Transposon Ty3-I Gag-Pol polyprotein

Overview
NameTransposon Ty3-I Gag-Pol polyprotein
Smed IDSMED30026219
Length (bp)946
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30026219) t-SNE clustered cells

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30026219) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transposon Ty3-I Gag-Pol polyprotein (SMED30026219) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transposon Ty3-I Gag-Pol polyprotein (SMED30026219) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026219

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026219SMESG000023344.1 SmedASXL_019867SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026219SMESG000023344.1 dd_Smed_v4_8921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026219SMESG000023344.1 dd_Smed_v4_8921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026219SMESG000023344.1 dd_Smed_v4_8921_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026219SMESG000023344.1 dd_Smed_v6_8921_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026219SMESG000023344.1 dd_Smed_v4_8921_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: CABCOCO1 (ciliary associated calcium binding coiled-coil 1 [Source:HGNC Symbol;Acc:HGNC:28678])

HSP 1 Score: 55.8398 bits (133), Expect = 1.293e-8
Identity = 46/196 (23.47%), Postives = 86/196 (43.88%), Query Frame = 2
Query:  302 KFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVD---NADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQ 880
            ++S   + +   L+N++T  MSL+E++  L  ++           +   +  D  +   +  +L   + QH+KL EF+F   R + V+G +  +E + S   P+P PL E ++ D+Y + F    ++     K +D     +  Q E D    D             +I+ +  VL +   +I   I  EI  K+Q
Sbjct:    7 QYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDW-NIFDVKQANAIIDYLKISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFDIY-STFIEPPTILDTEMKRLDQEQGPEESQPETDTSDMDP--------LVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQ 192          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Match: CABCOCO1 (ciliary associated calcium binding coiled-coil 1 [Source:HGNC Symbol;Acc:HGNC:28678])

HSP 1 Score: 55.8398 bits (133), Expect = 1.293e-8
Identity = 46/196 (23.47%), Postives = 86/196 (43.88%), Query Frame = 2
Query:  302 KFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVD---NADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQ 880
            ++S   + +   L+N++T  MSL+E++  L  ++           +   +  D  +   +  +L   + QH+KL EF+F   R + V+G +  +E + S   P+P PL E ++ D+Y + F    ++     K +D     +  Q E D    D             +I+ +  VL +   +I   I  EI  K+Q
Sbjct:    7 QYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDW-NIFDVKQANAIIDYLKISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFDIY-STFIEPPTILDTEMKRLDQEQGPEESQPETDTSDMDP--------LVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQ 192          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Match: CABCOCO1 (ciliary associated calcium binding coiled-coil 1 [Source:NCBI gene;Acc:100486238])

HSP 1 Score: 57.7658 bits (138), Expect = 2.283e-9
Identity = 43/178 (24.16%), Postives = 89/178 (50.00%), Query Frame = 2
Query:  350 RTSQMSLKENVLELKTILTNDSE-NPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVDNADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQ 880
            +  +MSL+E++ +L  +LT   + +PG   KG+L+  + ++ K +  +    + QH+KL E +FS  R   VLG +  +  + S+ T +P PL E +++++Y    +    V         ++   Q  ++L   +K  + E+   S  +++ +  VL +    +   + AEI  K++
Sbjct:    6 KAKKMSLEEHLKDLGRLLTGIGQSHPGK--KGILALFNVDQAKDIISYFQMSLFQHYKLYECMFSVPRDVMVLGAENVISVVKSEPT-FPAPLEEGISSEIYSQYIAP--PVPQSPITGTGDSRINQPLEELGGNEK-TADEVDPLSGFTVEDVKTVLNQVTTEVIGSLQAEINEKLR 177          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Match: Cabcoco1 (ciliary associated calcium binding coiled-coil 1 [Source:MGI Symbol;Acc:MGI:1920537])

HSP 1 Score: 69.707 bits (169), Expect = 4.154e-13
Identity = 43/170 (25.29%), Postives = 81/170 (47.65%), Query Frame = 2
Query:  143 NLLDSHNLGDIEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLY 652
            +LL   N   I++ L       + +  L+ AI++D+YV+   W KE       ++S   + +  LL N++T  MSL++++  L  ++     N     +      +  E   +  +L   + QH++L EF+F   R + V+G +  +E +     P+P PL E ++ D Y
Sbjct:   55 DLLGEENENGIQEKLGVFLNFKNLQTCLRDAILLDYYVSGFCWAKE-MNFSIEQYSKFMTLLDMLLHNLQTLHMSLEDSIKWLGEVMAEIGPNHSQKSEDF-HVFEVKEANAIIDYLKISLFQHYRLYEFLFYSTREEIVIGTEQTIEVVKPADYPFPAPLEEGISLDTY 222          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Match: Cabcoco1 (ciliary associated calcium binding coiled-coil 1 [Source:MGI Symbol;Acc:MGI:1920537])

HSP 1 Score: 52.373 bits (124), Expect = 1.293e-7
Identity = 29/117 (24.79%), Postives = 57/117 (48.72%), Query Frame = 2
Query:  302 KFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLY 652
            ++S   + +  LL N++T  MSL++++  L  ++     N     +      +  E   +  +L   + QH++L EF+F   R + V+G +  +E +     P+P PL E ++ D Y
Sbjct:    7 QYSKFMTLLDMLLHNLQTLHMSLEDSIKWLGEVMAEIGPNHSQKSEDF-HVFEVKEANAIIDYLKISLFQHYRLYEFLFYSTREEIVIGTEQTIEVVKPADYPFPAPLEEGISLDTY 122          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q8IVU9|CBCO1_HUMAN (Ciliary-associated calcium-binding coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=CABCOCO1 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 6.208e-8
Identity = 46/196 (23.47%), Postives = 86/196 (43.88%), Query Frame = 2
Query:  302 KFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVD---NADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQ 880
            ++S   + +   L+N++T  MSL+E++  L  ++           +   +  D  +   +  +L   + QH+KL EF+F   R + V+G +  +E + S   P+P PL E ++ D+Y + F    ++     K +D     +  Q E D    D             +I+ +  VL +   +I   I  EI  K+Q
Sbjct:    7 QYSKFMTLLAMSLQNLKTLHMSLEESIKWLGEVMAEIGPTHSQKSEDW-NIFDVKQANAIIDYLKISLFQHYKLYEFMFYSAREEIVIGTEQVIEVVKSACGPFPNPLEEGISFDIY-STFIEPPTILDTEMKRLDQEQGPEESQPETDTSDMDP--------LVGFTIEDVKSVLDQVTDDILIGIQTEINEKLQ 192          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Match: sp|Q8CDT7|CBCO1_MOUSE (Ciliary-associated calcium-binding coiled-coil protein 1 OS=Mus musculus OX=10090 GN=Cabcoco1 PE=1 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 9.043e-7
Identity = 29/117 (24.79%), Postives = 57/117 (48.72%), Query Frame = 2
Query:  302 KFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLY 652
            ++S   + +  LL N++T  MSL++++  L  ++     N     +      +  E   +  +L   + QH++L EF+F   R + V+G +  +E +     P+P PL E ++ D Y
Sbjct:    7 QYSKFMTLLDMLLHNLQTLHMSLEDSIKWLGEVMAEIGPNHSQKSEDF-HVFEVKEANAIIDYLKISLFQHYRLYEFLFYSTREEIVIGTEQTIEVVKPADYPFPAPLEEGISLDTY 122          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A1S3H837 (ciliary-associated calcium-binding coiled-coil protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106152571 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 2.438e-24
Identity = 70/284 (24.65%), Postives = 141/284 (49.65%), Query Frame = 2
Query:   41 SPKSSARNLAKTSVIESQRKPPNSFSIINELTCKNLLDSHNLGDIEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTN-DSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVDNADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQEIE 889
            S K  A+  +K   ++ ++    ++ +++ +  + L++  ++  ++  +    ++ +   +LK A I+D+YV    W KE       + S  F+A+H +LEN++   +S+ +N+ E K +L     ENP +P  G L   D N+ K V  +L T I QH+KL EF+FS+ +A++++G DL V        P+PPPL E +  D++     +         ++ D  +     +  ++   +  RE    ++L  D +  +L      +   ++ E+ +K++E E
Sbjct:    2 SKKKGAKGRSKAG-LDDEKDQSLAYKVLSSVQTQQLMEL-DVDQLQSKMVEVMQLPNHTADLKEAAILDYYVAGFWWGKER-GFTVQQLSGFFTALHRILENVKDKHLSMVDNLKEFKKMLVGVGQENPESP--GGLEFFDLNQAKMVADYLHTSIFQHYKLYEFIFSHTQAEEIIGADLDVNVAKPADMPWPPPLEEGVPEDIFNEHIRTPPPTPPPEPEAEDGNETPDDTRSKEEIAAQKEREAFLMAELGSDQVKAILSSVAKEMIGGLSTEMASKLRERE 280          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A210PX37 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17103 PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 3.193e-24
Identity = 69/262 (26.34%), Postives = 136/262 (51.91%), Query Frame = 2
Query:  110 SFSIINELTCKNLLDSHNLGDIEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKS--VDNADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQEIE 889
            ++ I++E  CK LL   ++ +++  L   FK+ +   +L+ A ++D+Y   V W KE   L   + S  F+ IH LL+N++   M++ +N+ E K +L              L   +  + K V  ++ T + QH+KL E +F+  +A++++G DL +ET    S P+PPPL E ++ +++ +  ++                A   + +K +++ D +L  +I  FS+L++D +  V++     +  P+ +EI  K++E E
Sbjct:   49 AYKILSEDQCKTLL-GQDVDEMQTTLCDIFKLHNYTTDLRDAGVLDYYTGAVWWGKEQGFL-PQQLSGFFTVIHILLDNVKEQHMTMVDNLKEFKKLLIGIEPEYQQIKSAGLDFFNTQQAKAVTTYVTTCLFQHYKLYELMFNQTQAEEIIGTDLEIETAKPASVPFPPPLDEGVSQEMFASYIATPPPTPEPEVVKSEGGLAGEEEGDKAMEELDTKLDTDI--FSELTVDDVRAVIESVAKELLDPLQSEIAAKLREKE 306          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: A0A1S3H6A7 (ciliary-associated calcium-binding coiled-coil protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152571 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.023e-23
Identity = 65/224 (29.02%), Postives = 113/224 (50.45%), Query Frame = 2
Query:  221 NLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTN-DSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVDNADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQEIE 889
            +LK A I+D+YV    W KE       + S  F+A+H +LEN++   +S+ +N+ E K +L     ENP +P  G L   D N+ K V  +L T I QH+KL EF+FS+ +A++++G DL V        P+PPPL E +  D++     +         ++ D  +     +  ++   +  RE    ++L  D +  +L      +   ++ E+ +K++E E
Sbjct:   89 DLKEAAILDYYVAGFWWGKER-GFTVQQLSGFFTALHRILENVKDKHLSMVDNLKEFKKMLVGVGQENPESP--GGLEFFDLNQAKMVADYLHTSIFQHYKLYEFIFSHTQAEEIIGADLDVNVAKPADMPWPPPLEEGVPEDIFNEHIRTPPPTPPPEPEAEDGNETPDDTRSKEEIAAQKEREAFLMAELGSDQVKAILSSVAKEMIGGLSTEMASKLRERE 309          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: V4ANB6 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_203888 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 5.955e-23
Identity = 69/261 (26.44%), Postives = 138/261 (52.87%), Query Frame = 2
Query:  110 SFSIINELTCKNLLDSHNLGDIEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTN-DSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVDNADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQEIE 889
            ++ ++    CK LL + ++ +++  L+  FK+     +LK A I+D+Y   V W KE       + S  F+ IH LL+N++   MS+ EN+ EL+ +L     E+   P  GL    +  + K ++ ++   + QH+K+ EF+FS+ +A++++G D+ VE   +   P+PPPL E +  ++Y+   ++     +      DN     + K++D  DK L  +I+ +S+L+ + +  +++     +   +  ++  K+QE E
Sbjct:    2 AYKVLTADHCKELL-ALSVENMQLKLSDIFKLQDNLTDLKEASILDYYTAAVWWAKEN-SFTEQQLSGFFTVIHTLLDNVKEKHMSIIENIKELQKMLVGIGVEHAIQPSGGL-QFFNIQQAKLISDYVSNSLFQHYKIYEFMFSHTQAEEIIGTDVDVEVCLAADVPFPPPLDEGINENIYQQYIATPPPSPTPEPNEEDNT----VNKEVD-IDKVLPEDINIYSELTPEDVRDIIESVSKEMLGGLQTDVAKKLQEKE 254          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Match: R7TAA1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_221472 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.619e-21
Identity = 63/213 (29.58%), Postives = 115/213 (53.99%), Query Frame = 2
Query:   47 KSSARNLAKTSVIESQRKPPNSFSIINELTCKNLL---DSHNLG-DIEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPG-NPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSS 670
            + S R+ A+  V+E +++   ++ +++    K+L    D+  L  +I D L    + D   ++LK  + +D +V  + W K+   +   + S IF+ +H LL+NI+   + + +N+LE K +L       G +   G L  LD  + K +  +L     QHH+L EFVF++ +A++V+G DL VET  S   P+PPPL EA+  + ++   ++
Sbjct:   25 RKSGRSSARKHVVEEEKET-LAYKVLSAEMTKSLYALDDADELQRNISDFLK---RTDRLSVDLKDGVCVDHFVAGLWWCKQQ-AMTIEQTSAIFTVLHTLLDNIKEKHLGMVQNLLEYKKMLVGIGVELGPDQTGGGLECLDIGQAKMLTDYLQLSFFQHHRLFEFVFTHTQAEEVIGTDLEVETPKSADVPWPPPLIEAVPEETFKQYIAT 232          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: cabcoco1 (ciliary associated calcium binding coiled-coil 1 [Source:NCBI gene;Acc:103021761])

HSP 1 Score: 55.8398 bits (133), Expect = 1.208e-8
Identity = 36/146 (24.66%), Postives = 70/146 (47.95%), Query Frame = 2
Query:  224 LKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKEN----VLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDL 649
            LK A ++D++V    W KE       + S I + +  LL+NI+  QM   EN       L     + S+   NP        D +++K +  +  + + QH++L +F+F+  R + +L ++  ++   ++S  +  PL E +  +L
Sbjct:   41 LKEAALLDYFVGGFWWAKE-MNFTCQQSSFIMALLQLLLDNIKDKQMPFAENFKAFTQNLLATRMSSSDTAVNPL------FDVDQIKSITDYFKSSLFQHYRLYQFLFTQPREEMILRMERSIDV--ANSADFAAPLEEGMPPEL 177          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: cabcoco1 (ciliary associated calcium binding coiled-coil 1 [Source:NCBI gene;Acc:103021761])

HSP 1 Score: 55.8398 bits (133), Expect = 1.255e-8
Identity = 36/146 (24.66%), Postives = 70/146 (47.95%), Query Frame = 2
Query:  224 LKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKEN----VLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDL 649
            LK A ++D++V    W KE       + S I + +  LL+NI+  QM   EN       L     + S+   NP        D +++K +  +  + + QH++L +F+F+  R + +L ++  ++   ++S  +  PL E +  +L
Sbjct:   41 LKEAALLDYFVGGFWWAKE-MNFTCQQSSFIMALLQLLLDNIKDKQMPFAENFKAFTQNLLATRMSSSDTAVNPL------FDVDQIKSITDYFKSSLFQHYRLYQFLFTQPREEMILRMERSIDV--ANSADFAAPLEEGMPPEL 177          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: cabcoco1 (ciliary associated calcium binding coiled-coil 1 [Source:NCBI gene;Acc:103021761])

HSP 1 Score: 50.0618 bits (118), Expect = 9.647e-7
Identity = 36/151 (23.84%), Postives = 70/151 (46.36%), Query Frame = 2
Query:  224 LKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRT-----SQMSLKEN----VLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDL 649
            LK A ++D++V    W KE       + S I + +  LL+NI+       QM   EN       L     + S+   NP        D +++K +  +  + + QH++L +F+F+  R + +L ++  ++   ++S  +  PL E +  +L
Sbjct:   41 LKEAALLDYFVGGFWWAKE-MNFTCQQSSFIMALLQLLLDNIKVHSVSDKQMPFAENFKAFTQNLLATRMSSSDTAVNPL------FDVDQIKSITDYFKSSLFQHYRLYQFLFTQPREEMILRMERSIDV--ANSADFAAPLEEGMPPEL 182          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Match: cabcoco1 (ciliary associated calcium binding coiled-coil 1 [Source:NCBI gene;Acc:103021761])

HSP 1 Score: 50.0618 bits (118), Expect = 1.014e-6
Identity = 36/151 (23.84%), Postives = 70/151 (46.36%), Query Frame = 2
Query:  224 LKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRT-----SQMSLKEN----VLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDL 649
            LK A ++D++V    W KE       + S I + +  LL+NI+       QM   EN       L     + S+   NP        D +++K +  +  + + QH++L +F+F+  R + +L ++  ++   ++S  +  PL E +  +L
Sbjct:   41 LKEAALLDYFVGGFWWAKE-MNFTCQQSSFIMALLQLLLDNIKVHSVSDKQMPFAENFKAFTQNLLATRMSSSDTAVNP------LFDVDQIKSITDYFKSSLFQHYRLYQFLFTQPREEMILRMERSIDV--ANSADFAAPLEEGMPPEL 182          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001266.1 (pep scaffold:Pmarinus_7.0:GL477743:23012:42371:1 gene:ENSPMAG00000001138.1 transcript:ENSPMAT00000001266.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 2.371e-12
Identity = 50/175 (28.57%), Postives = 83/175 (47.43%), Query Frame = 2
Query:  149 LDSHNLGDIEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLD-----LFVETLPSDSTPYPPPLCEALTTDLYRN 658
            L S  L +++  L     +   E +L+ A ++D YV+   W +E     + +   + + +H LL+NI   +M L EN+      L       G  C  L + L   + K V  +L T + QH++L EFVF+  + Q V+ +D     + VE L  +  P+P PL E +  D+Y  
Sbjct:   28 LASLTLEEVQTHLAEMLHLREHETSLREAALLDVYVSAYRWARE-HGFSSQQILYVVTLLHTLLQNIEERRMKLVENLKACSRQLV------GVGCDDL-ACLSLEQGKLVLGYLTTSLFQHYRLYEFVFT--QPQDVVIIDSQQCSIEVEMLEINQKPFPLPLEEGIDADIYER 192          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001269.1 (pep scaffold:Pmarinus_7.0:GL477743:23012:42371:1 gene:ENSPMAG00000001138.1 transcript:ENSPMAT00000001269.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 6.248e-12
Identity = 43/146 (29.45%), Postives = 72/146 (49.32%), Query Frame = 2
Query:  215 ELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLY 652
            E +L+ A ++D YV+   W +E     + +   + + +H LL+NI   +M L EN+      L       G  C  L + L   + K V  +L T + QH++L EFVF+  +   ++   + VE L  +  P+P PL E +  D+Y
Sbjct:    8 ETSLREAALLDVYVSAYRWARE-HGFSSQQILYVVTLLHTLLQNIEERRMKLVENLKACSRQLV------GVGCDDL-ACLSLEQGKLVLGYLTTSLFQHYRLYEFVFTQPQDVVIIDSQIEVEMLEINQKPFPLPLEEGIDADIY 145          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Match: EDO36882 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHF5])

HSP 1 Score: 79.337 bits (194), Expect = 5.993e-17
Identity = 71/292 (24.32%), Postives = 134/292 (45.89%), Query Frame = 2
Query:   32 KPKSPKSSARNLAKTSVIESQRKPPNSFSIINE---LTCKNLLDSHNLGDIEDILT-TNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTN-DSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRN-CFSSVGSVRSHSAKSVDNADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQEIE 889
            + KS K       ++S  E + K   ++ +++E   L+ K L  +     + +IL   N+ I  PE     A ++D+YV+   W  +    +  + S   + +  LLENI+  Q+SL E++ E + +L     EN      G L   D ++ K +  +    + +H+KL +F+F+    ++V   +L +E  P    P+PPPL E +T +++R    +   S +       +    G     +   +KE++  I   + L  + I  ++K    + F     E+ETK++E E
Sbjct:   18 RKKSAKQGDNKGRRSSQEEEEVKESLAWKVLSEEQTLSLKELTVTELEAKMAEILGIENYHISLPE-----ACVLDYYVS-GFWFTKEQNFNTQQCSAFVTVLKILLENIKEKQLSLVESLKEFRNLLVGIGVENCSK--TGGLECFDVSQAKLITDYFTESLFKHYKLYKFLFTQEPEEEVTNTELTIEVPPLACVPFPPPLDEGMTEEVWRAYIMTPPPSPQPEKETEEEEGKAGS--SGISAANKEVAENI--LASLKPEDIKTIVKRAAEDTFGSFKLEVETKLKERE 297          
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Match: SMESG000023344.1 (SMESG000023344.1)

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 288/289 (99.65%), Postives = 288/289 (99.65%), Query Frame = 2
Query:   23 MTTKPKSPKSSARNLAKTSVIESQRKPPNSFSIINELTCKNLLDSHNLGDIEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVDNADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQEIE 889
            MTTK KSPKSSARNLAKTSVIESQRKPPNSFSIINELTCKNLLDSHNLGDIEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVDNADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQEIE
Sbjct:    1 MTTKAKSPKSSARNLAKTSVIESQRKPPNSFSIINELTCKNLLDSHNLGDIEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFSAIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNELKKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPPLCEALTTDLYRNCFSSVGSVRSHSAKSVDNADFGQLEKDLDKFDKELSREISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQEIE 289          
The following BLAST results are available for this feature:
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CABCOCO11.293e-823.47ciliary associated calcium binding coiled-coil 1 [... [more]
CABCOCO11.293e-823.47ciliary associated calcium binding coiled-coil 1 [... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CABCOCO12.283e-924.16ciliary associated calcium binding coiled-coil 1 [... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cabcoco14.154e-1325.29ciliary associated calcium binding coiled-coil 1 [... [more]
Cabcoco11.293e-724.79ciliary associated calcium binding coiled-coil 1 [... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8IVU9|CBCO1_HUMAN6.208e-823.47Ciliary-associated calcium-binding coiled-coil pro... [more]
sp|Q8CDT7|CBCO1_MOUSE9.043e-724.79Ciliary-associated calcium-binding coiled-coil pro... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H8372.438e-2424.65ciliary-associated calcium-binding coiled-coil pro... [more]
A0A210PX373.193e-2426.34Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A1S3H6A71.023e-2329.02ciliary-associated calcium-binding coiled-coil pro... [more]
V4ANB65.955e-2326.44Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
R7TAA12.619e-2129.58Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cabcoco11.208e-824.66ciliary associated calcium binding coiled-coil 1 [... [more]
cabcoco11.255e-824.66ciliary associated calcium binding coiled-coil 1 [... [more]
cabcoco19.647e-723.84ciliary associated calcium binding coiled-coil 1 [... [more]
cabcoco11.014e-623.84ciliary associated calcium binding coiled-coil 1 [... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001266.12.371e-1228.57pep scaffold:Pmarinus_7.0:GL477743:23012:42371:1 g... [more]
ENSPMAT00000001269.16.248e-1229.45pep scaffold:Pmarinus_7.0:GL477743:23012:42371:1 g... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO368825.993e-1724.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transposon Ty3-I Gag-Pol polyprotein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000023344.10.000e+099.65SMESG000023344.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026219 ID=SMED30026219|Name=Transposon Ty3-I Gag-Pol polyprotein|organism=Schmidtea mediterranea sexual|type=transcript|length=946bp
ATAAACTCCATGGTAATAAAATATGACAACAAAACCAAAGAGTCCAAAAT
CAAGTGCTAGAAATTTAGCAAAAACTTCTGTTATAGAAAGTCAAAGAAAA
CCTCCTAATTCTTTCTCTATAATTAATGAACTTACATGCAAAAATTTATT
AGATTCACATAATCTTGGAGATATAGAGGACATTTTAACAACTAATTTTA
AAATTGATTCTCCTGAACTTAATTTAAAATCAGCCATTATTATTGATTTC
TATGTCAATTTAGTAATATGGTTGAAAGAGACATTTCAATTAGATGCAGC
CAAGTTTTCATTAATATTTTCAGCAATTCATTATTTATTGGAAAACATAC
GAACCAGTCAAATGAGTTTGAAGGAAAATGTATTGGAATTGAAAACTATA
TTGACAAATGACAGTGAAAATCCCGGAAATCCTTGCAAAGGATTGCTGTC
AACCCTCGATGGAAACGAGTTGAAAAAAGTCAATCAATTTCTTCTTACTG
GAATTATTCAACATCACAAATTGATGGAATTCGTTTTTTCTTATCATCGA
GCTCAGAAAGTTCTCGGTTTGGATTTATTTGTCGAAACTCTTCCATCAGA
TTCGACGCCATATCCGCCGCCACTCTGTGAAGCATTGACTACTGATCTTT
ATCGCAACTGTTTTTCGTCTGTTGGGTCTGTACGATCGCATTCGGCAAAA
AGTGTTGACAATGCCGATTTTGGACAACTGGAGAAAGATTTGGACAAATT
CGACAAGGAATTGTCGAGAGAAATTTCACAGTTTTCCGATTTGTCAATCG
ACACAATCAGCCGGGTGTTGAAAGAAGAATGCGTTAATATTTTCCCACCG
ATCACTGCGGAAATCGAAACGAAAATTCAGGAAATCGAAATAAATTTTTT
CAAGAAATTTAATAAATCAATAAAATAATATTAGTTCTAAAAAAAA
back to top

protein sequence of SMED30026219-orf-1

>SMED30026219-orf-1 ID=SMED30026219-orf-1|Name=SMED30026219-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=302bp
MTTKPKSPKSSARNLAKTSVIESQRKPPNSFSIINELTCKNLLDSHNLGD
IEDILTTNFKIDSPELNLKSAIIIDFYVNLVIWLKETFQLDAAKFSLIFS
AIHYLLENIRTSQMSLKENVLELKTILTNDSENPGNPCKGLLSTLDGNEL
KKVNQFLLTGIIQHHKLMEFVFSYHRAQKVLGLDLFVETLPSDSTPYPPP
LCEALTTDLYRNCFSSVGSVRSHSAKSVDNADFGQLEKDLDKFDKELSRE
ISQFSDLSIDTISRVLKEECVNIFPPITAEIETKIQEIEINFFKKFNKSI
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0015074DNA integration
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR032727CLAMP
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR032727Flagellar C1a complex subunit C1a-32PFAMPF14769CLAMPcoord: 88..177
e-value: 5.5E-6
score: 26.7
IPR032727Flagellar C1a complex subunit C1a-32PANTHERPTHR28457FAMILY NOT NAMEDcoord: 45..298
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..23
NoneNo IPR availablePANTHERPTHR28457:SF3CILIARY-ASSOCIATED CALCIUM-BINDING COILED-COIL PROTEIN 1coord: 45..298