Voltage-dependent anion channel 2

Overview
NameVoltage-dependent anion channel 2
Smed IDSMED30026226
Length (bp)1212
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Voltage-dependent anion channel 2 (SMED30026226) t-SNE clustered cells

Violin plots show distribution of expression levels for Voltage-dependent anion channel 2 (SMED30026226) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Voltage-dependent anion channel 2 (SMED30026226) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Voltage-dependent anion channel 2 (SMED30026226) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026226

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026226SMESG000081676.1 SmedASXL_019644SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior sideSMED30026226SMESG000081676.1 dd_Smed_v4_7081_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30026226SMESG000081676.1 dd_Smed_v4_7081_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Human
Match: VDAC2 (voltage dependent anion channel 2 [Source:HGNC Symbol;Acc:HGNC:12672])

HSP 1 Score: 141.739 bits (356), Expect = 1.695e-38
Identity = 82/285 (28.77%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
             + P++ D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK+T + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K++Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + +  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALEL 292          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Human
Match: VDAC2 (voltage dependent anion channel 2 [Source:HGNC Symbol;Acc:HGNC:12672])

HSP 1 Score: 141.739 bits (356), Expect = 1.695e-38
Identity = 82/285 (28.77%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
             + P++ D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK+T + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K++Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + +  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALEL 292          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Human
Match: VDAC2 (voltage dependent anion channel 2 [Source:HGNC Symbol;Acc:HGNC:12672])

HSP 1 Score: 141.354 bits (355), Expect = 2.711e-38
Identity = 82/285 (28.77%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
             + P++ D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK+T + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K++Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + +  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:   28 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALEL 307          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Human
Match: VDAC2 (voltage dependent anion channel 2 [Source:HGNC Symbol;Acc:HGNC:12672])

HSP 1 Score: 126.331 bits (316), Expect = 7.833e-33
Identity = 75/275 (27.27%), Postives = 137/275 (49.82%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGG 958
             + P++ D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK+T + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K++Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + +  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++IN G
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAG 282          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Human
Match: VDAC1 (voltage dependent anion channel 1 [Source:HGNC Symbol;Acc:HGNC:12669])

HSP 1 Score: 123.635 bits (309), Expect = 7.371e-32
Identity = 80/285 (28.07%), Postives = 136/285 (47.72%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYE----PSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLE 985
            + P + D+GK  +D+F K +  G  K+       N +    SGS N ++ K+T S +TK   +        TEKW T N + +  E+TV + +   ++L ++    P++G+K+ K K  Y  E IN   D++     P +  + +      +  Y    + F+T K R ++ ++ + Y  +   L   + +  E    I++K+    E  V  +W         G+A K +   D+   AK++ +  +  GYT   + GIKLT  A LD +N+N GGHK GL LE
Sbjct:    3 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLETKY--RWTEYGLTFTEKWNTDNTLGT--EITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWLAGY---QMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLE 280          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Celegans
Match: vdac-1 (Probable voltage-dependent anion-selective channel [Source:UniProtKB/Swiss-Prot;Acc:Q21752])

HSP 1 Score: 105.916 bits (263), Expect = 8.207e-26
Identity = 77/286 (26.92%), Postives = 133/286 (46.50%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVN--DISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVT--VIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLE 985
            M  P F D+GK  KDLF+K +  GF KI +     +  ++    + S NI SGKL  + D K   K+      LTEKW T N++ +++EV       +K  ++  Y P +G++S K K +++      + D+      P++  + +F       +  G   TFD+   + +  S    +S     L   + N  +    ++ K+ SN EVG +  WK         LA K   ++D +++AK++++  ++   T      +KLT   + +    +   HKFGL LE
Sbjct:    1 MAPPTFADLGKSAKDLFNKGYNFGFLKIDSTTRAGDNKEVEFKSAASHNIGSGKLGGNLDVKY--KIPQYGITLTEKWNTENQLGTVIEVNEQFGRGLKVTLDSLYAPHAGKRSGKVKLDWALPTARVTADVGVTS-APVINAAGVFS---RDGWLIGAAATFDSSSNKLAATSLAFGHSTPQYTLHSFVINSTDFGASLYHKVASNVEVGTQLGWKVGGNGADYALATKYAPSRDLTVRAKVNSSSQVAVAATHSLSPALKLTLSTQFNLAAND--AHKFGLGLE 278          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0100584)

HSP 1 Score: 138.658 bits (348), Expect = 8.628e-38
Identity = 82/285 (28.77%), Postives = 143/285 (50.18%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEV--QSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            M  P+++D+GK+ +D+F K +  G +K+       + I  N +G  N +SGK+  S +TK  +K  +    LTEKW T N +  +  ++  ++E +K  +E N+ P SG K+ KFK  Y  E + A  D+      P++  S++      +  Y      FDT + + +  ++ + Y+ +   L   + +  E    IF++     +VGV+ SW   T      +  K +   D+S++AK++    +  GY    RDG+ LT    +D +N N GGHK G+ LE+
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVK--DYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGYQGWLAGY---QTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQLDDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLEL 280          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0080183)

HSP 1 Score: 138.658 bits (348), Expect = 8.628e-38
Identity = 82/285 (28.77%), Postives = 143/285 (50.18%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEV--QSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            M  P+++D+GK+ +D+F K +  G +K+       + I  N +G  N +SGK+  S +TK  +K  +    LTEKW T N +  +  ++  ++E +K  +E N+ P SG K+ KFK  Y  E + A  D+      P++  S++      +  Y      FDT + + +  ++ + Y+ +   L   + +  E    IF++     +VGV+ SW   T      +  K +   D+S++AK++    +  GY    RDG+ LT    +D +N N GGHK G+ LE+
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVK--DYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGYQGWLAGY---QTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQLDDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLEL 280          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0305260)

HSP 1 Score: 138.658 bits (348), Expect = 8.628e-38
Identity = 82/285 (28.77%), Postives = 143/285 (50.18%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEV--QSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            M  P+++D+GK+ +D+F K +  G +K+       + I  N +G  N +SGK+  S +TK  +K  +    LTEKW T N +  +  ++  ++E +K  +E N+ P SG K+ KFK  Y  E + A  D+      P++  S++      +  Y      FDT + + +  ++ + Y+ +   L   + +  E    IF++     +VGV+ SW   T      +  K +   D+S++AK++    +  GY    RDG+ LT    +D +N N GGHK G+ LE+
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVK--DYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGYQGWLAGY---QTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQLDDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLEL 280          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0332029)

HSP 1 Score: 138.658 bits (348), Expect = 8.628e-38
Identity = 82/285 (28.77%), Postives = 143/285 (50.18%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEV--QSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            M  P+++D+GK+ +D+F K +  G +K+       + I  N +G  N +SGK+  S +TK  +K  +    LTEKW T N +  +  ++  ++E +K  +E N+ P SG K+ KFK  Y  E + A  D+      P++  S++      +  Y      FDT + + +  ++ + Y+ +   L   + +  E    IF++     +VGV+ SW   T      +  K +   D+S++AK++    +  GY    RDG+ LT    +D +N N GGHK G+ LE+
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVK--DYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGYQGWLAGY---QTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQLDDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLEL 280          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Fly
Match: porin (gene:FBgn0004363 transcript:FBtr0080182)

HSP 1 Score: 138.658 bits (348), Expect = 8.628e-38
Identity = 82/285 (28.77%), Postives = 143/285 (50.18%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEV--QSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            M  P+++D+GK+ +D+F K +  G +K+       + I  N +G  N +SGK+  S +TK  +K  +    LTEKW T N +  +  ++  ++E +K  +E N+ P SG K+ KFK  Y  E + A  D+      P++  S++      +  Y      FDT + + +  ++ + Y+ +   L   + +  E    IF++     +VGV+ SW   T      +  K +   D+S++AK++    +  GY    RDG+ LT    +D +N N GGHK G+ LE+
Sbjct:    1 MAPPSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVK--DYGLTLTEKWNTDNTLFTEVAVQDQLLEGLKLSLEGNFAPQSGNKNGKFKVAYGHENVKADSDVNIDLKGPLINASAVLGYQGWLAGY---QTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQEFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQLDDDASVRAKVNNASQVGLGYQQKLRDGVTLTLSTLVDGKNFNAGGHKIGVGLEL 280          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Zebrafish
Match: zgc:56235 (zgc:56235 [Source:ZFIN;Acc:ZDB-GENE-040426-954])

HSP 1 Score: 136.346 bits (342), Expect = 6.686e-37
Identity = 84/282 (29.79%), Postives = 141/282 (50.00%), Query Frame = 2
Query:  149 PNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEV--TVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            P ++D+GK  KD+F K +  G  K+       N +  N SGS N D+GK   S +TK  +K     F   +KW T N + + + V   + E +K  ++ ++ P++G+KS K K +Y  E +N S D++     P++  +++      +  Y   L+ FDT K +  + ++ + Y      L   + +  E    +++K+    E  V  +W   +     G+A K +  KD+SL AK++    +  GYT   R G+KLT  A +D +N N GGHK GL  E+
Sbjct:    5 PAYSDLGKSAKDIFSKGYGFGIVKLDLKTKSQNGVEFNTSGSTNTDTGKAAGSLETKYKLKDLGLSF--NQKWNTDNMLTTEVSVEDQLAEGLKVALDTSFVPNTGKKSGKLKTSYKREFVNVSCDLDFEG--PVVHSAAVLGYEGWLLGY---LVAFDTAKSKLVQNNFALGYKTGDFQLHTNVNDGAEFGGSVYQKVSDQLETAVTLAWTAGSNNTRFGVAAKYQLDKDASLSAKVNNASLIGIGYTQSLRPGVKLTLSALVDGKNFNTGGHKVGLGFEL 279          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Zebrafish
Match: vdac2 (voltage-dependent anion channel 2 [Source:ZFIN;Acc:ZDB-GENE-030131-845])

HSP 1 Score: 132.109 bits (331), Expect = 3.086e-35
Identity = 82/284 (28.87%), Postives = 142/284 (50.00%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSIL--EVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P + D+GK  KD+F+K +  G  K+       + +    SGS N D+ K+  S +TK   K +      TEKW T N + + +  E  + + +K   +  + P++G+KS K K  Y  E +N   D++     P +  +++   V    +  G  ++FDT K + ++ ++ + Y      L   + + +E    I++K+    E  V  +W   + +   G+A K +  KD+S+ AK++    +  GYT   R GIKLT  A +D ++IN GGHK GL LE+
Sbjct:    3 VPPAYADLGKSAKDIFNKGYGFGMVKLDVKTKSASGVEFKTSGSSNTDTSKVVGSLETKY--KRSEYGLTFTEKWNTDNTLGTEINIEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREFVNLGCDVDFDFAGPTIHGAAV---VGYEGWLAGYQMSFDTAKSKMTQNNFAVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDKLETAVNLAWTAGSNSTRFGIAAKYQLDKDASISAKVNNTSLVGVGYTQSLRPGIKLTLSALVDGKSINSGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Zebrafish
Match: vdac2 (voltage-dependent anion channel 2 [Source:ZFIN;Acc:ZDB-GENE-030131-845])

HSP 1 Score: 132.109 bits (331), Expect = 3.086e-35
Identity = 82/284 (28.87%), Postives = 142/284 (50.00%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSIL--EVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P + D+GK  KD+F+K +  G  K+       + +    SGS N D+ K+  S +TK   K +      TEKW T N + + +  E  + + +K   +  + P++G+KS K K  Y  E +N   D++     P +  +++   V    +  G  ++FDT K + ++ ++ + Y      L   + + +E    I++K+    E  V  +W   + +   G+A K +  KD+S+ AK++    +  GYT   R GIKLT  A +D ++IN GGHK GL LE+
Sbjct:    3 VPPAYADLGKSAKDIFNKGYGFGMVKLDVKTKSASGVEFKTSGSSNTDTSKVVGSLETKY--KRSEYGLTFTEKWNTDNTLGTEINIEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREFVNLGCDVDFDFAGPTIHGAAV---VGYEGWLAGYQMSFDTAKSKMTQNNFAVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDKLETAVNLAWTAGSNSTRFGIAAKYQLDKDASISAKVNNTSLVGVGYTQSLRPGIKLTLSALVDGKSINSGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Zebrafish
Match: vdac3 (voltage-dependent anion channel 3 [Source:ZFIN;Acc:ZDB-GENE-040426-2380])

HSP 1 Score: 128.257 bits (321), Expect = 1.555e-33
Identity = 79/295 (26.78%), Postives = 139/295 (47.12%), Query Frame = 2
Query:  110 NLIKVRDPESMLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTAN--EVQSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            N+   +     + P + D+GK  KD+F K +  G  K+       + +     GS N D+GK   + +TK  +K       L +KW T N    +  LE  + + +K  ++ ++ P++G+KS K K  Y  E +N   D++     P +  +++      +  Y    + FDT K + ++ ++ + Y      L   + +  E    I++K+    E  V  +W   +     G+A K +  KDSS+ AK++    +  GYT   R G+KLT  A +D++N N GGHK G+  E+
Sbjct:   27 NIDTAKHANMAVPPAYADLGKSAKDIFSKGYGFGTVKLDLKTKSQSGVEFTTGGSSNTDTGKAAGNLETKYKVKELG--LSLNQKWNTDNVLTTEVTLEDQLTKGLKLGLDTSFVPNTGKKSAKLKTGYKREYMNVGCDLDFDLAGPTVHAAAVLGYEGWLAGY---QMAFDTAKSKLAQNNFALGYKAGDFQLHTNVNDGTEFGGSIYQKVNGQLETAVNLAWTAGSNNTRFGIAAKYQLDKDSSVSAKVNNASLVGVGYTQSLRPGVKLTLSALIDAKNFNAGGHKVGMGFEL 316          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Zebrafish
Match: vdac1 (voltage-dependent anion channel 1 [Source:ZFIN;Acc:ZDB-GENE-030131-6514])

HSP 1 Score: 126.716 bits (317), Expect = 2.836e-33
Identity = 81/283 (28.62%), Postives = 139/283 (49.12%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLE 985
            + P + D+GK  +D+F K +  G  K+       N +    SGS N ++ K+  + +TK   K A +    TEKW T N + +   LE  + + +K   + ++ P++G+KS K K++Y  E IN   D++       +  + +  L   +  Y    +TF+  + R ++ ++ + Y  +   L   + +  E    I++K+  N E  V  +W         G+A K +   D++  AK++ +  +  GYT   + GIKLT  A LD +NIN GGHK GL LE
Sbjct:    3 VPPTYVDLGKSARDIFTKGYGFGLIKLDLKTRSENGLEFKSSGSANTETSKVAGTLETKY--KWAEHGLTFTEKWNTDNTLGTEITLEDQLTKGLKLTFDSSFSPNTGKKSGKIKSSYQREHINLGCDVDYDINGTAVHGALVLGLDGWLAGY---QMTFEAGRNRITQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNDNLETAVNLAWTAGNSNTRFGIAAKYQIDSDAAFSAKVNNSSLVGLGYTQTLKPGIKLTLSALLDGKNINAGGHKMGLGLE 280          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 138.272 bits (347), Expect = 2.660e-37
Identity = 84/290 (28.97%), Postives = 142/290 (48.97%), Query Frame = 2
Query:  131 PESMLA--PNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            P+  +A  P++ D+GK  +D+F+K +  G  K+         +    SGS N DSGK+  S +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K  Y  E +N   D++     P +  S++      +  Y    +TFD+ K + +K ++ + Y      L   + + +E    I++K+    E  V  +W     +   G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D +NIN GGHK GL LE+
Sbjct:    2 PDCTMAVPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKY--KWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAVVGYEGWLAGY---QMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQLDSHASISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLEL 286          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 138.272 bits (347), Expect = 4.952e-37
Identity = 90/322 (27.95%), Postives = 151/322 (46.89%), Query Frame = 2
Query:   29 VGTFTW*MVLLFLFLIYNIKSIFFKQNNLIKVRDPESMLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            V   +W  + L    +Y+    FF     + V        P++ D+GK  +D+F+K +  G  K+         +    SGS N DSGK+  S +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K  Y  E +N   D++     P +  S++   V    +  G  +TFD+ K + +K ++ + Y      L   + + +E    I++K+    E  V  +W     +   G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D +NIN GGHK GL LE+
Sbjct:    6 VSACSWAPLPLHFASVYDSAKSFFMSLGTMAV-------PPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKY--KWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAV---VGYEGWLAGYQMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQLDSHASISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLEL 315          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 136.732 bits (343), Expect = 7.096e-37
Identity = 82/284 (28.87%), Postives = 139/284 (48.94%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P++ D+GK  +D+F+K +  G  K+         +    SGS N DSGK+  S +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K  Y  E +N   D++     P +  S++      +  Y    +TFD+ K + +K ++ + Y      L   + + +E    I++K+    E  V  +W     +   G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D +NIN GGHK GL LE+
Sbjct:    3 VPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKY--KWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAVVGYEGWLAGY---QMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQLDSHASISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 136.732 bits (343), Expect = 9.943e-37
Identity = 82/284 (28.87%), Postives = 139/284 (48.94%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P++ D+GK  +D+F+K +  G  K+         +    SGS N DSGK+  S +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K  Y  E +N   D++     P +  S++      +  Y    +TFD+ K + +K ++ + Y      L   + + +E    I++K+    E  V  +W     +   G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D +NIN GGHK GL LE+
Sbjct:   15 VPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKY--KWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAVVGYEGWLAGY---QMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQLDSHASISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLEL 293          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Xenopus
Match: vdac2 (voltage-dependent anion channel 2 [Source:NCBI gene;Acc:548947])

HSP 1 Score: 136.732 bits (343), Expect = 1.339e-36
Identity = 83/284 (29.23%), Postives = 140/284 (49.30%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P++ D+GK  +D+F+K +  G  K+         +    SGS N DSGK+  S +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K  Y  E +N   D++     P +  S++   V    +  G  +TFD+ K + +K ++ + Y      L   + + +E    I++K+    E  V  +W     +   G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D +NIN GGHK GL LE+
Sbjct:   22 VPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSATGVEFATSGSSNTDSGKVNGSLETKY--KWGEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPAIHGSAV---VGYEGWLAGYQMTFDSAKSKLTKNNFAVGYKTGDFQLHTNVNDGSEFAGSIYQKVSDKMETAVNLAWTSGNNSTRFGIAAKYQLDSHASISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKNINAGGHKLGLGLEL 300          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Mouse
Match: Vdac2 (voltage-dependent anion channel 2 [Source:MGI Symbol;Acc:MGI:106915])

HSP 1 Score: 137.887 bits (346), Expect = 3.568e-37
Identity = 83/289 (28.72%), Postives = 144/289 (49.83%), Query Frame = 2
Query:  131 PESM-LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            P  M + P + D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK++ + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K+ Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + N  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++ N GGHK GL LE+
Sbjct:   10 PRPMCIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALEL 293          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Mouse
Match: Vdac2 (voltage-dependent anion channel 2 [Source:MGI Symbol;Acc:MGI:106915])

HSP 1 Score: 137.117 bits (344), Expect = 5.050e-37
Identity = 81/285 (28.42%), Postives = 142/285 (49.82%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
             + P + D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK++ + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K+ Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + N  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++ N GGHK GL LE+
Sbjct:    2 CIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Mouse
Match: Vdac2 (voltage-dependent anion channel 2 [Source:MGI Symbol;Acc:MGI:106915])

HSP 1 Score: 137.117 bits (344), Expect = 5.050e-37
Identity = 81/285 (28.42%), Postives = 142/285 (49.82%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
             + P + D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK++ + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K+ Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + N  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++ N GGHK GL LE+
Sbjct:    2 CIPPPYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVSGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSAYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRSNFAVGYRTGDFQLHTNVNNGTEFGGSIYQKVCEDFDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSFNAGGHKLGLALEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Mouse
Match: Vdac1 (voltage-dependent anion channel 1 [Source:MGI Symbol;Acc:MGI:106919])

HSP 1 Score: 121.709 bits (304), Expect = 2.125e-31
Identity = 79/285 (27.72%), Postives = 135/285 (47.37%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYE----PSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLE 985
            + P + D+GK  +D+F K +  G  K+       N +    SGS N ++ K+  S +TK   +        TEKW T N + +  E+TV + +   ++L ++    P++G+K+ K K  Y  E IN   D++     P +  + +      +  Y    + F+T K R ++ ++ + Y  +   L   + +  E    I++K+    E  V  +W         G+A K +   D+   AK++ +  +  GYT   + GIKLT  A LD +N+N GGHK GL LE
Sbjct:    3 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLETKY--RWTEYGLTFTEKWNTDNTLGT--EITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGY---QMNFETSKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLE 280          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Mouse
Match: Vdac1 (voltage-dependent anion channel 1 [Source:MGI Symbol;Acc:MGI:106919])

HSP 1 Score: 121.709 bits (304), Expect = 2.845e-31
Identity = 79/285 (27.72%), Postives = 135/285 (47.37%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYE----PSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLE 985
            + P + D+GK  +D+F K +  G  K+       N +    SGS N ++ K+  S +TK   +        TEKW T N + +  E+TV + +   ++L ++    P++G+K+ K K  Y  E IN   D++     P +  + +      +  Y    + F+T K R ++ ++ + Y  +   L   + +  E    I++K+    E  V  +W         G+A K +   D+   AK++ +  +  GYT   + GIKLT  A LD +N+N GGHK GL LE
Sbjct:   16 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVNGSLETKY--RWTEYGLTFTEKWNTDNTLGT--EITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKREHINLGCDVDFDIAGPSIRGALVLGYEGWLAGY---QMNFETSKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQVDPDACFSAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLE 293          
BLAST of Voltage-dependent anion channel 2 vs. UniProt/SwissProt
Match: sp|Q9MZ15|VDAC2_PIG (Voltage-dependent anion-selective channel protein 2 OS=Sus scrofa OX=9823 GN=VDAC2 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.041e-38
Identity = 83/289 (28.72%), Postives = 147/289 (50.87%), Query Frame = 2
Query:  131 PESM-LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            P  M + P++ D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK+T + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K++Y  E +N   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + +  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:    9 PRPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECVNLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALEL 292          
BLAST of Voltage-dependent anion channel 2 vs. UniProt/SwissProt
Match: sp|P68003|VDAC2_RABIT (Voltage-dependent anion-selective channel protein 2 OS=Oryctolagus cuniculus OX=9986 GN=VDAC2 PE=2 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 5.366e-38
Identity = 82/285 (28.77%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
             + P++ D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK+T + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K++Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + +  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALEL 292          
BLAST of Voltage-dependent anion channel 2 vs. UniProt/SwissProt
Match: sp|P68002|VDAC2_BOVIN (Voltage-dependent anion-selective channel protein 2 OS=Bos taurus OX=9913 GN=VDAC2 PE=2 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 5.893e-38
Identity = 82/285 (28.77%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
             + P++ D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK+T + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K++Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + +  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALEL 292          
BLAST of Voltage-dependent anion channel 2 vs. UniProt/SwissProt
Match: sp|P45880|VDAC2_HUMAN (Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2 PE=1 SV=2)

HSP 1 Score: 141.739 bits (356), Expect = 8.139e-38
Identity = 82/285 (28.77%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
             + P++ D+GK  +D+F+K F  G  K+       + +  + SGS N D+GK+T + +TK   K        TEKW T N + +   +E  + + +K   +  + P++G+KS K K++Y  E IN   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + +  E    I++K+  + +  V  +W   T     G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:   13 CIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKY--KWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDPTASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALEL 292          
BLAST of Voltage-dependent anion channel 2 vs. UniProt/SwissProt
Match: sp|P82013|VDAC2_MELGA (Voltage-dependent anion-selective channel protein 2 OS=Meleagris gallopavo OX=9103 GN=VDAC2 PE=1 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 5.644e-37
Identity = 82/285 (28.77%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
             + P++ D+GK  +D+F+K +  G  K+       + +    SGS N D+GK+  S +TK   K A      TEKW T N + +   +E  + + +K   +  + P++G+KS K K+ Y  E +N   D++     P +  S++F     +  Y    +TFD+ K + ++ ++ + Y      L   + + +E    I++K+  N E  V  +W   + +   G+A K +    +S+ AK++ +  +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:    1 AIPPSYADLGKSARDIFNKGYGFGLVKLDVKTKSASGVEFTTSGSSNTDTGKVNGSLETKY--KWAEYGLTFTEKWNTDNTLGTEIAIEDQIAKGLKLTFDTTFSPNTGKKSGKIKSAYKRECLNLGCDVDFDFAGPAIHGSAVFGYEGWLAGY---QMTFDSAKSKLTRNNFSVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDNLETAVNLAWTAGSNSTRFGIAAKYKLDSTASISAKVNNSSLVGVGYTQTLRPGVKLTLSALIDGKSINAGGHKLGLGLEL 280          
BLAST of Voltage-dependent anion channel 2 vs. TrEMBL
Match: A0A1E1XUP7 (Putative mitochondrial volatge dependent anion-selective channel OS=Amblyomma sculptum OX=1581419 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.164e-38
Identity = 82/285 (28.77%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSIL--EVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            M  P + D+GK+ +DLF+KN+  G  K+         +  N+SG+   D+GK+ +S +TK   K+      L EKW T N + + +  E  +   VK     N+ P +G+KS   +  Y  E ++ +GD++     PI+  +++        +  GG ++FDT K R SK ++ + +      +   + +  E    +F+++  N + GV+ +W   T     GL    +  +++S++AK++ +G +  G+T   R GI LT    LD +N N GGHK GL L++
Sbjct:    1 MAPPCYADLGKQARDLFNKNYHFGVVKLDCKSTTQTGVEFNVSGTSLNDTGKVNASLETKY--KIPEYGLTLKEKWNTDNTLSTEVCSEEKLARGVKVAFHANFAPQTGKKSGALRTAYKLENVHLNGDVDLGPPGPIVHGAAVLHYQG---WLAGGQVSFDTTKNRLSKTNFAVGFQAGDFAVHTNVNDGQEFAGSVFQRVNPNLQTGVQLAWTAGTNATRFGLGCVYDLDQETSVRAKVNNSGQIGLGFTHRLRPGISLTLSTMLDGKNFNQGGHKLGLGLDL 280          
BLAST of Voltage-dependent anion channel 2 vs. TrEMBL
Match: A0A023FJD2 (Putative mitochondrial volatge dependent anion-selective channel OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 1.164e-38
Identity = 82/285 (28.77%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSIL--EVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            M  P + D+GK+ +DLF+KN+  G  K+         +  N+SG+   D+GK+ +S +TK   K+      L EKW T N + + +  E  +   VK     N+ P +G+KS   +  Y  E ++ +GD++     PI+  +++        +  GG ++FDT K R SK ++ + +      +   + +  E    +F+++  N + GV+ +W   T     GL    +  +++S++AK++ +G +  G+T   R GI LT    LD +N N GGHK GL L++
Sbjct:    1 MAPPCYADLGKQARDLFNKNYHFGVVKLDCKSTTQTGVEFNVSGTSLNDTGKVNASLETKY--KIPEYGLTLKEKWNTDNTLSTEVCSEEKLARGVKVAFHANFAPQTGKKSGALRTAYKLENVHLNGDVDLGPPGPIVHGAAVLHYQG---WLAGGQVSFDTTKNRLSKTNFAVGFQAGDFAVHTNVNDGQEFAGSVFQRVNPNLQTGVQLAWTAGTNATRFGLGCVYDLDQETSVRAKVNNSGQIGLGFTHRLRPGISLTLSTMLDGKNFNQGGHKLGLGLDL 280          
BLAST of Voltage-dependent anion channel 2 vs. TrEMBL
Match: A0A1I8HC40 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009193g1 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.645e-38
Identity = 86/283 (30.39%), Postives = 146/283 (51.59%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQL 982
            M  P+F D+GK   DLF +++  G  K          + L  +G+ ++++G+     +TK   K  +     TEKW T+N V +   +E  +++ +K+ +E N+EP++G+KS K KN + +   N   D+E +   P L  S +F       F+GG  + +DT +Q+ +K++YG+ Y  +   L   + N       +++KL  + E GV+  W   +     G+A K +   DS  K K+D N  +   Y+F   DG+++T     D +NINGGGH+ GL L
Sbjct:    1 MAPPSFGDLGKDASDLFSRDYTFGSVKAEIKSKTSTGVELKTTGNHDMETGRAAGDLETKYVFK--DYGITFTEKWKTSNVVTAEVAIEDKLVKGLKNSLEANFEPNTGKKSAKVKNGFKSSNANLGLDLEFKSNLPTLVGSGVFGYQN---FFGGVNVGYDTERQKLTKLNYGVAYKLKDFCLYAGVENGTNFSGSVYQKLSESLETGVKLGWSSSSHATDFGVATKYKLEGDSFFKFKVDNNSMIGSAYSFKVNDGVRVTLCGNFDGKNINGGGHRLGLAL 278          
BLAST of Voltage-dependent anion channel 2 vs. TrEMBL
Match: A0A023FKR8 (Putative mitochondrial volatge dependent anion-selective channel OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 3.392e-38
Identity = 81/285 (28.42%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSIL--EVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            M  P + D+GK+ +DLF+KN+  G  K+         +  N+SG+   D+GK+ +S +TK   K+      L EKW T N + + +  E  +   +K     N+ P +G+KS   +  Y  E ++ +GD++     PI+  +++        +  GG ++FDT K R SK ++ + +      +   + +  E    +F+++  N + GV+ +W   T     GL    +  +++S++AK++ +G +  G+T   R GI LT    LD +N N GGHK GL L++
Sbjct:    1 MAPPCYADLGKQARDLFNKNYHFGVVKLDCKSTTQTGVEFNVSGTSLNDTGKVNASLETKY--KIPEYGLTLKEKWNTDNTLSTEVCSEEKLARGLKVAFHANFAPQTGKKSGALRTAYKLENVHLNGDVDLGPPGPIVHGAAVLHYQG---WLAGGQVSFDTTKNRLSKTNFAVGFQAGDFAVHTNVNDGQEFAGSVFQRVNPNLQTGVQLAWTAGTNATRFGLGCVYDLDQETSVRAKVNNSGQIGLGFTHRLRPGISLTLSTMLDGKNFNQGGHKLGLGLDL 280          
BLAST of Voltage-dependent anion channel 2 vs. TrEMBL
Match: A0A1E1X365 (Putative mitochondrial volatge dependent anion-selective channel OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 5.974e-38
Identity = 80/285 (28.07%), Postives = 145/285 (50.88%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSIL--EVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            M  P + D+GK+ +DLF+KN+  G  K+         +  N+SG+   D+GK+ +S +TK   K+      L EKW T N + + +  E  +   +K+    N+ P +G+KS   +  Y  E ++ +GD++     PI+  +++        +  GG ++FDT K R SK ++ + +      +   + +  E    +F+++    + GV+ +W   T     GL    +  +++S++AK++ +G +  G+T   R GI LT    LD +N N GGHK GL L++
Sbjct:    1 MAPPCYADLGKQARDLFNKNYHFGVVKLDCKSTTQTGVEFNVSGTSLNDTGKVNASLETKY--KIPEYGLTLKEKWNTDNTLSTEICSEEKLARGLKAAFHANFAPQTGKKSGALRTAYKLENVHLNGDVDLGPPGPIVHGAAVLHYQG---WLAGGQVSFDTTKNRLSKTNFAVGFQAGDFAVHTNVNDGQEFAGSVFQRVNPQLQTGVQLAWTAGTNATRFGLGCVYDLDQETSVRAKVNNSGQIGLGFTHRLRPGISLTLSTMLDGKNFNQGGHKLGLGLDL 280          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Cavefish
Match: vdac2 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:103037680])

HSP 1 Score: 135.191 bits (339), Expect = 1.750e-36
Identity = 83/286 (29.02%), Postives = 146/286 (51.05%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYE----PSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P + D+GK  KD+F+K +  G  K+       + +    SGS N D+ K+  S +TK   K +      TEKW T N + +  E+T+ + +   ++L ++    P++G+KS K K  Y  E +N   D++     P +  +++   V    +  G  ++FDT K + ++ ++ + Y      L   + + +E    I++K+  N E  V  +W   + +   G+A K +  KD+S+ AK++    +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:    3 VPPCYADLGKSAKDIFNKGYGFGLVKLDVKTKSSSGVEFKTSGSSNTDTSKVVGSLETKY--KRSEYGLTFTEKWNTDNTLGT--EITIEDQIAKGLKLTFDTTFSPNTGKKSGKVKTAYKREFVNLGCDVDFDFAGPTIHGAAV---VGYEGWLAGYQMSFDTAKSKMTQNNFAVGYKTGDFQLHTNVNDGSEFGGSIYQKVSDNLETAVNLAWTAGSNSTRFGIAAKYQLDKDASISAKVNNTSLVGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Cavefish
Match: VDAC2 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:103040512])

HSP 1 Score: 134.42 bits (337), Expect = 3.161e-36
Identity = 84/286 (29.37%), Postives = 142/286 (49.65%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYE----PSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P + D+GK  KD+F+K +  G  K+       N +    SGS N D+ K+T + +TK   K        TEKW T N + +  E+TV + +   ++L ++    P++G+KS K K  Y  E +N   D++     P +  +++      +  Y    +TFDT K + ++ ++ I Y      L   + + +E    I++K+    E  V  +W     +   G+A K +    SS+ AK++ +  +  GYT   R G+KLT  A +D ++IN GGHK GL LE+
Sbjct:    3 VPPAYADLGKSAKDIFNKGYGFGLVKLDVKTKSANGVEFKTSGSSNTDTNKVTGNLETKY--KWDEYGLTFTEKWNTDNTLGT--EITVEDQITKGLKLTFDTTFSPNTGKKSGKVKTAYKREFLNVGCDVDFDFAGPAVHGAAVLGFEGWLAGY---QMTFDTAKSKMTRNNFAIGYKTGDFQLHTNVNDGSEFGGSIYQKVNDELETAVNLAWTAGNNSTRFGIAAKYQLDSSSSISAKVNNSSLVGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Cavefish
Match: vdac3 (voltage dependent anion channel 3 [Source:NCBI gene;Acc:103039704])

HSP 1 Score: 129.028 bits (323), Expect = 3.356e-34
Identity = 78/282 (27.66%), Postives = 140/282 (49.65%), Query Frame = 2
Query:  149 PNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            P + D+GK  KD+F K +  G  K+       + +  +  GS N D+GK + + +TK  +K    +F   +KW T N + +   +E  + + +K  ++ ++ P++G+KS K K  Y  E +N   DI+     P +  +++      +  Y    + FDT K + ++ ++ + Y      L   + +  E    I++K+ S  E  V  +W   +     G+A K +  KD+S+ AK++    +  GYT   R G+KLT  A +D++N N GGHK G+  E+
Sbjct:    5 PAYADLGKSAKDIFSKGYGFGTVKLDLKTKSQSGVEFSTGGSSNTDTGKASGNLETKYKVKDLGLNF--NQKWNTDNTLTTEISMEDQLAKGLKLGLDTSFVPNTGKKSAKLKTGYKREYMNVGCDIDFDLAGPTVHAAAVLGYEGWLAGY---QMAFDTAKSKLAQNNFALGYKAGDFQLHTNVNDGTEFGGSIYQKVNSELETAVNLAWTAGSNNTRFGIAAKYQLDKDASVSAKVNNASLVGVGYTQALRPGVKLTLSALIDAKNFNAGGHKVGMGFEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Cavefish
Match: vdac1 (voltage dependent anion channel 1 [Source:NCBI gene;Acc:103024199])

HSP 1 Score: 127.102 bits (318), Expect = 1.877e-33
Identity = 83/282 (29.43%), Postives = 139/282 (49.29%), Query Frame = 2
Query:  149 PNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            P + D+GK  KD+F K +  G  K+       N +    +GS N ++ K++ + +TK   K A +    TEKW T N + +   LE  + + +K   + ++ P++G+KS K K+ Y  E IN   D++   I       ++  +V    +  G  +TF+  K R ++ ++ + Y  +   L   + +  E    I++K+    E  V  +W         G+A K +   D+S  AK++ +  +  GYT   + GIKLT  A LD +NIN GGHK GL LE+
Sbjct:    5 PTYVDLGKSAKDVFTKGYGFGLIKLDLKTKSENGLEFKSAGSANTETSKVSGALETKY--KWAEHGLTFTEKWNTDNTLGTEITLEDQLAKGLKLTFDSSFSPNTGKKSGKIKSGYKREHINLGCDVD-YDINGTAVHGAV--VVGYEGWLAGYQMTFEAGKNRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNDKLETAVNLAWTAGNSNTRFGIAAKYQIDADASFSAKVNNSSLVGLGYTQTLKPGIKLTLSALLDGKNINAGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Cavefish
Match: vdac3 (voltage dependent anion channel 3 [Source:NCBI gene;Acc:103039704])

HSP 1 Score: 98.5969 bits (244), Expect = 1.893e-22
Identity = 65/257 (25.29%), Postives = 122/257 (47.47%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDG 907
            + P + D+GK  KD+F K +  G  K+       + +  +  GS N D+GK + + +TK  +K    +F   +KW T N + +   +E  + + +K  ++ ++ P++G+KS K K  Y  E +N   DI+     P +  +++      +  Y    + FDT K + ++ ++ + Y      L   + +  E    I++K+ S  E  V  +W   +     G+A K +  KD+S+ AK++    +  GYT   R G
Sbjct:   80 VPPAYADLGKSAKDIFSKGYGFGTVKLDLKTKSQSGVEFSTGGSSNTDTGKASGNLETKYKVKDLGLNF--NQKWNTDNTLTTEISMEDQLAKGLKLGLDTSFVPNTGKKSAKLKTGYKREYMNVGCDIDFDLAGPTVHAAAVLGYEGWLAGY---QMAFDTAKSKLAQNNFALGYKAGDFQLHTNVNDGTEFGGSIYQKVNSELETAVNLAWTAGSNNTRFGIAAKYQLDKDASVSAKVNNASLVGVGYTQALRPG 331          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Sea Lamprey
Match: vdac2 (voltage-dependent anion channel 2 [Source:ZFIN;Acc:ZDB-GENE-030131-845])

HSP 1 Score: 140.198 bits (352), Expect = 4.898e-39
Identity = 84/282 (29.79%), Postives = 147/282 (52.13%), Query Frame = 2
Query:  149 PNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEV--TVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            P F D+GK  +D+F K F  G  K+       + +  + SGS N ++GK+ +S +TK   K A+    LTEKW+T N + + + V   + + +K  ++  + P++G+KS K K+ Y  E +N   D++     P +  +++   V    +  G  + FDT K + ++ ++ I Y      L   + +  E    I++K+    E  V+ +W   + T   G+A K +   ++++ AK++ +  +  GYT   R G+KL+  A LD +NIN GGHK GL LE+
Sbjct:    5 PTFVDLGKSARDVFSKGFGFGLVKLDLKTKTSSGVEFSTSGSSNSETGKVNASLETKY--KWADYGLNLTEKWSTDNTLATEISVEDQLAKGLKLTLDTTFAPNTGKKSGKLKSTYKREYLNLGCDVDLDFAGPTVNGAAV---VGYEGWLAGYQLAFDTAKSKLTRSNFAIGYKTADFQLHTNVNDGTEFGGNIYQKVNDKLETAVDLAWTAGSNTTRFGIAAKYQLDSNTTINAKVNNSSLVGLGYTQTLRPGVKLSLSALLDGKNINAGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005399.1 (pep scaffold:Pmarinus_7.0:GL479471:12985:19564:-1 gene:ENSPMAG00000004891.1 transcript:ENSPMAT00000005399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 1.223e-22
Identity = 65/282 (23.05%), Postives = 131/282 (46.45%), Query Frame = 2
Query:  149 PNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEV--TVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            P F  +G+  +++F K +  G  K+       + +  N  G+ + DSG+++ + +T+ +     +   L E W+T N + + + V   + + ++   + ++ P++G+K+   K  Y+   ++A+ D++     PI+  S +      +  Y  GL   D  K++ +     + Y  E   L   + +  E     F+++    +  V  +W      P   L    +  +++S+  K+++   L   YT   R G+KL+    LD +NIN GGHK GL LE+
Sbjct:    5 PFFESLGEAAREVFTKGYGFGLVKLDFTTRAASGVEFNTRGASHTDSGRVSGALETRYSWP--EHGLRLVECWSTDNCLGTRISVDDQLAKGLQLVFDTSFSPNTGKKTGLVKVLYARPFVSATTDVDVSLGGPIVASSVVLAARGWLAGYHMGL---DVGKRKITSNRISLGYMTEDFQLLTNVVDGVEFSGSYFQRVSERLDTAVRLAWSAGAPHPRFTLGGTYKIDQNASVSGKMNSASLLGLSYTQALRPGVKLSLCGLLDVKNINSGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Yeast
Match: POR1 (Mitochondrial porin (voltage-dependent anion channel); outer membrane protein required for maintenance of mitochondrial osmotic stability and mitochondrial membrane permeability; couples the glutathione pools of the intermembrane space (IMS) and the cytosol; interacts with Om45 and Om14 in the outer membrane; phosphorylated; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000005000])

HSP 1 Score: 59.3066 bits (142), Expect = 2.197e-10
Identity = 66/302 (21.85%), Postives = 115/302 (38.08%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNF----PAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEM---INASGDIECRQIEPILTLSSIFKLVRSIPFY------------GGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSS--LKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQL 982
            M  P ++DI + I DL +K+F    PA F          N I  ++   Q +  G L+++ + K+N K       LT+ W+  N +Q+ LE             N  P         KN   T +   +  S  +     +P  T    F L    P +            GG    +D      S+ +  + Y  +  +L   L N        F+ + +  +VG +++         + +     +  D+S  +KAK+  +G ++  Y  L R G+ L  G+  D+  ++   HK G  L
Sbjct:    1 MSPPVYSDISRNINDLLNKDFYHATPAAF---DVQTTTANGIKFSLKAKQPVKDGPLSTNVEAKLNDK--QTGLGLTQGWSNTNNLQTKLEFA-----------NLTPG-------LKNELITSLTPGVAKSAVLNTTFTQPFFTARGAFDLCLKSPTFVGDLTMAHEGIVGGAEFGYDISAGSISRYAMALSYFAKDYSLGATLNNEQITTVDFFQNVNAFLQVGAKATMNCKLPNSNVNIEFATRYLPDASSQVKAKVSDSGIVTLAYKQLLRPGVTLGVGSSFDALKLSEPVHKLGWSL 279          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Nematostella
Match: EDO31835 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWS9])

HSP 1 Score: 131.724 bits (330), Expect = 1.178e-35
Identity = 80/282 (28.37%), Postives = 147/282 (52.13%), Query Frame = 2
Query:  155 FNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYE----PSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + D+GK  +D+F K +  G  K+       N +    +GS   D+GK+  S +TK   K ++    L+EKWTT N + S  E+TV + +   ++L ++    P++G+KS K K  Y  + ++A+GD++     P +  S++   V    ++ G  + +DT K +    ++ + Y  +   +   + + ++    I+ ++  N EV  + +W   +         K +  KD++L+AK++ N +L   YT   RDGIK T  + +D++N+N GGHK GL LE+
Sbjct:    8 YEDLGKEARDVFGKGYGFGCVKVDLKTTTKNGVEFKTAGSSMNDTGKVFGSLETKY--KYSDYGISLSEKWTTDNVLSS--EITVEDQIAKGLKLQFDTTFAPNTGKKSAKIKTAYKQDYLHATGDVDFDFAGPTVQGSAV---VGYEGWHAGYQVAYDTSKSKLIANNFSLGYRAKDFQIHSAVNDASKFTGSIYHQISKNLEVAAQLNWATGSSNTSFQGGCKYDVDKDTTLRAKVNNNSHLGLAYTQRLRDGIKATVSSHIDTKNLNQGGHKLGLSLEM 282          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Medaka
Match: VDAC2 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:101154906])

HSP 1 Score: 137.502 bits (345), Expect = 2.202e-37
Identity = 85/286 (29.72%), Postives = 143/286 (50.00%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYE----PSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P + D+GK  KD+F K +  G  K+       + +    SGS N D+ K+T + +TK   KL       TEKW+T N + +  EV V + +   ++LN++    P++G+KS K K  Y  E +NA  D++     P +  +++      +  Y    +TFD+ K R ++ ++ + Y+     L   + +  E    I++K+    E  V  +W   +     G+A K +    +S+ AK++    +  GYT   R G+KLT  A +D +NIN GGHK GL LE+
Sbjct:    3 VPPAYADLGKSAKDIFSKGYGFGLVKLDVKTKSSSGVEFKTSGSSNTDTSKVTGTLETKY--KLPEYGLTFTEKWSTENTLGT--EVCVEDQITKGLKLNFDTTFSPNTGKKSGKIKAAYKKEHVNAGVDVDLDFAGPTIHAAAVGGYEGWLAGY---QMTFDSAKSRMTRSNFAVGYTTGDFQLHTNVNDGAEFGGSIYQKVNDKLETAVNLAWTVGSNGTLFGIAAKYQLDPSASISAKVNNASLVGIGYTQTLRPGMKLTLSAMVDGKNINAGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Medaka
Match: vdac2 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:101173732])

HSP 1 Score: 133.65 bits (335), Expect = 6.765e-36
Identity = 82/286 (28.67%), Postives = 142/286 (49.65%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYE----PSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P + D+GK  KD+FDK +  G  K+       + +    SGS N D+ K++ + +TK   K A      TEKW T N + +  E+T+ + +   ++L ++    P++G+KS K K  Y  E +N   D++     P +  + +      +  Y    ++FDT K +  + ++ I Y      L   + + +E    I++K+    E  V  +W   + +   G+  K +  KD+S+ AK++ N  +  GYT   R G+KLT    +D ++IN GGHK GL LE+
Sbjct:    3 VPPAYADLGKSAKDIFDKGYGFGVVKLDVKTKSASGVEFKTSGSSNTDTSKVSGTLETKY--KRAEYGLTFTEKWNTDNTLGT--EITIEDQIAKGLKLTFDTTFSPNTGKKSGKVKAAYKREYVNLGCDVDFDFAGPTIHGNGVVGYEGWLAGY---QMSFDTAKSKMIRNNFAIGYKTGDFQLHTNVNDGSEFGGSIYQKVSDKLETAVSLAWTAGSNSTRFGIGAKYQLDKDASISAKVNNNSLVGVGYTQTLRPGVKLTLAGLVDGKSINAGGHKLGLGLEL 281          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Medaka
Match: vdac3 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:101170932])

HSP 1 Score: 134.035 bits (336), Expect = 1.330e-35
Identity = 81/291 (27.84%), Postives = 143/291 (49.14%), Query Frame = 2
Query:  125 RDPESM-LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P +M + P ++D+GK  KD+F+K F  G  K+       + +    SGS N D+GK     +TK   KL        +KW T N + +   +E  + + +K  ++ ++ P++G+KS K K  Y  E +N   D++     P +  +++      +  Y    + FDT K + ++ ++ + Y      L   + +  E    I++K+ ++ E  V  +W   +     G+  K +  KD+SL  K++    +  GYT   R G+KLT  A +D +N+NGGGHK GL  E+
Sbjct:   35 KSPGTMAVPPAYSDLGKSAKDIFNKGFGYGVLKLDIKTKSQSGVEFATSGSNNTDTGKSGGHLETKY--KLNELGLSFNQKWNTDNTLTTEITMEDQLAKGLKLGLDSSFVPNTGKKSAKLKTGYKREYMNLGCDLDFDMAGPTVHAAAVLGYEGWLAGY---QLAFDTAKSKLAQNNFALGYKAGDFQLHTHVNDGTEFGGSIYQKVNNSLETAVHLAWTAGSNNTRFGIGAKYQLDKDASLSTKVNNACLVGVGYTHTLRPGVKLTLSAMIDGKNVNGGGHKVGLGFEL 320          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Medaka
Match: zgc:56235 (voltage-dependent anion-selective channel protein 2 [Source:NCBI gene;Acc:101162768])

HSP 1 Score: 122.094 bits (305), Expect = 1.063e-31
Identity = 82/282 (29.08%), Postives = 138/282 (48.94%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            + P+++D+GK  KD+F K +  G  K+       + +  N SGS N D+GK + S +TK  MK       +T+KW T N + +  EVTV + V+  +  +  P   +KS K K  Y  + +N   D++     PI+  +++      +  Y    + FDT K + S+ ++ + Y      L   + +  E    I++K+    E  V  +W   +     G+A K +  KD+SL  K++    +  GYT   R G+K+T  A +D +N N GGHK G+  E+
Sbjct:    3 VPPSYSDLGKAAKDIFSKGYGFGLVKLDLKTKSQSGVEFNTSGSSNTDTGKASGSLETKYKMKEVG--LSVTQKWNTDNTLGT--EVTVEDQVR--LFSSTLPPFRKKSGKLKTGYKRDYVNLGCDVDFEG--PIIHAAAVLGYEGWLLGY---QMAFDTAKSKLSQNNFALGYRAGDFQLHTNVNDGTEFGGSIYQKVNDELETAVTLAWTAGSNNTRFGVAGKYKLDKDASLSVKVNNASLIGVGYTQSLRSGVKVTLSALIDGKNFNAGGHKVGMGFEL 273          
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Medaka
Match: vdac1 (voltage dependent anion channel 1 [Source:NCBI gene;Acc:101173964])

HSP 1 Score: 120.553 bits (301), Expect = 4.521e-31
Identity = 76/283 (26.86%), Postives = 135/283 (47.70%), Query Frame = 2
Query:  143 LAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQS--ILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLE 985
            + P + D+GK  +D+F K +  G  K+       N +    +GS N ++ K+  S +TK   K A +    TEKW T N + +   +E  + + +K  ++ ++ P++G+K  K K  Y  + +N   D+        +  +++      +  Y    +TF+  + + ++ ++ + Y  +   L   + +  E    I++K+    E  V  SW         G+A K +   D+S  AK++ +  +  GYT   + GIKLT  A LD +NIN GGHK GL LE
Sbjct:    3 VPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSTGSANTETSKVAGSLETKY--KWAEHGLTFTEKWNTDNTLGTEITVEDQLAKGLKLTLDSSFSPNTGKKGGKVKTAYKCDHVNVGCDVNYDINGTAIHGAAVVGYEGWLAGY---QMTFEAGRNKVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNEQLETAVNLSWTAGNSNTRFGIAAKYQIDPDASFSAKVNNSSLVGLGYTQTLKPGIKLTLSALLDGKNINAGGHKLGLGLE 280          
BLAST of Voltage-dependent anion channel 2 vs. Planmine SMEST
Match: SMESG000081676.1 (SMESG000081676.1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 280/283 (98.94%), Postives = 282/283 (99.65%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 988
            MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKL SSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYG+QYSNETTNLTGLLTNHNEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLA+KREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV
Sbjct:    1 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLISSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGVQYSNETTNLTGLLTNHNEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAMKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQLEV 283          
BLAST of Voltage-dependent anion channel 2 vs. Planmine SMEST
Match: SMESG000071615.1 (SMESG000071615.1)

HSP 1 Score: 180.644 bits (457), Expect = 4.153e-54
Identity = 95/261 (36.40%), Postives = 163/261 (62.45%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTF 922
            M  P+F+D+GK+ KDLF+K FPAGFFK+SA FP+   +++N +GS N+D+G+ + + + K+ +  +     L EKWT  NE  S +E+    ++ + +E+  EP++G+ S+K KN+Y ++ I  SGDI+ + ++P ++LS +  L++SIP +GGG +T+D  K +  +++YG+Q   +       L N+ E + QI  K+    ++GVES W  + KT   G   +      S +KAK+++ G+LS GY F+  +G KL++
Sbjct:    1 MSQPSFSDLGKKFKDLFNKQFPAGFFKLSAKFPETKGLAVNFNGSLNMDTGQFSPNLELKIPIS-SYGGITLIEKWTAKNEFLSSIEMKPTSSLTNALEVTLEPTNGQTSIKTKNSYKSDSITTSGDIKFKTLKPEISLSIMTNLIQSIPLHGGGSVTYDFNKNKIKEINYGLQID-KGDICLSSLGNNKEFMAQICMKISDQVDIGVESGWNQELKTTTFGTVSQLRLDSGSLVKAKVESTGFLSLGYCFVFVEG-KLSY 258          
BLAST of Voltage-dependent anion channel 2 vs. Planmine SMEST
Match: SMESG000053095.1 (SMESG000053095.1)

HSP 1 Score: 139.428 bits (350), Expect = 3.967e-38
Identity = 88/283 (31.10%), Postives = 141/283 (49.82%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANE--VQSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQL 982
            M+ P+F D+GK  KDLF+KNF  G   +         + L I G  ++ +GKL  S + K   +   N    + KW T NE  V   +E  +    K   +L + P SG K MK + ++  + +N   D+    ++PIL  S +     S  +  G  IT+D  +   ++  + I Y  +  +L G L N  +I   I++++  N EVGV+  W  +++    G+A K +F   S  K KID    L  GY F ARD + +T  A++D +++  GGH+FG+ L
Sbjct:    1 MIPPSFCDLGKTTKDLFNKNFHFGLLSVEYLSKSAQGVELTIKGDNSLKAGKLNGSLEWKYKFE---NGLKNSVKWDTKNELGVNFSIENFIKTGSKLSADLGFNPDSGNKKMKMQTSFKRKYLNCGLDMCFTNLKPILIPSLVIGCTESKGYLLGAEITYDLNRMDLTRHKFSIGYHKDDLSLIGSLINKTDIETHIYQRINPNVEVGVQIKWNWNSRNTEFGVAGKYQFDNSSIFKGKIDNKSILGLGYIFRARDNVDITLNAEIDGKDLEKGGHRFGMGL 280          
BLAST of Voltage-dependent anion channel 2 vs. Planmine SMEST
Match: SMESG000013661.1 (SMESG000013661.1)

HSP 1 Score: 107.071 bits (266), Expect = 3.120e-26
Identity = 69/285 (24.21%), Postives = 144/285 (50.53%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTV--IENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKR--EFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGLQL 982
            M+ P+F+D+G+  KDLFDK +  G + +     K +  S+ I G+ NI S  L+ +F+T       N    +   W+T N + + L   V  I+ +K    +++EP +G+KS+  KN+Y  + +N + ++  + ++P + L+ +       P+  G  + FD   Q     ++ I Y      ++  + + +     I++K+  NT++G+  ++  ++K     +A +     +  S +K KI+ +  + F Y     DG++L+  +++D++ +  G + FGL +
Sbjct:    1 MIPPSFSDLGRAAKDLFDKKYKFGLYNVEV-CSKNDTASVAIKGNHNIKSSSLSGTFET---THTTNYGIDIKNTWSTKNVLTTELSKVVKSIKGLKCVGIMSFEPDTGKKSLNAKNSYKRDYLNINSELVFKNLKPDVNLNLVLGCSYPKPYLAGLDLNFDINNQHLKNHTFAIGYEKSDFGISTSMKDLSLFNTYIYQKINKNTDIGIHVTYNKNSKISKYEIAAQYMIPHSDRSYVKGKINQDLIMGFVYGCNINDGVQLSLSSEIDAKKLESGPYNFGLAI 281          
BLAST of Voltage-dependent anion channel 2 vs. Planmine SMEST
Match: SMESG000000196.1 (SMESG000000196.1)

HSP 1 Score: 100.908 bits (250), Expect = 6.197e-24
Identity = 73/283 (25.80%), Postives = 140/283 (49.47%), Query Frame = 2
Query:  140 MLAPNFNDIGKRIKDLFDKNFPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDFLLTEKWTTANEVQSILEVTV--IENVKSCIELNYEPSSGRKSMKFKNNYSTEMINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVSYGIQYSXXXXXXXXXXXXXXEILFQIFKKLFSNTEVGVESSWKHDTKTPGIGLAIKREF--TKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNINGGGHKFGL 976
            M+ P+F+D+GK  KDLFDK F  G   +     K +  +L +    +  +  L+ +F+ K +   A  D  +T KW T+N V + +  T   I+ +K+   L +EP++G KS+ FK++Y  E +N + +      +P + L+ +       P+  G  +T DT  ++    ++ + Y          + N +     +++K+ S  ++GV  S     K    G+A + +F  + DS +K KI+ +  +   Y     +G++LT  +++D + ++ G H FG+
Sbjct:    1 MIPPSFSDLGKAAKDLFDKKFLVGVSNVEI-ITKKDARTLTVKSKHDHKTKDLSGNFELKHSNIKAGLD--MTLKWCTSNVVVAEISKTYERIKGLKNVGILTFEPNTGLKSLNFKDSYKREYLNINSEFLFNSKKPDINLNMVLGCTHPKPYLTGVDLTIDTEGKKLRNHTFALGYQKSDFGALITVKNLSMFNAYVYQKISSFVDIGVHVSHNKANKENKYGIAGQYQFPDSDDSFIKLKINQDTMIGLVYGCTLNNGVQLTLSSEIDGKKLDTGPHNFGV 280          
The following BLAST results are available for this feature:
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VDAC21.695e-3828.77voltage dependent anion channel 2 [Source:HGNC Sym... [more]
VDAC21.695e-3828.77voltage dependent anion channel 2 [Source:HGNC Sym... [more]
VDAC22.711e-3828.77voltage dependent anion channel 2 [Source:HGNC Sym... [more]
VDAC27.833e-3327.27voltage dependent anion channel 2 [Source:HGNC Sym... [more]
VDAC17.371e-3228.07voltage dependent anion channel 1 [Source:HGNC Sym... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vdac-18.207e-2626.92Probable voltage-dependent anion-selective channel... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
porin8.628e-3828.77gene:FBgn0004363 transcript:FBtr0100584[more]
porin8.628e-3828.77gene:FBgn0004363 transcript:FBtr0080183[more]
porin8.628e-3828.77gene:FBgn0004363 transcript:FBtr0305260[more]
porin8.628e-3828.77gene:FBgn0004363 transcript:FBtr0332029[more]
porin8.628e-3828.77gene:FBgn0004363 transcript:FBtr0080182[more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:562356.686e-3729.79zgc:56235 [Source:ZFIN;Acc:ZDB-GENE-040426-954][more]
vdac23.086e-3528.87voltage-dependent anion channel 2 [Source:ZFIN;Acc... [more]
vdac23.086e-3528.87voltage-dependent anion channel 2 [Source:ZFIN;Acc... [more]
vdac31.555e-3326.78voltage-dependent anion channel 3 [Source:ZFIN;Acc... [more]
vdac12.836e-3328.62voltage-dependent anion channel 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vdac22.660e-3728.97voltage-dependent anion channel 2 [Source:NCBI gen... [more]
vdac24.952e-3727.95voltage-dependent anion channel 2 [Source:NCBI gen... [more]
vdac27.096e-3728.87voltage-dependent anion channel 2 [Source:NCBI gen... [more]
vdac29.943e-3728.87voltage-dependent anion channel 2 [Source:NCBI gen... [more]
vdac21.339e-3629.23voltage-dependent anion channel 2 [Source:NCBI gen... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vdac23.568e-3728.72voltage-dependent anion channel 2 [Source:MGI Symb... [more]
Vdac25.050e-3728.42voltage-dependent anion channel 2 [Source:MGI Symb... [more]
Vdac25.050e-3728.42voltage-dependent anion channel 2 [Source:MGI Symb... [more]
Vdac12.125e-3127.72voltage-dependent anion channel 1 [Source:MGI Symb... [more]
Vdac12.845e-3127.72voltage-dependent anion channel 1 [Source:MGI Symb... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9MZ15|VDAC2_PIG5.041e-3828.72Voltage-dependent anion-selective channel protein ... [more]
sp|P68003|VDAC2_RABIT5.366e-3828.77Voltage-dependent anion-selective channel protein ... [more]
sp|P68002|VDAC2_BOVIN5.893e-3828.77Voltage-dependent anion-selective channel protein ... [more]
sp|P45880|VDAC2_HUMAN8.139e-3828.77Voltage-dependent anion-selective channel protein ... [more]
sp|P82013|VDAC2_MELGA5.644e-3728.77Voltage-dependent anion-selective channel protein ... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1E1XUP71.164e-3828.77Putative mitochondrial volatge dependent anion-sel... [more]
A0A023FJD21.164e-3828.77Putative mitochondrial volatge dependent anion-sel... [more]
A0A1I8HC401.645e-3830.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A023FKR83.392e-3828.42Putative mitochondrial volatge dependent anion-sel... [more]
A0A1E1X3655.974e-3828.07Putative mitochondrial volatge dependent anion-sel... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vdac21.750e-3629.02voltage-dependent anion-selective channel protein ... [more]
VDAC23.161e-3629.37voltage-dependent anion-selective channel protein ... [more]
vdac33.356e-3427.66voltage dependent anion channel 3 [Source:NCBI gen... [more]
vdac11.877e-3329.43voltage dependent anion channel 1 [Source:NCBI gen... [more]
vdac31.893e-2225.29voltage dependent anion channel 3 [Source:NCBI gen... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vdac24.898e-3929.79voltage-dependent anion channel 2 [Source:ZFIN;Acc... [more]
ENSPMAT00000005399.11.223e-2223.05pep scaffold:Pmarinus_7.0:GL479471:12985:19564:-1 ... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
POR12.197e-1021.85Mitochondrial porin (voltage-dependent anion chann... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO318351.178e-3528.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VDAC22.202e-3729.72voltage-dependent anion-selective channel protein ... [more]
vdac26.765e-3628.67voltage-dependent anion-selective channel protein ... [more]
vdac31.330e-3527.84voltage-dependent anion-selective channel protein ... [more]
zgc:562351.063e-3129.08voltage-dependent anion-selective channel protein ... [more]
vdac14.521e-3126.86voltage dependent anion channel 1 [Source:NCBI gen... [more]
back to top
BLAST of Voltage-dependent anion channel 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081676.10.000e+098.94SMESG000081676.1[more]
SMESG000071615.14.153e-5436.40SMESG000071615.1[more]
SMESG000053095.13.967e-3831.10SMESG000053095.1[more]
SMESG000013661.13.120e-2624.21SMESG000013661.1[more]
SMESG000000196.16.197e-2425.80SMESG000000196.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026226 ID=SMED30026226|Name=Voltage-dependent anion channel 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1212bp
TTTTGTTTCCAGGTAAATGTTCAAACACGTTGGGACATTTACATGGTAAA
TGGTATTACTTTTTTTATTTTTAATTTACAATATAAAGTCAATATTTTTT
AAACAAAATAATTTAATTAAAGTTCGTGACCCAGAAAGCATGTTAGCGCC
AAATTTTAATGATATTGGTAAAAGAATTAAAGATTTATTTGATAAAAATT
TCCCAGCTGGTTTTTTTAAAATATCAGCTAATTTTCCTAAAGTTAATGAT
ATTTCATTAAATATAAGTGGTTCACAAAATATAGATTCTGGGAAGTTGAC
TTCTTCGTTCGACACTAAAATGAATATGAAATTGGCCAACAATGATTTTT
TACTTACTGAAAAATGGACTACAGCCAATGAAGTCCAAAGTATTTTGGAA
GTTACCGTCATAGAAAATGTCAAAAGTTGCATTGAATTAAATTATGAGCC
AAGTAGTGGGAGAAAATCGATGAAATTCAAAAATAATTACTCGACGGAGA
TGATTAACGCGTCTGGAGACATAGAATGTCGACAAATCGAACCGATATTG
ACTCTTAGTTCAATTTTCAAATTAGTTCGATCTATTCCGTTTTACGGAGG
AGGTTTAATAACTTTTGATACATACAAACAGAGATTTTCAAAGGTTTCGT
ATGGTATTCAATATAGCAATGAAACCACAAATTTAACGGGATTATTAACA
AATCATAATGAAATATTATTTCAAATTTTTAAAAAATTATTCTCAAACAC
GGAAGTTGGAGTCGAATCTTCTTGGAAACATGACACAAAAACACCTGGAA
TAGGTTTAGCAATAAAGCGTGAATTTACAAAAGATAGTTCGTTGAAGGCA
AAAATAGACACTAATGGATACCTTTCGTTTGGGTATACATTTCTCGCGCG
TGACGGTATTAAATTGACTTTTGGAGCTAAGCTTGACAGCAGGAACATCA
ACGGAGGCGGTCATAAGTTTGGTTTACAGCTAGAAGTTTGATAGGAATAA
TAAATAATAAAGATTGTGATACAATTGCATTTAAATTAGAAATTTTGTTC
TCTACAAGTGCACGTGTTTTGTTTAATTAGATAAATAATGTGAAAAATAA
AGGCGTAAAATTTTAAGTCTCGCCGGGCTCTAGTAAGTACCGCTATTGCT
GTCGTTAAAAATTCGATGGATTTAAAGTTGTGTTTATCGATTACATATTC
ATAAAAGCAGAT
back to top

protein sequence of SMED30026226-orf-1

>SMED30026226-orf-1 ID=SMED30026226-orf-1|Name=SMED30026226-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=314bp
MVLLFLFLIYNIKSIFFKQNNLIKVRDPESMLAPNFNDIGKRIKDLFDKN
FPAGFFKISANFPKVNDISLNISGSQNIDSGKLTSSFDTKMNMKLANNDF
LLTEKWTTANEVQSILEVTVIENVKSCIELNYEPSSGRKSMKFKNNYSTE
MINASGDIECRQIEPILTLSSIFKLVRSIPFYGGGLITFDTYKQRFSKVS
YGIQYSNETTNLTGLLTNHNEILFQIFKKLFSNTEVGVESSWKHDTKTPG
IGLAIKREFTKDSSLKAKIDTNGYLSFGYTFLARDGIKLTFGAKLDSRNI
NGGGHKFGLQLEV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005741mitochondrial outer membrane
GO:0005739mitochondrion
GO:0016020membrane
GO:0016021integral component of membrane
GO:0046930pore complex
Vocabulary: biological process
TermDefinition
GO:0008016regulation of heart contraction
GO:0015698inorganic anion transport
GO:0031101fin regeneration
GO:0036444mitochondrial calcium uptake
GO:0098656anion transmembrane transport
GO:0044070regulation of anion transport
GO:0006820anion transport
GO:0055085transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:1903959regulation of anion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0015267channel activity
GO:0008308voltage-gated anion channel activity
GO:0000166nucleotide binding
GO:0015288porin activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001925Porin_Euk
IPR023614Porin_dom_sf
IPR027246Porin_Euk/Tom40
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001925Porin, eukaryotic typePRINTSPR00185EUKARYTPORINcoord: 34..49
score: 45.67
coord: 99..114
score: 37.5
coord: 279..296
score: 45.73
IPR001925Porin, eukaryotic typePANTHERPTHR11743VOLTAGE-DEPENDENT ANION-SELECTIVE CHANNELcoord: 34..312
IPR023614Porin domain superfamilyGENE3DG3DSA:2.40.160.10coord: 31..313
e-value: 2.3E-64
score: 219.4
IPR027246Eukaryotic porin/Tom40PFAMPF01459Porin_3coord: 34..308
e-value: 2.3E-37
score: 128.9
NoneNo IPR availablePANTHERPTHR11743:SF23GH26960P-RELATEDcoord: 34..312
NoneNo IPR availableCDDcd07306Porin3_VDACcoord: 33..312
e-value: 1.19116E-50
score: 167.0
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..17
score: 0.509