGAGATTAAAATTACAAACG
CGAGAAGACACAAAGTCACAATTGGAGTTAGAGAAAAAACGACTCAGCAG
TTCGCTTGCTGGTTCGATAGTTGATGACCCAACAATAAGTCAAGAAAAAA
GACGACAAGAACGACGAGCAAGACGAAACAAAGCTGAAAATGTTGATGAT
AAACCGTTAGAAAAGGAAAAAGTGAAAAGAAAATCTCGTAAAAAGAAAAC
TGAAGAACCATCAGGAACAAATGAGACTGAAGAGATTAAAGCAGTTTCAT
CTCAAATGCAATCAGAAGAACTCGTCAGTCGGCCTAAACATATCGATAGA
GCAGCAATTGCTGCTGCTATACGCGAAAAAAGAAAAAGAGATAAAGAAGT
AGAAATGCAAGAGAGCATGAAAGAAGATGATTATAACATGACTAAACAAT
CTTTGCCTGGACAGATTTCCACAAGATTCGACGTAGAGGCGATGAACAGT
ACTCGGTTTTCGCTTGCTCCAGAGCCTGATATTCCTTGGGAAACTCTCAA
AGAACAAGAAATGATTACCGAAAAGCAATCTTTTGATTTCTTTTGTAGGC
AATGGCCCGTTGCTCCGAAGCAAGAAAAACGAAAATCCCTTCCGGTTGAA
GGTGATATAGAAAACGCGGAACGACGAGAATCACAGGAATTGAAAGACAC
GTCAAAATTGATTGATAATTTCGAGCGAGACCCGAACTATACCATATTCA
AACATTCCACTTTTTTCCTTCAAACATTGCCAGCAACAAAATTACCATCT
TATGAAACTTTACTCATAGAAGAAGAATCTGGATTATTGTTTTATCCTGG
AGTTGTTGATATGTCATATTTCAATGATCGTCCTTTGAGAAATCTTGAAG
AAGAGGGACTTTACGTTGGCAGGAGACCATTTATAAATACAACAAATGAA
AGGAAACTAGCCTCAAGAATCCAGAAAGAAAATAAAATGGATTGGTTCGG
TGAAGATGGCAGAATAAAAATTCTTCCTGATCCGTTAAAAGAGATTCCAT
TCCGGCCTCTGATGTGGAACGAGCAATTCAATCCGATGCCAGATGGACTA
CAAACCGAGGATTTGAAACCAATTATCTCATCCACAACATACGAACACAT
CGACAGCGGTGATCCAAACAGTTCATTCCAGATGATCATTAATGTTGAAT
CACTGGAATTCTCACATCATCATCTGTTCTCATTTGAACATGTCCTAGCA
CAACGTATCAAGCAGCTATTCACCGCATACCAATACATCAGCAAGCAGGA
AGGATTGGACTTCTTTCAACAACGGATTCTGTCACTCAAGCATGCCATTC
AGCACTTGCAGGAGAAACTGTCCAATAAAAATGCAGCAGCTCAATCAGAA
ATATTGGCCCGAATAGATAACTATCGACAAGAAATAAGAAACACCCGAAA
CGCAAGAAACAACGAAGAGGGTTATCTTAGAAAATTGAAAACTTCAATTA
TTAAAACGTGGAAACAAATAAAAAGTGAAAGAAATATAACCGGAATGACA
TTGACAGACGTATCGGTGAAAATTAAAAAACAATTAGCGGATGCGGACGA
GGATTACCGACTGTGGGAAAGAGATATTTCTGATCAAATAGCGGAAGAAA
AAGAATATTTCGAAAATAACTATCGAAAAGAAATGAAAATTTATGAAAAC
CAGAAACAACTTTATGATAAACAAAGTAAATTAAAGGCTGACGCGAGATT
GCGACAGGAGGAAAAGGAACGGAAAGAAGAAAGTATTAAATCCAGAAAAA
CTCGAAATAAAAGAAATGAAGAAGTCGAATATTTTCAAGAAGCTGAGGAT
ATAAAAGTACTCGGTGAACCGGATATTGGAGAGCCAGTGATGCCTAAACC
ATTTGATGAAGAATCGCTTTCCAGAGAAATCAGAAGTCAATTCGAGTTGT
GTAGAAGGTTACCCGGGGAACCGTTTATTCATCCCGTTCTGAAGGTTGGA
TCGATTTCCAATGAAAATCTCACGAAGGAAGAACTCAACCGACGGAACAT
GATGCAAAAGTACCAGTACTATATCGAATTGTTCTTTAATAATAAGAAAG
TCGTCGTTACAAGCAATAAGGAACTCAATCACGATTTCTCCGTGACATTC
AAAGAAAAAATTCCAGTCATCATTTCCCAGTATCCAGAGGTGATAATTCT
GAAGCTCTATGAGAGTTCAGGATTCACATCGAAATTTCTATCTAGTGCCG
AAATGGATGTTCCTCTTCCGTTTAAATTATCCGAAAACGAGGAAATGGAA
ACTTACAGTTTTAAGACAAACCAATATCTTTTGCATAGAAATTGTGGAGT
TGGCTCTGGTGAAAAATCATTTCCATTAGAAAGTCTCGATGGGACCCCTA
GTGGAGAAATTATTTCACCATTGTTCACAAGTGGCCTGTTATTTGCTCGA
ACTGTATGGGCTGTCAATTCTGATGGGGAATTAATGATTCCTTTAAGTTA
TTTAAATTCAGAAAAATTCATAAACCTCAAACATAATCGAGATCCTTTAT
TGGCGATGGGACTGACAAGAATATTAGATTTGCAGAGACGCCAGGAATGG
CAGAGCATAGAGTCACACCTTGATCCGAATGATCCACGGGACGCTAAAGT
CATTACAGCTCTTCACACAAACGAAGAACTTGGAATTGATTCTGAAACAA
AACTTTCCAGTGATTTTTTCAGGTTAAATCCCTACATGGATGAATTTGCT
TTCTCCACTGAAGATGATATTGACCGTTCTTTGAGATTTCGTATGATTCG
TTTACGGAATAATAATGTTCCTGAGTTTTTGACGTTGCCTATCCCATTAT
ATGACGACAAAGTTCCTTTAGAGTTGATAAAGGATTATGAGAATAGGAAA
GGAGTTAATAAAAACAAAATAATTGTCACTGGATTTGAAGCTCGTAAATT
GATACATCAGGAATTCATAGAGAAAGTCAGAGATGAAGTTTTATCGAAAT
TCAGAACTAGTTTGATGAAAAAATCCCTTGTAGAAATGGTTAGGGAAGAA
GAGATTCCAACAATCAATGATATATTTCCAAAGTTATTCAACGTCAACCG
ATTCAGTCGACCTCTTCAAAGGTTGCCTGAACCAAGGAAACCGATTTCTG
TTCACAATATCTATGAAATGAATGTCGAAATCGTCGTAGTGATTCAGCGC
GCTACAAATCTACCAGTTGATGTGGAAAGGAGGACCTTGACTCCTTTTGT
TCAAGTCAATTTCCAAAATATAAATCGCACTACTGATGTTTTGGAAGGAA
TTAATCCAGCGTGGGATATCGAATTGAGATTGCCATTTAAACCTCCAACT
ACTGTGACGAGCCTGGATACAATTAGAGATACGTTATTGATCAATGTATA
TGATCAGCAAGTTATTAATTTGAACAGTGACATCAATTCAAAGTTCCATA
CATTACATGAACGCTACGAAAGGCATTGGTTGGGAAGTCTGGAAATACCG
TTCAATACAATCTACCTCAATTCCAAAATCGAAGGAAATTTCCGATTGAA
ACAACCGGCATTTGTGCAAGGCTACGAAAGTGATGAATACATGGAAAGTT
TTCCAATGATGTCGGTTTTCATCACTTTAGATCCTGAAATCCACCCACCG
CAATCATTAAAAGACCGAAACATTACAAAGTTTGATAGTGTTGAAGACAG
AGATCTCATCACTCACGTTGATAGATGGCAAAACGAAATGAATATGAGAT
TTCCGAAAAGGTTTAGACGAGTAACAGTTGTAAATATGCGCTGTCAAGAA
ACCTTGATCACTCGTTACATATCTACTTTAAAGCCGCCAGAAGAACTGTT
AGCTGTGGACGAAAATATGAAGCAAAAGGTTATCGCCAGATTTGTTTCGT
TGATATCTTTCATGGCAGATGCTATTGTATTTCCTGGCATTTCGGATATT
TGGAGCACATGTGATCAATTCCTCAAAATGCTAATTGGTGACGAGGACGA
ACACGCTGTGCTCCTTTGCAATTATTTTAATTATTTGTATCAGGACCCGA
ATAAAGTTTTCCTATGTCTTGGCGAAGCCATTCCAGAAGGATCAACTGCT
TATGTATTGACTAAAGAAATGAATGGTGACGTTTGGCTATGGAATGCTTC
GACGGGTATGAAATTCAAAAGTAATGATCCGACTTGCTCAATGTTCAAAA
TCGGGCTATTAGTTAACGAGAGAAATGTCTGGGCTAATACTCAACAAAGA
GTTCAACCATGGGAACTCCGATTTGACTTGTCGATAAAAGCAGATTGGTT
CCCTTTGTTCAAAAGTAACATAAATTTGCAAACTGTCCAACCAGATGCGA
TTATCTATGAGGAACCGTTTTTGAAAGAAGTTCAAGATTTTCAGTTGACT
TTGGAAAATCAACTGAGAAGTAATATTATGGATTGGAGATTTGGATTGAC
GACGAACTTCATCATAGCGCCTCGGCGAGAAATGGTGGAGATCTTGAAAT
GTTTGGAAATAAACTGTGGCGAAATGAATGAAAGCATTAATGAAAAAGTG
AAAGATTTAATGACTGGATACAAGGTATTCGGATTCCCCATCAATTTGCC
TTATATGGAGATTCCTGATGTGTTATCGCGCATCGAGGCGACAGGAATCC
ATTTAACTGCTGACCCAAGAGTCGAATTTGCATTAGCAGTCTACATAAAA
TCCTATCCGAATACCGTATTATCCATATGGATATATGTAGCGTCTCTAGT
AAGGAATAACAAATAGCTCCATCGTCCCGACCCCAATATAACCGA
back to top

protein sequence of SMED30026237-orf-1

>SMED30026237-orf-1 ID=SMED30026237-orf-1|Name=SMED30026237-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1624bp
MDTTIKNDDYLDTLCNSSEYPSDAEAEIVKAEFTEKHRRTKKKLDERLKL
QTREDTKSQLELEKKRLSSSLAGSIVDDPTISQEKRRQERRARRNKAENV
DDKPLEKEKVKRKSRKKKTEEPSGTNETEEIKAVSSQMQSEELVSRPKHI
DRAAIAAAIREKRKRDKEVEMQESMKEDDYNMTKQSLPGQISTRFDVEAM
NSTRFSLAPEPDIPWETLKEQEMITEKQSFDFFCRQWPVAPKQEKRKSLP
VEGDIENAERRESQELKDTSKLIDNFERDPNYTIFKHSTFFLQTLPATKL
PSYETLLIEEESGLLFYPGVVDMSYFNDRPLRNLEEEGLYVGRRPFINTT
NERKLASRIQKENKMDWFGEDGRIKILPDPLKEIPFRPLMWNEQFNPMPD
GLQTEDLKPIISSTTYEHIDSGDPNSSFQMIINVESLEFSHHHLFSFEHV
LAQRIKQLFTAYQYISKQEGLDFFQQRILSLKHAIQHLQEKLSNKNAAAQ
SEILARIDNYRQEIRNTRNARNNEEGYLRKLKTSIIKTWKQIKSERNITG
MTLTDVSVKIKKQLADADEDYRLWERDISDQIAEEKEYFENNYRKEMKIY
ENQKQLYDKQSKLKADARLRQEEKERKEESIKSRKTRNKRNEEVEYFQEA
EDIKVLGEPDIGEPVMPKPFDEESLSREIRSQFELCRRLPGEPFIHPVLK
VGSISNENLTKEELNRRNMMQKYQYYIELFFNNKKVVVTSNKELNHDFSV
TFKEKIPVIISQYPEVIILKLYESSGFTSKFLSSAEMDVPLPFKLSENEE
METYSFKTNQYLLHRNCGVGSGEKSFPLESLDGTPSGEIISPLFTSGLLF
ARTVWAVNSDGELMIPLSYLNSEKFINLKHNRDPLLAMGLTRILDLQRRQ
EWQSIESHLDPNDPRDAKVITALHTNEELGIDSETKLSSDFFRLNPYMDE
FAFSTEDDIDRSLRFRMIRLRNNNVPEFLTLPIPLYDDKVPLELIKDYEN
RKGVNKNKIIVTGFEARKLIHQEFIEKVRDEVLSKFRTSLMKKSLVEMVR
EEEIPTINDIFPKLFNVNRFSRPLQRLPEPRKPISVHNIYEMNVEIVVVI
QRATNLPVDVERRTLTPFVQVNFQNINRTTDVLEGINPAWDIELRLPFKP
PTTVTSLDTIRDTLLINVYDQQVINLNSDINSKFHTLHERYERHWLGSLE
IPFNTIYLNSKIEGNFRLKQPAFVQGYESDEYMESFPMMSVFITLDPEIH
PPQSLKDRNITKFDSVEDRDLITHVDRWQNEMNMRFPKRFRRVTVVNMRC
QETLITRYISTLKPPEELLAVDENMKQKVIARFVSLISFMADAIVFPGIS
DIWSTCDQFLKMLIGDEDEHAVLLCNYFNYLYQDPNKVFLCLGEAIPEGS
TAYVLTKEMNGDVWLWNASTGMKFKSNDPTCSMFKIGLLVNERNVWANTQ
QRVQPWELRFDLSIKADWFPLFKSNINLQTVQPDAIIYEEPFLKEVQDFQ
LTLENQLRSNIMDWRFGLTTNFIIAPRREMVEILKCLEINCGEMNESINE
KVKDLMTGYKVFGFPINLPYMEIPDVLSRIEATGIHLTADPRVEFALAVY
IKSYPNTVLSIWIYVASLVRNNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0032391photoreceptor connecting cilium
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0035869ciliary transition zone
GO:0036038MKS complex
GO:0042995cell projection
Vocabulary: biological process
TermDefinition
GO:0035845photoreceptor cell outer segment organization
GO:0001843neural tube closure
GO:0007224smoothened signaling pathway
GO:0007368determination of left/right symmetry
GO:0007507heart development
GO:0030030cell projection organization
GO:0035082axoneme assembly
GO:0043010camera-type eye development
GO:0044458motile cilium assembly
GO:0060271cilium morphogenesis
GO:1904491protein localization to ciliary transition zone
GO:1905515non-motile cilium assembly
GO:1990403embryonic brain development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR041510DUF5523
IPR035892C2_domain_sf
IPR000008C2_dom
IPR028928CC2D2AN-C2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 500..520
NoneNo IPR availableCOILSCoilCoilcoord: 590..610
NoneNo IPR availableCOILSCoilCoilcoord: 619..639
NoneNo IPR availableCOILSCoilCoilcoord: 471..491
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 36..64
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 619..639
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 80..127
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 128..143
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 36..149
NoneNo IPR availablePANTHERPTHR20837CENTROSOMAL PROTEIN-RELATEDcoord: 70..1620
NoneNo IPR availableCDDcd00030C2coord: 1096..1180
e-value: 0.00272626
score: 37.0463
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 1095..1213
IPR041510Domain of unknown function (DUF5523)PFAMPF17661DUF5523coord: 161..395
e-value: 5.2E-19
score: 68.9
IPR028928CC2D2A, N-terminal, C2 domainPFAMPF15625CC2D2AN-C2coord: 690..866
e-value: 2.5E-31
score: 108.8
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 1092..1224
e-value: 4.8E-7
score: 31.7
IPR000008C2 domainPFAMPF00168C2coord: 1096..1217
e-value: 1.1E-4
score: 22.4
IPR000008C2 domainPROSITEPS50004C2coord: 1079..1200
score: 10.767