SMED30026227

Overview
NameSMED30026227
Smed IDSMED30026227
Length (bp)1866
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30026227 (SMED30026227) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30026227 (SMED30026227) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30026227 (SMED30026227) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30026227 (SMED30026227) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026227

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026227SMESG000055174.1 SmedASXL_011686SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30026227SMESG000055174.1 SMESG000055172.1 dd_Smed_v4_10518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026227SMESG000055174.1 SMESG000055172.1 dd_Smed_v4_10518_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026227SMESG000055174.1 SMESG000055172.1 dd_Smed_v6_10518_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30026227SMESG000055172.1 SMESG000055174.1 SMED30026227smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026227SMESG000055174.1 OX_Smed_1.0.20392ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30026227 vs. Ensembl Human
Match: GUK1 (guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:4693])

HSP 1 Score: 172.17 bits (435), Expect = 1.721e-49
Identity = 81/186 (43.55%), Postives = 136/186 (73.12%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST+++RL++E   +F FS+S+TTR+PR GE++G DY+F+T+E  QR +   +FIE A +SGN YGT K A++ V   N++C+LD+D QGV  IK  +L  IY+ ++PP+   LE+RLR+++ E+E+ +++RLA A  +M+     G+FD+++ ND+L+++  ELK+ +  E++
Sbjct:    5 RPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIK 190          
BLAST of SMED30026227 vs. Ensembl Human
Match: GUK1 (guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:4693])

HSP 1 Score: 172.17 bits (435), Expect = 1.721e-49
Identity = 81/186 (43.55%), Postives = 136/186 (73.12%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST+++RL++E   +F FS+S+TTR+PR GE++G DY+F+T+E  QR +   +FIE A +SGN YGT K A++ V   N++C+LD+D QGV  IK  +L  IY+ ++PP+   LE+RLR+++ E+E+ +++RLA A  +M+     G+FD+++ ND+L+++  ELK+ +  E++
Sbjct:    5 RPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIK 190          
BLAST of SMED30026227 vs. Ensembl Human
Match: GUK1 (guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:4693])

HSP 1 Score: 172.17 bits (435), Expect = 1.721e-49
Identity = 81/186 (43.55%), Postives = 136/186 (73.12%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST+++RL++E   +F FS+S+TTR+PR GE++G DY+F+T+E  QR +   +FIE A +SGN YGT K A++ V   N++C+LD+D QGV  IK  +L  IY+ ++PP+   LE+RLR+++ E+E+ +++RLA A  +M+     G+FD+++ ND+L+++  ELK+ +  E++
Sbjct:    5 RPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIK 190          
BLAST of SMED30026227 vs. Ensembl Human
Match: GUK1 (guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:4693])

HSP 1 Score: 172.17 bits (435), Expect = 1.721e-49
Identity = 81/186 (43.55%), Postives = 136/186 (73.12%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST+++RL++E   +F FS+S+TTR+PR GE++G DY+F+T+E  QR +   +FIE A +SGN YGT K A++ V   N++C+LD+D QGV  IK  +L  IY+ ++PP+   LE+RLR+++ E+E+ +++RLA A  +M+     G+FD+++ ND+L+++  ELK+ +  E++
Sbjct:    5 RPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIK 190          
BLAST of SMED30026227 vs. Ensembl Human
Match: GUK1 (guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:4693])

HSP 1 Score: 172.17 bits (435), Expect = 1.721e-49
Identity = 81/186 (43.55%), Postives = 136/186 (73.12%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST+++RL++E   +F FS+S+TTR+PR GE++G DY+F+T+E  QR +   +FIE A +SGN YGT K A++ V   N++C+LD+D QGV  IK  +L  IY+ ++PP+   LE+RLR+++ E+E+ +++RLA A  +M+     G+FD+++ ND+L+++  ELK+ +  E++
Sbjct:    5 RPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIK 190          
BLAST of SMED30026227 vs. Ensembl Celegans
Match: guk-1 (GUanylate Kinase [Source:UniProtKB/TrEMBL;Acc:A5HU98])

HSP 1 Score: 160.614 bits (405), Expect = 1.493e-45
Identity = 86/191 (45.03%), Postives = 127/191 (66.49%), Query Frame = -1
Query: 1069 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEM-QFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLK 1638
            + +V+ GPSG GKSTI+ R M+E PN F FS+S+TTR PR GE+ G  Y+F  KE  Q  +K NEF+EFA +SGN YGT K  + E+    K+C+LDI+ QGV  IKN++LDA Y+ IR P+ + LE+RLR +  E+E+ + +RL  A +++ +      +FD ++ ND+LE++ KE  D +  ++E   K
Sbjct:   14 RPIVLSGPSGGGKSTILTRAMQEYPNSFAFSVSHTTRQPRAGEEHGKHYYFTEKEKMQEMIKNNEFLEFATFSGNTYGTSKKTVLEIENSGKICVLDIELQGVRNIKNSHLDARYILIRAPSIKLLEERLRARGTETEESLSKRLQHASEDLVEIEKNPTLFDKVIVNDDLERAYKEFVDLLRDDLEKTSK 204          
BLAST of SMED30026227 vs. Ensembl Celegans
Match: guk-1 (GUanylate Kinase [Source:UniProtKB/TrEMBL;Acc:A5HU98])

HSP 1 Score: 160.999 bits (406), Expect = 1.587e-45
Identity = 86/191 (45.03%), Postives = 127/191 (66.49%), Query Frame = -1
Query: 1069 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEM-QFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLK 1638
            + +V+ GPSG GKSTI+ R M+E PN F FS+S+TTR PR GE+ G  Y+F  KE  Q  +K NEF+EFA +SGN YGT K  + E+    K+C+LDI+ QGV  IKN++LDA Y+ IR P+ + LE+RLR +  E+E+ + +RL  A +++ +      +FD ++ ND+LE++ KE  D +  ++E   K
Sbjct:   25 RPIVLSGPSGGGKSTILTRAMQEYPNSFAFSVSHTTRQPRAGEEHGKHYYFTEKEKMQEMIKNNEFLEFATFSGNTYGTSKKTVLEIENSGKICVLDIELQGVRNIKNSHLDARYILIRAPSIKLLEERLRARGTETEESLSKRLQHASEDLVEIEKNPTLFDKVIVNDDLERAYKEFVDLLRDDLEKTSK 215          
BLAST of SMED30026227 vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12406131:-1 gene:WBGene00002991.1 transcript:F17E5.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 102.064 bits (253), Expect = 2.235e-22
Identity = 54/187 (28.88%), Postives = 94/187 (50.27%), Query Frame = -1
Query: 1096 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFI 1656
            +++  RK LV+ G  G G+  I   L+   PN F + I +TTR PR  E DG  Y+F+T E     ++ NE++E+  +  + YGT  + I+ + K  K+ ILD++ Q +  ++ A      VFI  PN + ++       K   +  + R A  H          +FD I+TN +++ +  +L+  +
Sbjct:  428 LSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNLQGMQDPDGSLEKLLNESDVLRQAFGH----------LFDFIITNSDIDDTIAQLERLV 604          
BLAST of SMED30026227 vs. Ensembl Celegans
Match: lin-2 (pep chromosome:WBcel235:X:12399517:12414037:-1 gene:WBGene00002991.1 transcript:F17E5.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-2)

HSP 1 Score: 102.449 bits (254), Expect = 2.740e-22
Identity = 54/187 (28.88%), Postives = 94/187 (50.27%), Query Frame = -1
Query: 1096 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFI 1656
            +++  RK LV+ G  G G+  I   L+   PN F + I +TTR PR  E DG  Y+F+T E     ++ NE++E+  +  + YGT  + I+ + K  K+ ILD++ Q +  ++ A      VFI  PN + ++       K   +  + R A  H          +FD I+TN +++ +  +L+  +
Sbjct:  769 LSQYRRKTLVLLGAHGVGRRHIKNTLIHRHPNRFAYPIPHTTRPPRKDEVDGKHYYFVTNEQMMADIQNNEYLEYGTHEESMYGTKLETIRNIHKSGKIAILDVEPQALKVLRTAEYSPFVVFIAAPNLQGMQDPDGSLEKLLNESDVLRQAFGH----------LFDFIITNSDIDDTIAQLERLV 945          
BLAST of SMED30026227 vs. Ensembl Celegans
Match: magu-2 (MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1DQX2])

HSP 1 Score: 97.0561 bits (240), Expect = 9.472e-21
Identity = 53/188 (28.19%), Postives = 103/188 (54.79%), Query Frame = -1
Query: 1093 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXX-XXEDRILQRLAVAHQ--EMQFGYRDGMFDLILTNDNLEKSTKELKDFIM 1647
            T R+ +V+CG  G G   +  RL++         + YT+R+P++GE +G+ YHF++K+ F    K  +F+EF  Y   +YGT K  +  V+++ K C++ + ++ +  I++ ++    +FI  P+   L ++   +     +D  L+ +    +  E ++G+   +FD I+ N + EKS +ELK  +M
Sbjct:  468 THRRPIVLCGAEGVGCLKLRDRLLESDRITLACPVPYTSRTPKEGEFNGVHYHFVSKQKFHEDAKSGKFVEFGEYQKFWYGTAKKDVVNVIERGKTCVMTLKAESLGAIRSPDIQPYIIFIAAPSLYILRRQREVEGTFGVKDDELKAILTQSKSIEQKYGH---LFDGIIVNIDFEKSFRELKQILM 652          
BLAST of SMED30026227 vs. Ensembl Fly
Match: CG11811 (gene:FBgn0036099 transcript:FBtr0076265)

HSP 1 Score: 161.77 bits (408), Expect = 1.540e-45
Identity = 79/191 (41.36%), Postives = 131/191 (68.59%), Query Frame = -1
Query: 1084 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEV 1656
            MT    + LV+CGPSGSGKST+++RL  E P+ F FSIS+TTR PR+GE+ G+ Y+F+ +   +  +  +EFIE A ++GN YGT K A++E+  + ++CILDI+ +GV +IK  +L+ I +F  PP+ + LE+RLR++  E+E+ + +RL  A  E+ +G   G F  I+ N +++ + +E ++F++ E+
Sbjct:   30 MTAPGPRPLVLCGPSGSGKSTLLKRLFAEFPSTFGFSISHTTRKPREGEEHGVHYYFVERPEMEAAIAGDEFIETAEFTGNLYGTSKAAVREIQAQGRVCILDIEQKGVEQIKRTDLNPILIFNNPPSIKELERRLRKRGSETEESLSKRLNAAQVELDYGLTPGNFHKIINNVDIDVAYEEFRNFVVQEL 220          
BLAST of SMED30026227 vs. Ensembl Fly
Match: sdt (gene:FBgn0261873 transcript:FBtr0089974)

HSP 1 Score: 100.138 bits (248), Expect = 2.181e-21
Identity = 50/182 (27.47%), Postives = 106/182 (58.24%), Query Frame = -1
Query: 1108 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQ--FGYRDGMFDLILTNDNLEKSTKEL 1647
            T ++ +V+ GP   G+  + +RLM +    F  ++ +T+R+ R+GE  G+DYHFIT++AF+  +    F+E   Y   +YGT  +AI+ V+   K+C+L++  Q +  ++ ++L    V + PP+ + L ++     +  ++  L+ +    ++M+  +G+   +FD+I+ N++ E++  +L
Sbjct: 1164 THKRPIVLIGPPNIGRHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDMEARWGH---LFDMIIINNDTERAYHQL 1341          
BLAST of SMED30026227 vs. Ensembl Fly
Match: sdt (gene:FBgn0261873 transcript:FBtr0340141)

HSP 1 Score: 100.138 bits (248), Expect = 2.311e-21
Identity = 50/182 (27.47%), Postives = 106/182 (58.24%), Query Frame = -1
Query: 1108 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQ--FGYRDGMFDLILTNDNLEKSTKEL 1647
            T ++ +V+ GP   G+  + +RLM +    F  ++ +T+R+ R+GE  G+DYHFIT++AF+  +    F+E   Y   +YGT  +AI+ V+   K+C+L++  Q +  ++ ++L    V + PP+ + L ++     +  ++  L+ +    ++M+  +G+   +FD+I+ N++ E++  +L
Sbjct: 1403 THKRPIVLIGPPNIGRHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDMEARWGH---LFDMIIINNDTERAYHQL 1580          
BLAST of SMED30026227 vs. Ensembl Fly
Match: sdt (gene:FBgn0261873 transcript:FBtr0333720)

HSP 1 Score: 100.138 bits (248), Expect = 2.427e-21
Identity = 50/182 (27.47%), Postives = 106/182 (58.24%), Query Frame = -1
Query: 1108 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQ--FGYRDGMFDLILTNDNLEKSTKEL 1647
            T ++ +V+ GP   G+  + +RLM +    F  ++ +T+R+ R+GE  G+DYHFIT++AF+  +    F+E   Y   +YGT  +AI+ V+   K+C+L++  Q +  ++ ++L    V + PP+ + L ++     +  ++  L+ +    ++M+  +G+   +FD+I+ N++ E++  +L
Sbjct: 1698 THKRPIVLIGPPNIGRHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDMEARWGH---LFDMIIINNDTERAYHQL 1875          
BLAST of SMED30026227 vs. Ensembl Fly
Match: sdt (gene:FBgn0261873 transcript:FBtr0100376)

HSP 1 Score: 100.138 bits (248), Expect = 2.464e-21
Identity = 50/182 (27.47%), Postives = 106/182 (58.24%), Query Frame = -1
Query: 1108 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQ--FGYRDGMFDLILTNDNLEKSTKEL 1647
            T ++ +V+ GP   G+  + +RLM +    F  ++ +T+R+ R+GE  G+DYHFIT++AF+  +    F+E   Y   +YGT  +AI+ V+   K+C+L++  Q +  ++ ++L    V + PP+ + L ++     +  ++  L+ +    ++M+  +G+   +FD+I+ N++ E++  +L
Sbjct: 1817 THKRPIVLIGPPNIGRHELRQRLMAD-SERFSAAVPHTSRARREGEVPGVDYHFITRQAFEADILARRFVEHGEYEKAYYGTSLEAIRTVVASGKICVLNLHPQSLKLLRASDLKPYVVLVAPPSLDKLRQKKLRNGEPFKEEELKDIIATARDMEARWGH---LFDMIIINNDTERAYHQL 1994          
BLAST of SMED30026227 vs. Ensembl Zebrafish
Match: guk1b (guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-020916-1])

HSP 1 Score: 189.504 bits (480), Expect = 3.494e-56
Identity = 95/191 (49.74%), Postives = 141/191 (73.82%), Query Frame = -1
Query: 1075 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETV 1647
            +  + +V+ GPSG+GKST+++RLMKE   VF FS+S+TTR+PR GE+DG DYHF+TKE  Q G+ K+EFIE A +SGN YGT K +I++V  +N +CILD+D QGV  IK  +L+ IY+ I+PP+ E LEKRLR++  E+ED + +RL  A  +M+     G+FD+++ ND+LE++ ++LK  ++ E+E V
Sbjct:    2 SGPRPVVLSGPSGAGKSTLLKRLMKEYEGVFGFSVSHTTRNPRPGEEDGKDYHFVTKEKMQEGIDKDEFIENAEFSGNMYGTSKSSIEDVQAQNLICILDVDIQGVKNIKKTDLNPIYISIQPPSMEILEKRLRDRQTETEDSLQKRLEAARIDMELSKEPGVFDIVIVNDDLEEAYEKLKSVLIEEIEKV 192          
BLAST of SMED30026227 vs. Ensembl Zebrafish
Match: guk1b (guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-020916-1])

HSP 1 Score: 175.637 bits (444), Expect = 1.293e-50
Identity = 95/217 (43.78%), Postives = 141/217 (64.98%), Query Frame = -1
Query: 1075 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGI--------------------------DYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETV 1647
            +  + +V+ GPSG+GKST+++RLMKE   VF FS+S+TTR+PR GE+DG                           DYHF+TKE  Q G+ K+EFIE A +SGN YGT K +I++V  +N +CILD+D QGV  IK  +L+ IY+ I+PP+ E LEKRLR++  E+ED + +RL  A  +M+     G+FD+++ ND+LE++ ++LK  ++ E+E V
Sbjct:    2 SGPRPVVLSGPSGAGKSTLLKRLMKEYEGVFGFSVSHTTRNPRPGEEDGKGLNCLPMLLGATLLPVADVLSSVTSEDYHFVTKEKMQEGIDKDEFIENAEFSGNMYGTSKSSIEDVQAQNLICILDVDIQGVKNIKKTDLNPIYISIQPPSMEILEKRLRDRQTETEDSLQKRLEAARIDMELSKEPGVFDIVIVNDDLEEAYEKLKSVLIEEIEKV 218          
BLAST of SMED30026227 vs. Ensembl Zebrafish
Match: guk1a (guanylate kinase 1a [Source:ZFIN;Acc:ZDB-GENE-040625-130])

HSP 1 Score: 160.999 bits (406), Expect = 1.397e-45
Identity = 87/186 (46.77%), Postives = 134/186 (72.04%), Query Frame = -1
Query: 1075 LVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETV 1632
            +V+ GPSG+GKST++++L+KE   VF FS+S+TTR+PR GE++G DYHF+++E  Q  + K EFIE A +SGN YGT K A++ V  +N +CILDID QGV  IK  +L+ IYV ++ P+ + LEKRLR++  ESE+ + +RL  A  +++     G+FD+++ ND+LE +  +LKD ++ E++ V
Sbjct:    7 VVMSGPSGAGKSTLLKKLLKEFNGVFGFSVSHTTRNPRPGEENGKDYHFVSREVMQTSIAKGEFIESAEFSGNMYGTSKAAVQAVQAQNLICILDIDMQGVKNIKKTDLNPIYVSVQAPSMDILEKRLRDRKTESEESLQKRLHAAKVDVEISKEPGLFDVVIINDDLEAAYGKLKDVLLEEIQKV 192          
BLAST of SMED30026227 vs. Ensembl Zebrafish
Match: guk1a (guanylate kinase 1a [Source:ZFIN;Acc:ZDB-GENE-040625-130])

HSP 1 Score: 160.999 bits (406), Expect = 1.397e-45
Identity = 87/186 (46.77%), Postives = 134/186 (72.04%), Query Frame = -1
Query: 1075 LVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETV 1632
            +V+ GPSG+GKST++++L+KE   VF FS+S+TTR+PR GE++G DYHF+++E  Q  + K EFIE A +SGN YGT K A++ V  +N +CILDID QGV  IK  +L+ IYV ++ P+ + LEKRLR++  ESE+ + +RL  A  +++     G+FD+++ ND+LE +  +LKD ++ E++ V
Sbjct:    7 VVMSGPSGAGKSTLLKKLLKEFNGVFGFSVSHTTRNPRPGEENGKDYHFVSREVMQTSIAKGEFIESAEFSGNMYGTSKAAVQAVQAQNLICILDIDMQGVKNIKKTDLNPIYVSVQAPSMDILEKRLRDRKTESEESLQKRLHAAKVDVEISKEPGLFDVVIINDDLEAAYGKLKDVLLEEIQKV 192          
BLAST of SMED30026227 vs. Ensembl Zebrafish
Match: guk1a (guanylate kinase 1a [Source:ZFIN;Acc:ZDB-GENE-040625-130])

HSP 1 Score: 161.384 bits (407), Expect = 1.774e-45
Identity = 87/186 (46.77%), Postives = 134/186 (72.04%), Query Frame = -1
Query: 1075 LVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETV 1632
            +V+ GPSG+GKST++++L+KE   VF FS+S+TTR+PR GE++G DYHF+++E  Q  + K EFIE A +SGN YGT K A++ V  +N +CILDID QGV  IK  +L+ IYV ++ P+ + LEKRLR++  ESE+ + +RL  A  +++     G+FD+++ ND+LE +  +LKD ++ E++ V
Sbjct:   16 VVMSGPSGAGKSTLLKKLLKEFNGVFGFSVSHTTRNPRPGEENGKDYHFVSREVMQTSIAKGEFIESAEFSGNMYGTSKAAVQAVQAQNLICILDIDMQGVKNIKKTDLNPIYVSVQAPSMDILEKRLRDRKTESEESLQKRLHAAKVDVEISKEPGLFDVVIINDDLEAAYGKLKDVLLEEIQKV 201          
BLAST of SMED30026227 vs. Ensembl Xenopus
Match: efcab7 (EF-hand calcium binding domain 7 [Source:Xenbase;Acc:XB-GENE-5749161])

HSP 1 Score: 168.318 bits (425), Expect = 7.725e-48
Identity = 85/186 (45.70%), Postives = 131/186 (70.43%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST+++RLM E   +F FS+S+TTR PR GE DG DYHF++ +  ++G+++ EFIE A++SGN YGT   A++ V  +N++CILDID QGV  IK  +L+ IY+ I PP+   LEKRLR+++ ESE+ + +RL  A  +++     G+FD I+ ND+LE++   LK  +  E++
Sbjct:   20 RPVVLSGPSGAGKSTLLKRLMNEYEGLFGFSVSHTTRKPRPGEADGKDYHFVSLDDMKKGIERGEFIEHAVFSGNMYGTSTAAVQAVQARNQICILDIDMQGVKSIKKTSLNPIYISIHPPSVPILEKRLRDRNTESEESLQKRLNAAIADLEISKEPGLFDAIIVNDDLEEAYAHLKGTLAQEIK 205          
BLAST of SMED30026227 vs. Ensembl Xenopus
Match: efcab7 (EF-hand calcium binding domain 7 [Source:Xenbase;Acc:XB-GENE-5749161])

HSP 1 Score: 167.933 bits (424), Expect = 1.042e-47
Identity = 85/186 (45.70%), Postives = 131/186 (70.43%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST+++RLM E   +F FS+S+TTR PR GE DG DYHF++ +  ++G+++ EFIE A++SGN YGT   A++ V  +N++CILDID QGV  IK  +L+ IY+ I PP+   LEKRLR+++ ESE+ + +RL  A  +++     G+FD I+ ND+LE++   LK  +  E++
Sbjct:   18 RPVVLSGPSGAGKSTLLKRLMNEYEGLFGFSVSHTTRKPRPGEADGKDYHFVSLDDMKKGIERGEFIEHAVFSGNMYGTSTAAVQAVQARNQICILDIDMQGVKSIKKTSLNPIYISIHPPSVPILEKRLRDRNTESEESLQKRLNAAIADLEISKEPGLFDAIIVNDDLEEAYAHLKGTLAQEIK 203          
BLAST of SMED30026227 vs. Ensembl Xenopus
Match: efcab7 (EF-hand calcium binding domain 7 [Source:Xenbase;Acc:XB-GENE-5749161])

HSP 1 Score: 144.436 bits (363), Expect = 6.615e-39
Identity = 62/122 (50.82%), Postives = 91/122 (74.59%), Query Frame = -1
Query: 1273 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPN 1638
            + +V+ GPSG+GKST+++RLM E   +F FS+S+TTR PR GE DG DYHF++ +  ++G+++ EFIE A++SGN YGT   A++ V  +N++CILDID QGV  IK  +L+ IY+ I PP+
Sbjct:   20 RPVVLSGPSGAGKSTLLKRLMNEYEGLFGFSVSHTTRKPRPGEADGKDYHFVSLDDMKKGIERGEFIEHAVFSGNMYGTSTAAVQAVQARNQICILDIDMQGVKSIKKTSLNPIYISIHPPS 141          
BLAST of SMED30026227 vs. Ensembl Xenopus
Match: ecm2.1 (extracellular matrix protein 2, female organ and adipocyte specific, gene 1 [Source:Xenbase;Acc:XB-GENE-951818])

HSP 1 Score: 107.071 bits (266), Expect = 2.262e-24
Identity = 60/178 (33.71%), Postives = 94/178 (52.81%), Query Frame = -1
Query: 1108 RKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKEL 1641
            RK LV+ G SG G+S I   L+ + P  F +   +T+R P+ GE++   YHF++ E   R + +NEF+E+  +SG  +GT    +KEV K  K+ ILDI+ Q +  ++ A L    VFI P + E             E   LQ+L      ++  Y    FDL L N+ +E++ ++L
Sbjct:  202 RKTLVLIGVSGVGRSHIKNTLLAKYPERFVYPAPHTSRPPKRGEEESGSYHFVSAEEMSRAISENEFLEYGSFSGYMFGTKIQTVKEVHKDGKVAILDIEPQTLKMVRTAELAPFIVFISPTDKE-------------ESEALQKLRADSDVLRSRYAQ-HFDLTLVNNGVEQTVQDL 365          
BLAST of SMED30026227 vs. Ensembl Xenopus
Match: ecm2.1 (extracellular matrix protein 2, female organ and adipocyte specific, gene 1 [Source:Xenbase;Acc:XB-GENE-951818])

HSP 1 Score: 107.071 bits (266), Expect = 3.067e-24
Identity = 60/178 (33.71%), Postives = 94/178 (52.81%), Query Frame = -1
Query: 1108 RKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKEL 1641
            RK LV+ G SG G+S I   L+ + P  F +   +T+R P+ GE++   YHF++ E   R + +NEF+E+  +SG  +GT    +KEV K  K+ ILDI+ Q +  ++ A L    VFI P + E             E   LQ+L      ++  Y    FDL L N+ +E++ ++L
Sbjct:  223 RKTLVLIGVSGVGRSHIKNTLLAKYPERFVYPAPHTSRPPKRGEEESGSYHFVSAEEMSRAISENEFLEYGSFSGYMFGTKIQTVKEVHKDGKVAILDIEPQTLKMVRTAELAPFIVFISPTDKE-------------ESEALQKLRADSDVLRSRYAQ-HFDLTLVNNGVEQTVQDL 386          
BLAST of SMED30026227 vs. Ensembl Mouse
Match: Guk1 (guanylate kinase 1 [Source:MGI Symbol;Acc:MGI:95871])

HSP 1 Score: 174.481 bits (441), Expect = 2.217e-50
Identity = 83/186 (44.62%), Postives = 135/186 (72.58%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST++++L +E  ++F FS+S+TTR+PR GE+DG DY+F+T+E  QR +   +FIE A +SGN YGT K+A++ V   N++C+LD+D QGV  IK  +L  IY+F++PP+ + LE+RLR ++ E+E+ + +RLA A  +M+     G+FDL++ ND+L+K+   LK  +  E++
Sbjct:   14 RPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIKKTDLCPIYIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIINDDLDKAYATLKQALSEEIK 199          
BLAST of SMED30026227 vs. Ensembl Mouse
Match: Guk1 (guanylate kinase 1 [Source:MGI Symbol;Acc:MGI:95871])

HSP 1 Score: 174.481 bits (441), Expect = 3.096e-50
Identity = 83/186 (44.62%), Postives = 135/186 (72.58%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST++++L +E  ++F FS+S+TTR+PR GE+DG DY+F+T+E  QR +   +FIE A +SGN YGT K+A++ V   N++C+LD+D QGV  IK  +L  IY+F++PP+ + LE+RLR ++ E+E+ + +RLA A  +M+     G+FDL++ ND+L+K+   LK  +  E++
Sbjct:   26 RPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIKKTDLCPIYIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIINDDLDKAYATLKQALSEEIK 211          
BLAST of SMED30026227 vs. Ensembl Mouse
Match: Mpp1 (membrane protein, palmitoylated [Source:MGI Symbol;Acc:MGI:105941])

HSP 1 Score: 114.005 bits (284), Expect = 1.380e-26
Identity = 61/180 (33.89%), Postives = 98/180 (54.44%), Query Frame = -1
Query: 1102 RKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKD 1641
            RK LV+ G SG G+S I   L+   P  F +   YTTR P+  E+DG +YHFI+ E   + +  NEF+EF  Y GN +GT  + + ++ K++K+ ILDI+ Q +  ++ A L    VFI P +  T                LQ+L    + ++  Y    FDL L N++++++ K+L++
Sbjct:  262 RKTLVLIGASGVGRSHIKNGLLSHNPEKFAYPAPYTTRPPKKSEEDGKEYHFISTEEMTKNISANEFLEFGSYQGNMFGTKFETVHQIHKQDKIAILDIEPQTLKTVRTAELSPFIVFIAPTDQGTQT------------EALQQLQKDSEAIRSQYAH-YFDLSLVNNSVDETLKKLQE 428          
BLAST of SMED30026227 vs. Ensembl Mouse
Match: Mpp1 (membrane protein, palmitoylated [Source:MGI Symbol;Acc:MGI:105941])

HSP 1 Score: 114.005 bits (284), Expect = 1.890e-26
Identity = 61/180 (33.89%), Postives = 98/180 (54.44%), Query Frame = -1
Query: 1102 RKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKD 1641
            RK LV+ G SG G+S I   L+   P  F +   YTTR P+  E+DG +YHFI+ E   + +  NEF+EF  Y GN +GT  + + ++ K++K+ ILDI+ Q +  ++ A L    VFI P +  T                LQ+L    + ++  Y    FDL L N++++++ K+L++
Sbjct:  282 RKTLVLIGASGVGRSHIKNGLLSHNPEKFAYPAPYTTRPPKKSEEDGKEYHFISTEEMTKNISANEFLEFGSYQGNMFGTKFETVHQIHKQDKIAILDIEPQTLKTVRTAELSPFIVFIAPTDQGTQT------------EALQQLQKDSEAIRSQYAH-YFDLSLVNNSVDETLKKLQE 448          
BLAST of SMED30026227 vs. Ensembl Mouse
Match: Mpp1 (membrane protein, palmitoylated [Source:MGI Symbol;Acc:MGI:105941])

HSP 1 Score: 108.612 bits (270), Expect = 1.036e-24
Identity = 49/121 (40.50%), Postives = 72/121 (59.50%), Query Frame = -1
Query: 1279 RKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRP 1641
            RK LV+ G SG G+S I   L+   P  F +   YTTR P+  E+DG +YHFI+ E   + +  NEF+EF  Y GN +GT  + + ++ K++K+ ILDI+ Q +  ++ A L    VFI P
Sbjct:  282 RKTLVLIGASGVGRSHIKNGLLSHNPEKFAYPAPYTTRPPKKSEEDGKEYHFISTEEMTKNISANEFLEFGSYQGNMFGTKFETVHQIHKQDKIAILDIEPQTLKTVRTAELSPFIVFIAP 402          
BLAST of SMED30026227 vs. UniProt/SwissProt
Match: sp|Q9P6I5|KGUA_SCHPO (Guanylate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.05 PE=3 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 2.160e-50
Identity = 92/184 (50.00%), Postives = 134/184 (72.83%), Query Frame = -1
Query: 1087 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSE 1638
            K +V+ GPSG GKST+++RL+K+  +   FS+S+TTR+PR GEKDGIDYHF+TKE FQ+ V + +F+E+A++SGN YGT   AI+E+   NK  ILDID QGV ++K + +DA YVF+ PP+ E LE RLR +  E+E  ILQRL  A  E+++  + G FD ++ ND++EK+ K+L+   +S+
Sbjct:   19 KPVVVFGPSGVGKSTLLKRLLKDHGDKLGFSVSHTTRTPRAGEKDGIDYHFVTKEEFQKLVAEEKFVEWAVFSGNMYGTSIMAIQELEAVNKKAILDIDLQGVLQVKASPIDAQYVFLAPPSIEQLEVRLRGRGTENESAILQRLERARAEIEYSEKPGNFDALIVNDDVEKAYKQLEAICLSD 202          
BLAST of SMED30026227 vs. UniProt/SwissProt
Match: sp|Q64520|KGUA_MOUSE (Guanylate kinase OS=Mus musculus OX=10090 GN=Guk1 PE=1 SV=2)

HSP 1 Score: 174.481 bits (441), Expect = 1.387e-49
Identity = 83/186 (44.62%), Postives = 135/186 (72.58%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST++++L +E  ++F FS+S+TTR+PR GE+DG DY+F+T+E  QR +   +FIE A +SGN YGT K+A++ V   N++C+LD+D QGV  IK  +L  IY+F++PP+ + LE+RLR ++ E+E+ + +RLA A  +M+     G+FDL++ ND+L+K+   LK  +  E++
Sbjct:    5 RPVVLSGPSGAGKSTLLKKLFQEHSSIFGFSVSHTTRNPRPGEEDGKDYYFVTREMMQRDIAAGDFIEHAEFSGNLYGTSKEAVRAVQAMNRICVLDVDLQGVRSIKKTDLCPIYIFVQPPSLDVLEQRLRLRNTETEESLAKRLAAARTDMESSKEPGLFDLVIINDDLDKAYATLKQALSEEIK 190          
BLAST of SMED30026227 vs. UniProt/SwissProt
Match: sp|Q16774|KGUA_HUMAN (Guanylate kinase OS=Homo sapiens OX=9606 GN=GUK1 PE=1 SV=2)

HSP 1 Score: 172.17 bits (435), Expect = 8.265e-49
Identity = 81/186 (43.55%), Postives = 136/186 (73.12%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST+++RL++E   +F FS+S+TTR+PR GE++G DY+F+T+E  QR +   +FIE A +SGN YGT K A++ V   N++C+LD+D QGV  IK  +L  IY+ ++PP+   LE+RLR+++ E+E+ +++RLA A  +M+     G+FD+++ ND+L+++  ELK+ +  E++
Sbjct:    5 RPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIK 190          
BLAST of SMED30026227 vs. UniProt/SwissProt
Match: sp|P15454|KGUA_YEAST (Guanylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUK1 PE=1 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 2.624e-46
Identity = 87/183 (47.54%), Postives = 129/183 (70.49%), Query Frame = -1
Query: 1087 LVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKN-ANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSE 1632
            +VI GPSG+GKST++++L  E P+ F FS+S TTR+PR GE +G DY+F++ + F+  +K NEFIE+A +SGN+YG+   ++K+V K  K CILDID QGV  +K    L+A ++FI PP+ E L+KRL  +  E+E+ I +RL+ A  E+ +    G  D ++ ND+L+K+ KELKDFI +E
Sbjct:    5 IVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYA-ETGAHDKVIVNDDLDKAYKELKDFIFAE 186          
BLAST of SMED30026227 vs. UniProt/SwissProt
Match: sp|P31006|KGUA_PIG (Guanylate kinase OS=Sus scrofa OX=9823 GN=GUK1 PE=1 SV=2)

HSP 1 Score: 162.925 bits (411), Expect = 2.274e-45
Identity = 83/186 (44.62%), Postives = 136/186 (73.12%), Query Frame = -1
Query: 1081 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1638
            + +V+ GPSG+GKST++++L++E  ++F FS+S+TTR PR GE++G DY+F+T+E  QR +   +FIE A +SGN YGT K A++ V   N++C+LD+D QGV  IK  +L  IY+F++PP+ + LE+RLR+++ E+E+ + +RLA A  +M+     G+FDLI+ ND+L+K+   LK+ +  E++
Sbjct:    5 RPVVLSGPSGAGKSTLLKKLLQEHSSIFGFSVSHTTRDPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKAAVRAVQAMNRICVLDVDLQGVRNIKKTDLQPIYIFVQPPSLDVLEQRLRQRNTETEESLAKRLAAAKADMESSKEPGLFDLIIINDSLDKAYWALKEALSEEIK 190          
BLAST of SMED30026227 vs. TrEMBL
Match: A0A0N0BJA3 (Guanylate kinase OS=Melipona quadrifasciata OX=166423 GN=WN51_08601 PE=3 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 5.666e-57
Identity = 95/191 (49.74%), Postives = 145/191 (75.92%), Query Frame = -1
Query: 1084 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEV 1656
            M     + LV+CGPSGSGKST+I++L +E P+ F +S+S+TTRSPR+GE+DG  YHF TK+  Q+ +++NEF+E A+YSGN YGT K A+++V +  K+C+LD+D QG+ +IK ++LD  Y+FI+PP+ + LEKRLR +  E+ED + +RL+VA  E+++G + G FD+++ NDN  K+ +ELK F+MS +
Sbjct:    1 MLHKGPRPLVLCGPSGSGKSTLIKKLFEEFPDTFGYSVSHTTRSPREGEEDGKHYHFTTKDKMQKQIEQNEFLETAIYSGNMYGTSKRAVEDVQEAGKICVLDVDVQGIKQIKQSSLDPFYIFIKPPSIKELEKRLRARKTETEDTLQRRLSVARTEIEYGEKPGNFDIVIENDNFSKAYEELKKFVMSNL 191          
BLAST of SMED30026227 vs. TrEMBL
Match: V9IE02 (Guanylate kinase OS=Apis cerana OX=7461 GN=ACCB01525.1 PE=2 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 7.072e-56
Identity = 95/191 (49.74%), Postives = 144/191 (75.39%), Query Frame = -1
Query: 1084 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEV 1656
            M     + LV+CGPSGSGKST+I++L +E P+ F +S+S+TTR+PR GE+DG  YHF TKE  Q+ ++++EFIE A++SGN YGT K A++EV +  K+C+LDI+ QGV ++K ++LD +Y+FI+PP+ E LEKRLR +  E+ED + QRL++A  EM++G + G FD+++ NDN  K+   L++F+MS +
Sbjct:    1 MLHKGPRPLVLCGPSGSGKSTLIKKLFEEFPDTFGYSVSHTTRTPRPGEEDGKHYHFTTKEKMQKQIEQDEFIETAIFSGNMYGTSKRAVEEVQQMGKICVLDIEIQGVEQVKRSSLDPLYIFIKPPSIEELEKRLRARKTETEDVLKQRLSIAKVEMEYGEKVGNFDIVIENDNFSKAYNILREFVMSSL 191          
BLAST of SMED30026227 vs. TrEMBL
Match: A0A2A3EIZ8 (Guanylate kinase OS=Apis cerana cerana OX=94128 GN=APICC_05723 PE=4 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 1.643e-55
Identity = 95/191 (49.74%), Postives = 144/191 (75.39%), Query Frame = -1
Query: 1084 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEV 1656
            M     + LV+CGPSGSGKST+I++L +E P+ F +S+S+TTR+PR GE+DG  YHF TKE  Q+ ++++EFIE A++SGN YGT K A++EV +  K+C+LDI+ QGV ++K ++LD +Y+FI+PP+ E LEKRLR +  E+ED + QRL++A  EM++G + G FD+++ NDN  K+   L++F+MS +
Sbjct:   15 MLHKGPRPLVLCGPSGSGKSTLIKKLFEEFPDTFGYSVSHTTRTPRPGEEDGKHYHFTTKEKMQKQIEQDEFIETAIFSGNMYGTSKRAVEEVQQMGKICVLDIEIQGVEQVKRSSLDPLYIFIKPPSIEELEKRLRARKTETEDVLKQRLSIAKVEMEYGEKVGNFDIVIENDNFSKAYNILREFVMSSL 205          
BLAST of SMED30026227 vs. TrEMBL
Match: A0A088A648 (Guanylate kinase-like domain-containing protein OS=Apis mellifera OX=7460 GN=LOC552023 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 8.043e-55
Identity = 94/192 (48.96%), Postives = 145/192 (75.52%), Query Frame = -1
Query: 1081 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVE 1656
            M     + LV+CGPSGSGKST+I++L +E P+ F +S+S+TTR+PR GE+DG  YHF TKE  Q+ ++++EFIE A++SGN YGT K A+++V +  K+C+LDI+ QGV ++K ++LD +Y+FI+PP+ E LEKRLR +  E+ED + QRL++A  EM++G + G FD+++ NDN  K+   L++F+MS ++
Sbjct:   15 MLHKGPRPLVLCGPSGSGKSTLIKKLFEEFPDTFGYSVSHTTRAPRPGEEDGKHYHFTTKEKMQKQIEQDEFIETAIFSGNMYGTSKCAVEKVQQMGKICVLDIEIQGVEQVKRSSLDPLYIFIKPPSIEELEKRLRARKTETEDVLKQRLSIAKVEMEYGEKTGNFDIVIENDNFSKAYNILREFVMSNLK 206          
BLAST of SMED30026227 vs. TrEMBL
Match: A0A2U1IV54 (Guanylate kinase-like domain-containing protein OS=Smittium angustum OX=133377 GN=BB558_007467 PE=3 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.421e-54
Identity = 97/190 (51.05%), Postives = 138/190 (72.63%), Query Frame = -1
Query: 1087 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSE 1656
            MT   ++ +V+ GPSGSGKST+I++L +E P+ F FS+S+TTRSPR GE DG+DYHF+TK+ F  GV   EFIE A +SGN+YGT   A++ V  K K+CILDI+++GV ++KN NLDA Y+FI PP+FE L KRL  +  E+E+ I +RL  A +E ++  + G +D+ + ND+LEK+ K LK FI ++
Sbjct:    1 MTSLIKRPIVLFGPSGSGKSTLIKKLFEEYPDSFGFSVSHTTRSPRSGEIDGVDYHFVTKDQFLAGVANGEFIENAEFSGNYYGTSIKAVENVKNKGKVCILDIETEGVKQVKNTNLDARYIFISPPSFEELRKRLLGRQTETEESIKKRLDTAAKEFEYAKQPGAYDIKIVNDDLEKAYKNLKSFIFNQ 190          
BLAST of SMED30026227 vs. Ensembl Cavefish
Match: guk1b (guanylate kinase-like [Source:NCBI gene;Acc:103024702])

HSP 1 Score: 181.8 bits (460), Expect = 2.370e-53
Identity = 89/191 (46.60%), Postives = 139/191 (72.77%), Query Frame = -1
Query: 1075 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETV 1647
            +  + +V+ GPSG+GKST+++RLMKE   VF FS+S+TTR+PR GE+DG DYHF+T+E  Q  +  NE IE A +SGN YGT K +I++V  +N +CILD+D QGV  IK  +L+ IY+ I+PP+ E LE+RLR++  E+E+ + +RL  A  +M+    +G+FDL++ ND+L+++ ++LK  ++ E++ V
Sbjct:    2 SGPRPVVLSGPSGAGKSTLLKRLMKEYEGVFGFSVSHTTRNPRPGEEDGKDYHFVTREKMQEAIDNNELIENAEFSGNMYGTSKSSIEDVQAQNLICILDVDIQGVRNIKETDLNPIYISIQPPSMEILEQRLRDRKTETEESLQKRLEAARIDMELSKEEGVFDLVIINDDLDEAYEKLKSVLIEEIQKV 192          
BLAST of SMED30026227 vs. Ensembl Cavefish
Match: guk1b (guanylate kinase-like [Source:NCBI gene;Acc:103024702])

HSP 1 Score: 181.8 bits (460), Expect = 3.040e-53
Identity = 89/191 (46.60%), Postives = 139/191 (72.77%), Query Frame = -1
Query: 1075 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETV 1647
            +  + +V+ GPSG+GKST+++RLMKE   VF FS+S+TTR+PR GE+DG DYHF+T+E  Q  +  NE IE A +SGN YGT K +I++V  +N +CILD+D QGV  IK  +L+ IY+ I+PP+ E LE+RLR++  E+E+ + +RL  A  +M+    +G+FDL++ ND+L+++ ++LK  ++ E++ V
Sbjct:    7 SGPRPVVLSGPSGAGKSTLLKRLMKEYEGVFGFSVSHTTRNPRPGEEDGKDYHFVTREKMQEAIDNNELIENAEFSGNMYGTSKSSIEDVQAQNLICILDVDIQGVRNIKETDLNPIYISIQPPSMEILEQRLRDRKTETEESLQKRLEAARIDMELSKEEGVFDLVIINDDLDEAYEKLKSVLIEEIQKV 197          
BLAST of SMED30026227 vs. Ensembl Cavefish
Match: guk1a (guanylate kinase [Source:NCBI gene;Acc:103046904])

HSP 1 Score: 175.637 bits (444), Expect = 4.510e-51
Identity = 88/188 (46.81%), Postives = 138/188 (73.40%), Query Frame = -1
Query: 1069 LVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLK 1632
            +V+ GPSG+GKST+++ LMKE   VF FS+S+TTR PR GE++G DYH++++E  Q G+ K +FIE A +SGN YGT K A+++V  +N +CILDID QGV  IK  +L+ IY+ I+PP+ + LEKRLR++  ESE+ + +RL  A+ ++Q     G+FD+++ N++LE++ ++LK  ++ E++ V K
Sbjct:    7 VVLSGPSGAGKSTLLKMLMKEFEGVFGFSVSHTTRKPRPGEENGKDYHYVSREVMQAGIDKGDFIENAEFSGNMYGTSKVAVQDVQARNLICILDIDMQGVKNIKKTDLNPIYISIQPPSMDILEKRLRDRKTESEESLQKRLQAANVDLQISKEAGLFDVVIVNNDLEEAYRDLKGALLEEIQKVQK 194          
BLAST of SMED30026227 vs. Ensembl Cavefish
Match: guk1a (guanylate kinase [Source:NCBI gene;Acc:103046904])

HSP 1 Score: 175.637 bits (444), Expect = 4.510e-51
Identity = 88/188 (46.81%), Postives = 138/188 (73.40%), Query Frame = -1
Query: 1069 LVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLK 1632
            +V+ GPSG+GKST+++ LMKE   VF FS+S+TTR PR GE++G DYH++++E  Q G+ K +FIE A +SGN YGT K A+++V  +N +CILDID QGV  IK  +L+ IY+ I+PP+ + LEKRLR++  ESE+ + +RL  A+ ++Q     G+FD+++ N++LE++ ++LK  ++ E++ V K
Sbjct:    7 VVLSGPSGAGKSTLLKMLMKEFEGVFGFSVSHTTRKPRPGEENGKDYHYVSREVMQAGIDKGDFIENAEFSGNMYGTSKVAVQDVQARNLICILDIDMQGVKNIKKTDLNPIYISIQPPSMDILEKRLRDRKTESEESLQKRLQAANVDLQISKEAGLFDVVIVNNDLEEAYRDLKGALLEEIQKVQK 194          
BLAST of SMED30026227 vs. Ensembl Cavefish
Match: guk1a (guanylate kinase [Source:NCBI gene;Acc:103046904])

HSP 1 Score: 175.252 bits (443), Expect = 8.888e-51
Identity = 88/188 (46.81%), Postives = 138/188 (73.40%), Query Frame = -1
Query: 1069 LVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLK 1632
            +V+ GPSG+GKST+++ LMKE   VF FS+S+TTR PR GE++G DYH++++E  Q G+ K +FIE A +SGN YGT K A+++V  +N +CILDID QGV  IK  +L+ IY+ I+PP+ + LEKRLR++  ESE+ + +RL  A+ ++Q     G+FD+++ N++LE++ ++LK  ++ E++ V K
Sbjct:   19 VVLSGPSGAGKSTLLKMLMKEFEGVFGFSVSHTTRKPRPGEENGKDYHYVSREVMQAGIDKGDFIENAEFSGNMYGTSKVAVQDVQARNLICILDIDMQGVKNIKKTDLNPIYISIQPPSMDILEKRLRDRKTESEESLQKRLQAANVDLQISKEAGLFDVVIVNNDLEEAYRDLKGALLEEIQKVQK 206          
BLAST of SMED30026227 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006611.1 (pep scaffold:Pmarinus_7.0:GL481772:5454:8357:-1 gene:ENSPMAG00000005965.1 transcript:ENSPMAT00000006611.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.866 bits (442), Expect = 2.112e-51
Identity = 88/188 (46.81%), Postives = 128/188 (68.09%), Query Frame = -1
Query: 1075 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETV 1638
            + +V+ GPSG GKST+I++LM E   VF  S+S+TTR+PR GE  G DYHF+T+E   R +   EFIE A YSGN YGT K A++ VL KN++CILDID QGV  +K  +L+ +Y+ I+PP+   LE+RLR +  E++D + +RL  A +E++F    G FD I+ ND L+++  +LK+ +  E+  V
Sbjct:    5 RPVVLSGPSGCGKSTLIKKLMSEFEGVFGLSVSHTTRNPRPGEVTGKDYHFVTREEMLRLIAAREFIEHAEYSGNLYGTSKSAVRAVLDKNQICILDIDMQGVHSMKKTDLNPLYISIQPPSITILEERLRLRKTENDDSLKRRLKAAKKEIEFSKEPGAFDAIVVNDELQEAYAQLKELVKKEIAKV 192          
BLAST of SMED30026227 vs. Ensembl Sea Lamprey
Match: guk1b (guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-020916-1])

HSP 1 Score: 174.866 bits (442), Expect = 3.486e-51
Identity = 86/188 (45.74%), Postives = 134/188 (71.28%), Query Frame = -1
Query: 1075 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETV 1638
            + +V+ GPSG+GKST+++RLM+E  +VF FS+S+TTR+PR GE DG DYHF+ +E  ++G+  +EFIE A +SGN YGT K A++ +   N++CILD+D QGV  +K   L+ +Y+ I PP+ E LE+RLR +  ESE+ I +RLA A  +++     G+FD ++ ND+L+++  +LKD +  E++ V
Sbjct:   20 RPVVLSGPSGAGKSTLVKRLMQEYADVFGFSVSHTTRNPRAGEVDGKDYHFVCREEMEKGILADEFIEHAEFSGNLYGTSKKAVEVIRDHNQICILDLDIQGVRSMKRTTLNPLYLSIHPPSIEALEERLRGRKTESEESIQKRLAAARADLEISKEPGIFDAVIINDDLDEAYNKLKDVLSEEIQKV 207          
BLAST of SMED30026227 vs. Ensembl Sea Lamprey
Match: MPP5 (membrane palmitoylated protein 5 [Source:HGNC Symbol;Acc:HGNC:18669])

HSP 1 Score: 105.145 bits (261), Expect = 6.640e-26
Identity = 57/184 (30.98%), Postives = 105/184 (57.07%), Query Frame = -1
Query: 1108 RKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFE------TXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKEL 1641
            ++ +V+ GP   G++ +  RLM+   + F  +  +TTR  RD E DG DYHF++++AF+  +  ++FIE   +  N YGT  D++++V+   K+C+L++ +Q +  +KN++L    +F+ PP+ E        E +  + S       L+ +    +EM+ GY    FD I+ N +L+K+ +EL
Sbjct:   41 KRPIVLIGPPNCGRNELRTRLMESDADRFAAATPHTTRGMRDNEVDGRDYHFVSRQAFEADIGVHKFIEHGEFEKNLYGTSIDSVRQVINSGKICVLNLHTQSLKLLKNSDLKPYIIFVAPPSQERLRAMMAKESKNPKVSARFLPEELREVIEKAREMEQGY-GHYFDGIIVNADLDKAHQEL 223          
BLAST of SMED30026227 vs. Ensembl Sea Lamprey
Match: mpp7a (membrane protein, palmitoylated 7a (MAGUK p55 subfamily member 7) [Source:NCBI gene;Acc:30166])

HSP 1 Score: 110.923 bits (276), Expect = 8.031e-26
Identity = 56/188 (29.79%), Postives = 96/188 (51.06%), Query Frame = -1
Query: 1105 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXX--------EDRILQRL--AVAHQEMQFGYRDGMFDLILTNDNLEKSTKELK 1638
            +V+V+ GP G G + + RRL+   P+++  ++  TTR  +  EKD  +Y+F+++  F+  +  N F+E+  + GN YGT  DAI+ V+   K+C+LD+    +  I+        +F++PP+ E L +                  D   Q +    A  E QFGY   +FD  + ND L  + +EL+
Sbjct:  369 RVIVLVGPPGVGINELKRRLIASDPSLYSGTVPTTTRQKKSHEKDSKEYYFVSRHLFEADLHNNRFVEYGEFKGNLYGTSVDAIRSVVNAGKVCLLDVSPPAIKSIRTPEFKPFVIFVKPPSLERLRQTRGAAKSSGDKNPARNFTDEDFQEMLGTAARMEAQFGY---LFDKTVVNDELAAAYRELR 553          
BLAST of SMED30026227 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008482.1 (pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 gene:ENSPMAG00000007666.1 transcript:ENSPMAT00000008482.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 6.089e-23
Identity = 60/193 (31.09%), Postives = 99/193 (51.30%), Query Frame = -1
Query: 1096 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXX------XXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFI 1656
            M    RK LV+ G  G G+ ++  RL+   P+ +  +I +T+R PRD EKDG  YHF+ +   +  +K   ++E   Y GN YGT  ++I  V++  KMCILD++ Q +  ++ A      VFI  P+ E L    +        +K   D  L++       +Q  Y    FDL + NDN++++   L+ ++
Sbjct:  350 MPPFQRKTLVLIGAQGVGRRSLKNRLLVSEPSRYGMTIPFTSRRPRDDEKDGQGYHFVARADMEVDIKSGRYLESGEYEGNLYGTKIESIG-VVRAGKMCILDVNPQALKLLRTAEFMPYVVFIAAPSVEILRSMHKAALDAGLTAKHLTDADLKKTVDESTRIQRAYIH-YFDLTIVNDNMDEAFANLRAYL 540          
BLAST of SMED30026227 vs. Ensembl Yeast
Match: GUK1 (Guanylate kinase; converts GMP to GDP; required for growth and mannose outer chain elongation of cell wall N-linked glycoproteins [Source:SGD;Acc:S000002862])

HSP 1 Score: 165.236 bits (417), Expect = 3.780e-48
Identity = 87/183 (47.54%), Postives = 129/183 (70.49%), Query Frame = -1
Query: 1087 LVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKN-ANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSE 1632
            +VI GPSG+GKST++++L  E P+ F FS+S TTR+PR GE +G DY+F++ + F+  +K NEFIE+A +SGN+YG+   ++K+V K  K CILDID QGV  +K    L+A ++FI PP+ E L+KRL  +  E+E+ I +RL+ A  E+ +    G  D ++ ND+L+K+ KELKDFI +E
Sbjct:    5 IVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYA-ETGAHDKVIVNDDLDKAYKELKDFIFAE 186          
BLAST of SMED30026227 vs. Ensembl Nematostella
Match: EDO42233 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S267])

HSP 1 Score: 174.096 bits (440), Expect = 5.130e-51
Identity = 87/186 (46.77%), Postives = 127/186 (68.28%), Query Frame = -1
Query: 1084 RKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEV 1641
            +K +VI GPSGSGKST+++RLMKE P+ F FS+S+TTR PR GE +G DY+F  +   ++ ++  EF+EFA Y+ N YGT K A+++V+   K+CILDID QGV  +K A +  +Y+F +PP+ E LE RLR +  E++D + QRL +A  E+ +G   G  D  + ND+L+K+  E KD I  E+
Sbjct:    3 KKPIVIHGPSGSGKSTLVKRLMKEYPDTFGFSVSHTTRQPRPGEINGKDYNFTERGIMEKAIENGEFLEFAEYNQNLYGTSKKAVQDVIHVGKVCILDIDVQGVKNVKKAEMKCLYIFAKPPSLEELENRLRGRGTETDDTLRQRLEIAKSELAYGEEPGNADYTIINDDLDKAYTEFKDIISKEI 188          
BLAST of SMED30026227 vs. Ensembl Nematostella
Match: EDO37538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE0])

HSP 1 Score: 100.523 bits (249), Expect = 2.120e-22
Identity = 60/195 (30.77%), Postives = 100/195 (51.28%), Query Frame = -1
Query: 1090 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFE------TXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMS 1656
            M    RK LV+ G  G G+ T+  +L+      F  +I +T+R  R+GE+ G  Y F+++E  +R ++  +++EF  Y GN YGT  D I+EV++  KMC++D++   +  +K        V I  P+FE      +        +K+  D  L R  V   E  +      FDL + NDN+E++  +L++ I S
Sbjct:  304 MPPFQRKTLVMIGAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVSREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDEL-RKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIES 497          
BLAST of SMED30026227 vs. Ensembl Nematostella
Match: EDO37539 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFE1])

HSP 1 Score: 93.2041 bits (230), Expect = 8.369e-22
Identity = 55/183 (30.05%), Postives = 94/183 (51.37%), Query Frame = -1
Query: 1090 GPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFE------TXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMS 1620
            G  G G+ T+  +L+      F  +I +T+R  R+GE+ G  Y F+++E  +R ++  +++EF  Y GN YGT  D I+EV++  KMC++D++   +  +K        V I  P+FE      +        +K+  D  L R  V   E  +      FDL + NDN+E++  +L++ I S
Sbjct:    1 GAQGVGRRTLKNKLIMSDRKRFGTTIPHTSRQMREGEQSGRGYFFVSREEMERDIRAGKYLEFGEYGGNMYGTKIDTIREVMRSGKMCVVDVNPTALKVLKTPEFMPYIVCIASPSFEELKEFQSKALSEGIVNKKRSDDEL-RKTVEDSERLYNSYAHYFDLTIANDNVEEAFNKLQNAIES 182          
BLAST of SMED30026227 vs. Ensembl Nematostella
Match: EDO46060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR66])

HSP 1 Score: 93.2041 bits (230), Expect = 1.735e-20
Identity = 58/190 (30.53%), Postives = 102/190 (53.68%), Query Frame = -1
Query: 1072 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFI-TKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVL 1638
            + +++ GP    K  I   L+ E P+ F   + +TTR  RD EKDG+DYHF+ ++E  +R ++ + FIE   Y+ N YGT  +++K V +K+K CILD+    + +++ A L  I +FI+P + E++ +  +  ++E   +   R     QE  FG     F  I+  D  ++    +K+ I  +   V+
Sbjct:  175 RPVIVLGPL---KDRINDDLISEFPDKFGSCVPHTTRPRRDYEKDGLDYHFVESREEMERAIQNHMFIEAGQYNDNLYGTSVESVKIVAEKSKHCILDVSGYAIKRLQVAGLYPIAIFIKPKSMESIRELNKRLTEEQAQKTFDRALKLEQE--FG---EYFTAIVQGDTYDELYNRVKEVIRQQSGPVI 356          
BLAST of SMED30026227 vs. Ensembl Nematostella
Match: EDO33577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRU3])

HSP 1 Score: 91.2781 bits (225), Expect = 2.656e-19
Identity = 53/210 (25.24%), Postives = 104/210 (49.52%), Query Frame = -1
Query: 1096 MGFNNISFLHIR*D*MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXX--------XXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFI 1701
            + ++ +  LH        + ++ +V+ GP   G+  + +RL++  P+ F  +I +T+R  + GE +  DYHF+ +  F   +  ++F+E      +FYGT  DAIK V+   K CIL++  + +  ++ +N+    +FI  P++E +             + +    DR +  +    +EM+  Y    FD  +TN + E++  EL+  I
Sbjct:  403 LTYDEVDLLH-----PNPSRKRPIVLIGPPKIGRKELRQRLIQYDPDRFAGAIPHTSRPIKPGEINDHDYHFVPRHTFVTDIVAHKFVEHGELQDHFYGTSFDAIKMVINAGKTCILNLHCEALKTLRASNIKPYVIFISSPSYERVRALRRGKIDPFNPKLNVALTDREIHEMVAKAREMEEAY-GHYFDHTITNTDFERTFDELRQVI 606          
BLAST of SMED30026227 vs. Ensembl Medaka
Match: guk1b (guanylate kinase-like [Source:NCBI gene;Acc:101155672])

HSP 1 Score: 182.185 bits (461), Expect = 1.671e-53
Identity = 93/188 (49.47%), Postives = 139/188 (73.94%), Query Frame = -1
Query: 1084 TARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEV 1647
            +  + +V+ GPSG+GKST++++LMK+   VF FS+S+TTR+PR GE+DG DYHF T+E  Q G+   EFIE A +SGN YGT K A+++V  KN +CILD+D QGV +IK  +L+ IY+ I+PP+ E LE+RLR++  E+ED + +RL  A  +M+     G+FD+++ ND+LE++ +ELKD I++EV
Sbjct:    2 SGPRPVVLSGPSGAGKSTLLKKLMKDHEGVFGFSVSHTTRNPRPGEEDGKDYHFTTREVMQEGIDNGEFIENAEFSGNMYGTSKAAVEDVRAKNLICILDVDIQGVRRIKETDLNPIYISIQPPSIEILEQRLRDRQTETEDSLQKRLEAARIDMELSKEPGVFDVVIINDDLERAYEELKD-ILNEV 188          
BLAST of SMED30026227 vs. Ensembl Medaka
Match: guk1a (guanylate kinase [Source:NCBI gene;Acc:101175509])

HSP 1 Score: 176.792 bits (447), Expect = 2.286e-51
Identity = 90/190 (47.37%), Postives = 132/190 (69.47%), Query Frame = -1
Query: 1069 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLK 1638
            + LV  GPSG+GKST++++LM E  +VF FS+S+TTR PR GE++GIDYH++++E  Q G+   EFIE A +SGN YGT K A++ V  KN +CILDID QGV  IK  +L+ +Y+ I+PP+ E LE+RLR +  ESE+ + +RL  A  +M+F     +FD+++ N+NLE++   LK  +  E+  V K
Sbjct:   13 RPLVFSGPSGAGKSTLLKKLMGEYDSVFGFSVSHTTRKPRPGEQNGIDYHYVSREEMQAGIDNGEFIESAEFSGNLYGTSKAAVQAVQAKNLICILDIDMQGVKNIKKTDLNPLYISIQPPSLEVLEERLRGRKTESEESVQKRLRAAKVDMEFSKEPNVFDVVIINNNLEEAYGSLKQALQEEIHKVKK 202          
BLAST of SMED30026227 vs. Ensembl Medaka
Match: guk1a (guanylate kinase [Source:NCBI gene;Acc:101175509])

HSP 1 Score: 176.407 bits (446), Expect = 4.377e-51
Identity = 90/190 (47.37%), Postives = 132/190 (69.47%), Query Frame = -1
Query: 1069 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLK 1638
            + LV  GPSG+GKST++++LM E  +VF FS+S+TTR PR GE++GIDYH++++E  Q G+   EFIE A +SGN YGT K A++ V  KN +CILDID QGV  IK  +L+ +Y+ I+PP+ E LE+RLR +  ESE+ + +RL  A  +M+F     +FD+++ N+NLE++   LK  +  E+  V K
Sbjct:   17 RPLVFSGPSGAGKSTLLKKLMGEYDSVFGFSVSHTTRKPRPGEQNGIDYHYVSREEMQAGIDNGEFIESAEFSGNLYGTSKAAVQAVQAKNLICILDIDMQGVKNIKKTDLNPLYISIQPPSLEVLEERLRGRKTESEESVQKRLRAAKVDMEFSKEPNVFDVVIINNNLEEAYGSLKQALQEEIHKVKK 206          
BLAST of SMED30026227 vs. Ensembl Medaka
Match: guk1a (guanylate kinase [Source:NCBI gene;Acc:101175509])

HSP 1 Score: 175.637 bits (444), Expect = 1.239e-50
Identity = 89/189 (47.09%), Postives = 132/189 (69.84%), Query Frame = -1
Query: 1072 KVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVL 1638
            + LV  GPSG+GKST++++LM E  +VF FS+S+TTR PR GE++GIDYH++++E  Q G+   EFIE A +SGN YGT K A++ V  KN +CILDID QGV  IK  +L+ +Y+ I+PP+ E LE+RLR +  ESE+ + +RL  A  +M+F     +FD+++ N+NLE++   LK  +  E+  V+
Sbjct:   17 RPLVFSGPSGAGKSTLLKKLMGEYDSVFGFSVSHTTRKPRPGEQNGIDYHYVSREEMQAGIDNGEFIESAEFSGNLYGTSKAAVQAVQAKNLICILDIDMQGVKNIKKTDLNPLYISIQPPSLEVLEERLRGRKTESEESVQKRLRAAKVDMEFSKEPNVFDVVIINNNLEEAYGSLKQALQEEIHKVV 205          
BLAST of SMED30026227 vs. Ensembl Medaka
Match: mpp4l (membrane protein, palmitoylated 4-like [Source:ZFIN;Acc:ZDB-GENE-091118-7])

HSP 1 Score: 115.546 bits (288), Expect = 6.971e-27
Identity = 59/189 (31.22%), Postives = 103/189 (54.50%), Query Frame = -1
Query: 1108 ETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFE--------TXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKEL 1650
            E   +++ I GPSG G S + RRL++  PN+F+ ++ +TTR PR  E+ G +Y+F ++EAF   V  N  +E+  Y GN YGT  ++ + VL   K+C++DI+   +  ++   L A  ++++PP  E        +        ++  +D  LQ +  A ++++  Y    FD +L ND L+ S  +L
Sbjct:  313 EDVHRLIAILGPSGVGVSELRRRLIEMNPNIFQGAVPHTTRPPRGYEESGREYYFTSREAFDNMVYNNRLLEYGEYKGNLYGTSIESARHVLNSGKICVMDIEPNAIQAVRTHELKAYIIYVKPPPLERLRETRRDSYITTDYYVNRPFKDEDLQEMEDAARKIESQYWQ-FFDHVLINDELQDSCVQL 500          
BLAST of SMED30026227 vs. Planmine SMEST
Match: SMESG000055172.1 (SMESG000055172.1)

HSP 1 Score: 464.537 bits (1194), Expect = 1.379e-162
Identity = 227/228 (99.56%), Postives = 227/228 (99.56%), Query Frame = 2
Query:  137 MKRQKIYPRLCVLKNWGTSYGFHLTTRKLTNGREYHYINDVAGGSSALYAGLLKYDKVLEVNDANIENENHKQIVKRILQNPNLVSLLVLKPDEHELFLQTGYSSADIKPFATVIESPDKKPNSGDKDAAANVSKESNQNSVTFDENSENSTQKLENLVLRTDSWTPKEYDIKDESTSITSSQNFAPSPPTVDSLEMVSMKSKRVNPRQLSKRSSLNIKEKIKILNEL 820
            MKRQKIYPRLCVLKNWGTSYGFHLTTRKLTNGREYHYINDVAGGSSALYAGLLKYDKVLEVNDANIENENHKQIVKRILQNPNLVSLLVLKPDEHELFLQTGYSSADIKPFATVIESPDKKPNSGDKDAAANVSKESNQNSVTFDENSENSTQKLENLVLRTDSWTPKEYDIKDESTSITSSQNFAPSPPTVDSLEMVS KSKRVNPRQLSKRSSLNIKEKIKILNEL
Sbjct:    1 MKRQKIYPRLCVLKNWGTSYGFHLTTRKLTNGREYHYINDVAGGSSALYAGLLKYDKVLEVNDANIENENHKQIVKRILQNPNLVSLLVLKPDEHELFLQTGYSSADIKPFATVIESPDKKPNSGDKDAAANVSKESNQNSVTFDENSENSTQKLENLVLRTDSWTPKEYDIKDESTSITSSQNFAPSPPTVDSLEMVSTKSKRVNPRQLSKRSSLNIKEKIKILNEL 228          
BLAST of SMED30026227 vs. Planmine SMEST
Match: SMESG000055174.1 (SMESG000055174.1)

HSP 1 Score: 373.629 bits (958), Expect = 1.844e-127
Identity = 196/197 (99.49%), Postives = 196/197 (99.49%), Query Frame = -1
Query: 1066 MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLKD 1656
            MTETARKVLVICGPSGSGKSTIIR LMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETLEKRLREKSKESEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLKD
Sbjct:    1 MTETARKVLVICGPSGSGKSTIIRCLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETLEKRLREKSKESEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLKD 197          
BLAST of SMED30026227 vs. Planmine SMEST
Match: SMESG000055172.1 (SMESG000055172.1)

HSP 1 Score: 283.108 bits (723), Expect = 4.305e-93
Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 2
Query:  137 MKRQKIYPRLCVLKNWGTSYGFHLTTRKLTNGREYHYINDVAGGSSALYAGLLKYDKVLEVNDANIENENHKQIVKRILQNPNLVSLLVLKPDEHELFLQTGYSSADIKPFATVIESPDKKPNSGDKDAAANVSK 541
            MKRQKIYPRLCVLKNWGTSYGFHLTTRKLTNGREYHYINDVAGGSSALYAGLLKYDKVLEVNDANIENENHKQIVKRILQNPNLVSLLVLKPDEHELFLQTGYSSADIKPFATVIESPDKKPNSGDKDAAANVSK
Sbjct:    1 MKRQKIYPRLCVLKNWGTSYGFHLTTRKLTNGREYHYINDVAGGSSALYAGLLKYDKVLEVNDANIENENHKQIVKRILQNPNLVSLLVLKPDEHELFLQTGYSSADIKPFATVIESPDKKPNSGDKDAAANVSK 135          
BLAST of SMED30026227 vs. Planmine SMEST
Match: SMESG000052584.1 (SMESG000052584.1)

HSP 1 Score: 169.859 bits (429), Expect = 5.184e-49
Identity = 84/183 (45.90%), Postives = 136/183 (74.32%), Query Frame = -1
Query: 1084 LVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEKDGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEV 1632
            LV+ GPSG GKST++ +LM +  N F FS+S+TTR PR GE+DG DYHF+ ++  +R + + +F+E+A ++GN YGT  DA+K+V    K+C+LDI+ +GV  +K ++L++ +VFI PP++E LEKRLR++  E+E+++  RL  +  +M+F    G+FDLI+ ND+LEK+ K L+DF+++++
Sbjct:    5 LVLNGPSGCGKSTLLTKLMDKHKNCFAFSVSHTTRDPRPGEQDGKDYHFVPRDKMKRLIDEGKFLEYAEFAGNIYGTSLDAVKKVQSSGKICVLDIEMEGVKAVKKSDLNSRFVFISPPSYEVLEKRLRDRGTETEEKLQARLLRSKVDMEFSKTPGIFDLIVINDDLEKAFKTLEDFLIADI 187          
BLAST of SMED30026227 vs. Planmine SMEST
Match: SMESG000052587.1 (SMESG000052587.1)

HSP 1 Score: 103.605 bits (257), Expect = 6.328e-26
Identity = 54/129 (41.86%), Postives = 95/129 (73.64%), Query Frame = -1
Query: 1084 FQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMCILDIDSQGVAKIKNANLDAIYVFIRPPNFETXXXXXXXXXXXXEDRILQRLAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEV 1470
             +R + + +F+E+A ++GN YGT  DA+K+V    K+C+LDI+ +GV  +K ++L++ +VFI PP++E LEKRLR++  E+E+++  RL  +  +M+F    G+FDLI+ ND+LEK+ K L+DF+++++
Sbjct:    1 MKRLIDEGKFLEYAEFAGNIYGTSLDAVKKVQSSGKICVLDIEMEGVKAVKKSDLNSRFVFISPPSYEVLEKRLRDRGTETEEKLQARLLRSKVDMEFSKTPGIFDLIVINDDLEKAFKTLEDFLIADI 129          
The following BLAST results are available for this feature:
BLAST of SMED30026227 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GUK11.721e-4943.55guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:46... [more]
GUK11.721e-4943.55guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:46... [more]
GUK11.721e-4943.55guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:46... [more]
GUK11.721e-4943.55guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:46... [more]
GUK11.721e-4943.55guanylate kinase 1 [Source:HGNC Symbol;Acc:HGNC:46... [more]
back to top
BLAST of SMED30026227 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
guk-11.493e-4545.03GUanylate Kinase [Source:UniProtKB/TrEMBL;Acc:A5H... [more]
guk-11.587e-4545.03GUanylate Kinase [Source:UniProtKB/TrEMBL;Acc:A5H... [more]
lin-22.235e-2228.88pep chromosome:WBcel235:X:12399517:12406131:-1 gen... [more]
lin-22.740e-2228.88pep chromosome:WBcel235:X:12399517:12414037:-1 gen... [more]
magu-29.472e-2128.19MAGUK family [Source:UniProtKB/TrEMBL;Acc:A0A3B1D... [more]
back to top
BLAST of SMED30026227 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG118111.540e-4541.36gene:FBgn0036099 transcript:FBtr0076265[more]
sdt2.181e-2127.47gene:FBgn0261873 transcript:FBtr0089974[more]
sdt2.311e-2127.47gene:FBgn0261873 transcript:FBtr0340141[more]
sdt2.427e-2127.47gene:FBgn0261873 transcript:FBtr0333720[more]
sdt2.464e-2127.47gene:FBgn0261873 transcript:FBtr0100376[more]
back to top
BLAST of SMED30026227 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
guk1b3.494e-5649.74guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-0209... [more]
guk1b1.293e-5043.78guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-0209... [more]
guk1a1.397e-4546.77guanylate kinase 1a [Source:ZFIN;Acc:ZDB-GENE-0406... [more]
guk1a1.397e-4546.77guanylate kinase 1a [Source:ZFIN;Acc:ZDB-GENE-0406... [more]
guk1a1.774e-4546.77guanylate kinase 1a [Source:ZFIN;Acc:ZDB-GENE-0406... [more]
back to top
BLAST of SMED30026227 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efcab77.725e-4845.70EF-hand calcium binding domain 7 [Source:Xenbase;A... [more]
efcab71.042e-4745.70EF-hand calcium binding domain 7 [Source:Xenbase;A... [more]
efcab76.615e-3950.82EF-hand calcium binding domain 7 [Source:Xenbase;A... [more]
ecm2.12.262e-2433.71extracellular matrix protein 2, female organ and a... [more]
ecm2.13.067e-2433.71extracellular matrix protein 2, female organ and a... [more]
back to top
BLAST of SMED30026227 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Guk12.217e-5044.62guanylate kinase 1 [Source:MGI Symbol;Acc:MGI:9587... [more]
Guk13.096e-5044.62guanylate kinase 1 [Source:MGI Symbol;Acc:MGI:9587... [more]
Mpp11.380e-2633.89membrane protein, palmitoylated [Source:MGI Symbol... [more]
Mpp11.890e-2633.89membrane protein, palmitoylated [Source:MGI Symbol... [more]
Mpp11.036e-2440.50membrane protein, palmitoylated [Source:MGI Symbol... [more]
back to top
BLAST of SMED30026227 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P6I5|KGUA_SCHPO2.160e-5050.00Guanylate kinase OS=Schizosaccharomyces pombe (str... [more]
sp|Q64520|KGUA_MOUSE1.387e-4944.62Guanylate kinase OS=Mus musculus OX=10090 GN=Guk1 ... [more]
sp|Q16774|KGUA_HUMAN8.265e-4943.55Guanylate kinase OS=Homo sapiens OX=9606 GN=GUK1 P... [more]
sp|P15454|KGUA_YEAST2.624e-4647.54Guanylate kinase OS=Saccharomyces cerevisiae (stra... [more]
sp|P31006|KGUA_PIG2.274e-4544.62Guanylate kinase OS=Sus scrofa OX=9823 GN=GUK1 PE=... [more]
back to top
BLAST of SMED30026227 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0N0BJA35.666e-5749.74Guanylate kinase OS=Melipona quadrifasciata OX=166... [more]
V9IE027.072e-5649.74Guanylate kinase OS=Apis cerana OX=7461 GN=ACCB015... [more]
A0A2A3EIZ81.643e-5549.74Guanylate kinase OS=Apis cerana cerana OX=94128 GN... [more]
A0A088A6488.043e-5548.96Guanylate kinase-like domain-containing protein OS... [more]
A0A2U1IV541.421e-5451.05Guanylate kinase-like domain-containing protein OS... [more]
back to top
BLAST of SMED30026227 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
guk1b2.370e-5346.60guanylate kinase-like [Source:NCBI gene;Acc:103024... [more]
guk1b3.040e-5346.60guanylate kinase-like [Source:NCBI gene;Acc:103024... [more]
guk1a4.510e-5146.81guanylate kinase [Source:NCBI gene;Acc:103046904][more]
guk1a4.510e-5146.81guanylate kinase [Source:NCBI gene;Acc:103046904][more]
guk1a8.888e-5146.81guanylate kinase [Source:NCBI gene;Acc:103046904][more]
back to top
BLAST of SMED30026227 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006611.12.112e-5146.81pep scaffold:Pmarinus_7.0:GL481772:5454:8357:-1 ge... [more]
guk1b3.486e-5145.74guanylate kinase 1b [Source:ZFIN;Acc:ZDB-GENE-0209... [more]
MPP56.640e-2630.98membrane palmitoylated protein 5 [Source:HGNC Symb... [more]
mpp7a8.031e-2629.79membrane protein, palmitoylated 7a (MAGUK p55 subf... [more]
ENSPMAT00000008482.16.089e-2331.09pep scaffold:Pmarinus_7.0:GL477324:4663:37503:1 ge... [more]
back to top
BLAST of SMED30026227 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GUK13.780e-4847.54Guanylate kinase; converts GMP to GDP; required fo... [more]
back to top
BLAST of SMED30026227 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO422335.130e-5146.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375382.120e-2230.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375398.369e-2230.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460601.735e-2030.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335772.656e-1925.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30026227 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
guk1b1.671e-5349.47guanylate kinase-like [Source:NCBI gene;Acc:101155... [more]
guk1a2.286e-5147.37guanylate kinase [Source:NCBI gene;Acc:101175509][more]
guk1a4.377e-5147.37guanylate kinase [Source:NCBI gene;Acc:101175509][more]
guk1a1.239e-5047.09guanylate kinase [Source:NCBI gene;Acc:101175509][more]
mpp4l6.971e-2731.22membrane protein, palmitoylated 4-like [Source:ZFI... [more]
back to top
BLAST of SMED30026227 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055172.11.379e-16299.56SMESG000055172.1[more]
SMESG000055174.11.844e-12799.49SMESG000055174.1[more]
SMESG000055172.14.305e-93100.00SMESG000055172.1[more]
SMESG000052584.15.184e-4945.90SMESG000052584.1[more]
SMESG000052587.16.328e-2641.86SMESG000052587.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026227 ID=SMED30026227|Name=SMED30026227|organism=Schmidtea mediterranea sexual|type=transcript|length=1866bp
ACGGAAGTCTTAATTTAAAAATTCTTAAAGAACGTGTATTTTTACATCTA
AAATCTTTGAACAATTTGTTTTAATTTTTGTGAAGGTTATTTTAAAATTA
AGATTCATACTTTTCAAAGAAATTTTATATTATCGAATGAAGCGACAGAA
AATTTATCCTAGGCTCTGTGTTCTAAAAAACTGGGGCACTTCTTATGGAT
TTCATTTAACTACGAGAAAATTAACAAACGGAAGAGAATACCATTACATC
AATGATGTAGCTGGTGGTTCTAGTGCACTTTATGCTGGTCTATTGAAATA
TGATAAAGTTTTAGAAGTCAATGATGCCAACATAGAAAATGAAAATCATA
AACAAATTGTGAAAAGAATCCTACAAAATCCAAATTTAGTTTCTCTATTG
GTTTTAAAACCCGACGAACATGAATTGTTCCTTCAAACTGGCTACTCATC
GGCAGATATCAAGCCATTTGCCACAGTTATTGAATCTCCTGATAAAAAAC
CTAATTCAGGCGACAAGGATGCAGCAGCAAATGTTTCAAAGGAATCCAAT
CAAAATTCTGTAACTTTTGACGAGAATTCGGAAAATTCTACTCAAAAATT
AGAAAATCTTGTTCTGAGAACCGATTCCTGGACTCCAAAAGAGTACGACA
TAAAAGATGAATCAACATCAATTACATCGTCTCAGAATTTTGCCCCGAGT
CCTCCTACTGTCGATAGCCTGGAGATGGTTTCTATGAAATCCAAAAGAGT
AAATCCCCGACAATTATCTAAACGCAGCTCTTTAAATATAAAAGAGAAAA
TAAAAATTCTAAATGAATTGTGAACTCTCAGACATGTTCACGGAAAAATC
AATATATCATGTGCAATTCATGAGCCATTGAAAAATGATTTATTAATACA
TTAATAAATAAATAAATTGTGTCTCATATTAAAAACAAAATTTACTATTA
CATGGATTTTATTTATTTATTTATATTGGTAAACAATTCAACTACGGTTA
GAAAAATTTCACAGAAATAATTAATCAATAGTTTTTATGGAATTTCTTCA
AACATGGCACAGTCAATCCTTTAAAACGGTTTCGACTTCCGACATTATAA
AATCCTTTAATTCTTTTGTAGATTTTTCTAGATTATCATTGGTCAATATG
AGATCAAACATTCCATCGCGGTATCCGAATTGCATTTCTTGGTGAGCTAC
TGCTAATCTTTGTAAAATTCTGTCTTCAGATTCTTTGCTTTTTTCTCTCA
ATCGTTTTTCCAAAGTTTCGAAATTTGGAGGTCGAATAAATACATAGATT
GCATCAAGATTTGCGTTTTTGATTTTGGCTACACCTTGACTGTCAATGTC
TAGGATACACATTTTGTTCTTCTTTAGAACTTCTTTGATGGCGTCTTTAT
GTGTTCCATAAAAATTTCCTGAATACATTGCAAATTCGATAAATTCATTT
TTCTTTACTCCTCTTTGAAAAGCTTCTTTGGTTATGAAATGATAGTCTAT
TCCATCCTTTTCTCCATCTCTCGGGCTTCTGGTTGTATATGAAATACTAA
ATTCAAAGACATTCGGAATCTCCTTCATTAGACGACGAATTATCGTAGAT
TTCCCACTTCCAGATGGTCCACAAATCACAAGTACCTTCCTGGCTGTTTC
TGTCATTTAATCCTATCTAATATGTAAGAATGATATATTATTAAATCCCA
TCTATCATTATATAATCAAAGCTGTGAGCGTGTTGTCTTGTTGCTGTCCT
TAGACATTGGTTGTTTCTGGAAAAATTTGCTATCCATTTGTAATTGTTGT
CTTTTTTATTCTTAAAAATGTTGTGTAGAGAGAAAATATTGTTTATCAAT
TCAAACAAAATTTATA
back to top

protein sequence of SMED30026227-orf-1

>SMED30026227-orf-1 ID=SMED30026227-orf-1|Name=SMED30026227-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=198bp
MTETARKVLVICGPSGSGKSTIIRRLMKEIPNVFEFSISYTTRSPRDGEK
DGIDYHFITKEAFQRGVKKNEFIEFAMYSGNFYGTHKDAIKEVLKKNKMC
ILDIDSQGVAKIKNANLDAIYVFIRPPNFETLEKRLREKSKESEDRILQR
LAVAHQEMQFGYRDGMFDLILTNDNLEKSTKELKDFIMSEVETVLKD*
back to top

protein sequence of SMED30026227-orf-2

>SMED30026227-orf-2 ID=SMED30026227-orf-2|Name=SMED30026227-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=229bp
MKRQKIYPRLCVLKNWGTSYGFHLTTRKLTNGREYHYINDVAGGSSALYA
GLLKYDKVLEVNDANIENENHKQIVKRILQNPNLVSLLVLKPDEHELFLQ
TGYSSADIKPFATVIESPDKKPNSGDKDAAANVSKESNQNSVTFDENSEN
STQKLENLVLRTDSWTPKEYDIKDESTSITSSQNFAPSPPTVDSLEMVSM
KSKRVNPRQLSKRSSLNIKEKIKILNEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR001478PDZ
IPR008145GK/Ca_channel_bsu
IPR027417P-loop_NTPase
IPR020590Guanylate_kinase_CS
IPR008144Guanylate_kin-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 61..81
NoneNo IPR availableCOILSCoilCoilcoord: 222..228
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 176..211
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 130..155
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 116..155
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..211
NoneNo IPR availablePANTHERPTHR14191PDZ DOMAIN CONTAINING PROTEINcoord: 7..208
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 8..90
e-value: 8.28636E-13
score: 59.8878
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 18..93
e-value: 2.4E-9
score: 47.0
IPR001478PDZ domainPFAMPF00595PDZcoord: 20..89
e-value: 1.3E-5
score: 25.4
IPR001478PDZ domainPROSITEPS50106PDZcoord: 9..93
score: 10.918
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 2..105
e-value: 1.0E-20
score: 75.5
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 8..95