Tetraspanin

Overview
NameTetraspanin
Smed IDSMED30026207
Length (bp)1078
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tetraspanin (SMED30026207) t-SNE clustered cells

Violin plots show distribution of expression levels for Tetraspanin (SMED30026207) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026207

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cement glandSMED30026207h1SMcG0001379 GDAG01039019.1SmedSxl_ww_GDAG01PMID:279364
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30026207h1SMcG0001379 Contig41594newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026207h1SMcG0001379 Contig41594uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026207h1SMcG0001379 Contig55145newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026207h1SMcG0001379 Contig55145uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026207h1SMcG0001379 Contig21041uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026207h1SMcG0001379 Contig21041newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
gonoporeSMED30026207h1SMcG0001379 Contig1577GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30026207h1SMcG0001379 Contig1577GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30026207h1SMcG0001379 PL05005B1G12smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
gonoporeSMED30026207h1SMcG0022037 Contig1577GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
copulatory apparatusSMED30026207h1SMcG0022037 Contig1577GPL15192PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN8 (tetraspanin 8 [Source:HGNC Symbol;Acc:HGNC:11855])

HSP 1 Score: 75.8702 bits (185), Expect = 2.707e-15
Identity = 61/202 (30.20%), Postives = 92/202 (45.54%), Query Frame = 1
Query:  325 LLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCG-INGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVV 927
            +LI +G   ++ GF GCCGAIKES+C+L  +   +  +++ QVA GI     K+K    +  +L +  +     A   +   F   I     E KCCG +NG +D       W  N Q  P++    C  L +                   C   N  +V  E C   + D + K+L IVIG+  GL + EIL +VF+ V+
Sbjct:   58 ILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYE--NTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAAD-------WGNNFQHYPEL----CACLDK----------------QRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVL 230          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN8 (tetraspanin 8 [Source:HGNC Symbol;Acc:HGNC:11855])

HSP 1 Score: 75.8702 bits (185), Expect = 2.707e-15
Identity = 61/202 (30.20%), Postives = 92/202 (45.54%), Query Frame = 1
Query:  325 LLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCG-INGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVV 927
            +LI +G   ++ GF GCCGAIKES+C+L  +   +  +++ QVA GI     K+K    +  +L +  +     A   +   F   I     E KCCG +NG +D       W  N Q  P++    C  L +                   C   N  +V  E C   + D + K+L IVIG+  GL + EIL +VF+ V+
Sbjct:   58 ILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYE--NTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAAD-------WGNNFQHYPEL----CACLDK----------------QRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVL 230          
BLAST of Tetraspanin vs. Ensembl Human
Match: TSPAN8 (tetraspanin 8 [Source:HGNC Symbol;Acc:HGNC:11855])

HSP 1 Score: 75.8702 bits (185), Expect = 2.707e-15
Identity = 61/202 (30.20%), Postives = 92/202 (45.54%), Query Frame = 1
Query:  325 LLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCG-INGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVV 927
            +LI +G   ++ GF GCCGAIKES+C+L  +   +  +++ QVA GI     K+K    +  +L +  +     A   +   F   I     E KCCG +NG +D       W  N Q  P++    C  L +                   C   N  +V  E C   + D + K+L IVIG+  GL + EIL +VF+ V+
Sbjct:   58 ILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYE--NTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAAD-------WGNNFQHYPEL----CACLDK----------------QRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVL 230          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD63 (CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692])

HSP 1 Score: 74.7146 bits (182), Expect = 4.900e-15
Identity = 54/215 (25.12%), Postives = 103/215 (47.91%), Query Frame = 1
Query:  280 SFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHI-FNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            +F  A P   +++ +++I +G+F  +  F GCCGA KE+ CL+ T++  +  +++ +VA  I     ++KV  +  N+  + +  +      P  +    ++  +  + KCCG    +D++      K  S SK +V P  CC+   +   I FN+K                  ++ EGC + +   + K++ +V    +G+   E+L IVFAC
Sbjct:   20 AFCGATPG--SLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENY------PKNNHTASILDRMQADFKCCGAANYTDWE------KIPSMSKNRV-PDSCCINVTVGCGINFNEK-----------------AIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFAC 202          
BLAST of Tetraspanin vs. Ensembl Human
Match: CD63 (CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692])

HSP 1 Score: 73.9442 bits (180), Expect = 1.389e-14
Identity = 51/205 (24.88%), Postives = 99/205 (48.29%), Query Frame = 1
Query:  310 NIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHI-FNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            +++ +++I +G+F  +  F GCCGA KE+ CL+ T++  +  +++ +VA  I     ++KV  +  N+  + +  +      P  +    ++  +  + KCCG    +D++      K  S SK +V P  CC+   +   I FN+K                  ++ EGC + +   + K++ +V    +G+   E+L IVFAC
Sbjct:   51 SLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENY------PKNNHTASILDRMQADFKCCGAANYTDWE------KIPSMSKNRV-PDSCCINVTVGCGINFNEK-----------------AIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFAC 225          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 75.485 bits (184), Expect = 2.880e-15
Identity = 72/254 (28.35%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  208 VWLKVDK---SNLMEMLRKINLGNNDDSFG--IAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILH---KHFNGA----LSPNPSVFTLVITS---IMFELKCCGINGE-SDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEK---HLKIVIGVCIGLGLFEILCIV 912
            +WL +DK    NL     K+   + D        KP+       LL V G   +V  F GCCGA KE + LL  YS  +  ++  Q+A  IYA    +      +N    ILH   K +NG     +S NP    LV T+   IM E  CCG++ +  +F+     W Q +  + Q  P  CC   E  +                 PY N +  ++ GC+  + +  E+   H KIV    +   L +++ IV
Sbjct:   41 LWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPTAVRQFGYLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSH----MFENDFRDILHSSLKMYNGTDNMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFN--NSGWYQLNHGRYQFPP-ACCPPDEHGRLR---------------PYCNTIMRHSHGCYAKIAESFEEVTSHFKIVSWTVVLFALIQVVGIV 272          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-11 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526])

HSP 1 Score: 75.485 bits (184), Expect = 2.880e-15
Identity = 72/254 (28.35%), Postives = 107/254 (42.13%), Query Frame = 1
Query:  208 VWLKVDK---SNLMEMLRKINLGNNDDSFG--IAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILH---KHFNGA----LSPNPSVFTLVITS---IMFELKCCGINGE-SDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEK---HLKIVIGVCIGLGLFEILCIV 912
            +WL +DK    NL     K+   + D        KP+       LL V G   +V  F GCCGA KE + LL  YS  +  ++  Q+A  IYA    +      +N    ILH   K +NG     +S NP    LV T+   IM E  CCG++ +  +F+     W Q +  + Q  P  CC   E  +                 PY N +  ++ GC+  + +  E+   H KIV    +   L +++ IV
Sbjct:   41 LWLVLDKYAIDNLAFATAKVQGYDQDAGLRDLATKPTAVRQFGYLLFVGGFIVIVVAFLGCCGAAKEWRPLLCCYSSCLMLILAIQIAATIYAFLHSH----MFENDFRDILHSSLKMYNGTDNMKVSNNPQDGLLVKTAWDKIMIEKSCCGVDSKIGEFN--NSGWYQLNHGRYQFPP-ACCPPDEHGRLR---------------PYCNTIMRHSHGCYAKIAESFEEVTSHFKIVSWTVVLFALIQVVGIV 272          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-12 (Tetraspanin-12 [Source:UniProtKB/Swiss-Prot;Acc:Q22495])

HSP 1 Score: 67.781 bits (164), Expect = 1.615e-12
Identity = 52/200 (26.00%), Postives = 100/200 (50.00%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQ--------SKPQVH--PIGCCV 711
            K  + +FN+ FF++G  +   GVW +++K+  + ML K +    D ++              L+++G  T + GF GC G+++E+   L  YS L+G ++IA+ + G++A   ++++   ++N L  ++  + +     +P +  L+I S+     CCGING       AD W +N+         + P+    P  CC+
Sbjct:   39 KYSVFSFNVIFFLLGFGLLLFGVWAQIEKNTFVNMLSKASKLYLDPTWP-------------LLIVGFLTFIIGFSGCVGSLRENTSFLTFYSTLLGLLLIAEFSAGVFAYACRDQLDNYIRNLLNDVVVGYRD-----DPDL-QLLIDSMQETWMCCGING-------ADDWDRNTYFSIEAREVASPEAGGVPFSCCI 212          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-17 (Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q11098])

HSP 1 Score: 62.7734 bits (151), Expect = 5.858e-11
Identity = 57/213 (26.76%), Postives = 98/213 (46.01%), Query Frame = 1
Query:  319 AILLIVIGLFTLVAGFCGCCGAIKESKCLLYTY-SFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPS--VFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQ-----VHPIGCCVLKELSKHIFNKKNLLNIL--SDPQCPY--SNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            A + +V G   L+ GF G CGA+  S+ LL  +  FL+G+  +A VA+G  +   K+KV    +N  ++ + K   G ++  P   + T  I  + F  KCCG  G +D+  I+ +W Q++    +     + P+ CC             + LN L  S  +C    +N    +  GC + ++    + + I +G   G  L  +L I  +C
Sbjct:   62 AYVSLVCGCAQLLVGFLGLCGAVNRSRFLLLAFVMFLIGT-FLADVAMGTLSLFYKDKVYSVKEN--VREIVKSKYGVMTSEPENKMVTEFIDKLQFYEKCCGSLGPTDY--ISSRWSQSTNQDSEEIESPLFPVSCCTQ-------ITGASALNPLAKSYARCQQIGANRQWRHAVGCSERLMSWFNEQIWIFVGFGFGSALTMMLGICLSC 262          
BLAST of Tetraspanin vs. Ensembl Celegans
Match: tsp-13 (Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9NET3])

HSP 1 Score: 62.7734 bits (151), Expect = 8.851e-11
Identity = 41/147 (27.89%), Postives = 72/147 (48.98%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVI 648
            VWL+ D S     + +       ++F  A P++F   + ++IV+G   +V    GCCG    S+  L  YS +V  +++A ++ GIY    K+ + V+L ++L  ++  ++ G     P V    +  +    +CCG  G SDF V 
Sbjct:   80 VWLRTD-SRFRNFISERYRQAVQEAFWEA-PTLFAF-SYIIIVLGAVMMVVAMLGCCGITGRSRPFLIIYSMVVFLLLVATLSCGIYLLYKKDGLDVELSDALNYMVQHYYQG-----PGVVQESLDHLQTAFRCCGNAGCSDFRVF 218          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076507)

HSP 1 Score: 92.0485 bits (227), Expect = 4.787e-21
Identity = 76/260 (29.23%), Postives = 132/260 (50.77%), Query Frame = 1
Query:  139 SKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            +K LL  FN  FF++G  IFG+G+WL VDK +L+ +L+ +      + F   +P     +A +L+VIG       F G  GA++ES+CLL TY   +  ++IA++  G      K+KV+ + +N L   +  +   +L  N    +L+   +M    CCGIN   DFD  +  W     ++    P  CC+LK+++K +   ++     SD    Y        +GC++   + + +  ++VI V I +G+  ++ I+ A
Sbjct:   10 AKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVE-SERIEQF--TQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTTITSY---SLGENVDATSLMWNQLMGNFGCCGINDYHDFDA-SPAWVNGKGNRTI--PDACCILKDVAKLVPRDEDCTTNPSDSNSFYK-------KGCYEVFTEWLIRQRELVI-VAIAVGIVHLVLIILA 252          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076506)

HSP 1 Score: 92.0485 bits (227), Expect = 4.787e-21
Identity = 76/260 (29.23%), Postives = 132/260 (50.77%), Query Frame = 1
Query:  139 SKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            +K LL  FN  FF++G  IFG+G+WL VDK +L+ +L+ +      + F   +P     +A +L+VIG       F G  GA++ES+CLL TY   +  ++IA++  G      K+KV+ + +N L   +  +   +L  N    +L+   +M    CCGIN   DFD  +  W     ++    P  CC+LK+++K +   ++     SD    Y        +GC++   + + +  ++VI V I +G+  ++ I+ A
Sbjct:   10 AKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVE-SERIEQF--TQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTTITSY---SLGENVDATSLMWNQLMGNFGCCGINDYHDFDA-SPAWVNGKGNRTI--PDACCILKDVAKLVPRDEDCTTNPSDSNSFYK-------KGCYEVFTEWLIRQRELVI-VAIAVGIVHLVLIILA 252          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp66E (gene:FBgn0035936 transcript:FBtr0076508)

HSP 1 Score: 92.0485 bits (227), Expect = 4.787e-21
Identity = 76/260 (29.23%), Postives = 132/260 (50.77%), Query Frame = 1
Query:  139 SKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            +K LL  FN  FF++G  IFG+G+WL VDK +L+ +L+ +      + F   +P     +A +L+VIG       F G  GA++ES+CLL TY   +  ++IA++  G      K+KV+ + +N L   +  +   +L  N    +L+   +M    CCGIN   DFD  +  W     ++    P  CC+LK+++K +   ++     SD    Y        +GC++   + + +  ++VI V I +G+  ++ I+ A
Sbjct:   10 AKYLLCIFNFIFFVLGTIIFGVGLWLAVDKHSLIALLKLVE-SERIEQF--TQPQAIEQLAYVLLVIGAVMFFMSFLGYLGAMRESRCLLSTYGTFLILLLIAEIVAGGLGAFFKDKVRAESKNFLQTTITSY---SLGENVDATSLMWNQLMGNFGCCGINDYHDFDA-SPAWVNGKGNRTI--PDACCILKDVAKLVPRDEDCTTNPSDSNSFYK-------KGCYEVFTEWLIRQRELVI-VAIAVGIVHLVLIILA 252          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp39D (gene:FBgn0032943 transcript:FBtr0273404)

HSP 1 Score: 73.1738 bits (178), Expect = 1.226e-14
Identity = 50/202 (24.75%), Postives = 94/202 (46.53%), Query Frame = 1
Query:  322 ILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALS--PNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            I+L+++G    V  F GCCGA+KES C++ +++ L   + + ++ +G+ AG  K+         L +I+   FN  +      + +    T +  EL CCGING +D++ +          +    P  CC             +++N+    +C    N      GC Q +++ ++    I+  V +G+   ++L I+FAC
Sbjct:   54 IILMIVGAAVAVICFLGCCGALKESSCMILSFALLAVVIFLFEIGLGL-AGYVKH-------TGLHQIMESQFNSTMQHYKERADYRDAWTLLQTELDCCGINGPNDWETV---------YRNSTLPAACC-------------SVINLSEAKEC---TNTHATQHGCLQKLLEILDSKTLILASVVLGVAGIQMLTILFAC 222          
BLAST of Tetraspanin vs. Ensembl Fly
Match: Tsp42Ed (gene:FBgn0029507 transcript:FBtr0345536)

HSP 1 Score: 70.8626 bits (172), Expect = 7.615e-14
Identity = 54/231 (23.38%), Postives = 107/231 (46.32%), Query Frame = 1
Query:  277 DSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAHNKVD*TQNPEDK 969
            D  G+ +    N VAI+++V+G    +  F GCCGAI+E+ C L +YS ++  ++++Q+A+ IY         V++Q SL KI+   ++   +       L++ ++    KCCG+NG +D+ +               +P  CC                +  S+  C  +    +    C ++V    + ++ I+    +G+   E++  +FAC +A+     T+N + +
Sbjct:   39 DFSGVGETFTANSVAIIILVLGCVVFLVAFMGCCGAIRENSCALTSYSVVMLVLLVSQLALIIYVWVD----HVQIQQSLEKIVQTIWDQRKTD-----ALLMDTLQRSFKCCGLNGFADYGI--------------TYPASCC----------------DSPSNGTCALTQ--VMTRSSCLKAVDSFWDTNVSIIKYAGLGVTAVELVAFIFACCLANQ----TRNSQRR 224          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan34 (tetraspanin 34 [Source:ZFIN;Acc:ZDB-GENE-060825-202])

HSP 1 Score: 81.6481 bits (200), Expect = 1.462e-17
Identity = 69/265 (26.04%), Postives = 118/265 (44.53%), Query Frame = 1
Query:  148 LLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAI--LLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAHN 936
            ++  FN   F+ G ++  +G+W+ VD+ +L+  L  I     +D    A P +  +  I  LLI +G F  + GF GCCGA+KESKC+L T+  +V  + + +VA  +     +  V+  L     K+     +      P  F+ +  + M ELKCCG N  +DF         N   +  ++P  CC                      +C           GCF++++  IE +  ++ GV +G+   EI  +V + ++  N
Sbjct:    1 MMFVFNGIIFLAGAAVLAVGIWVAVDRVSLLGFLEHI-----ED----APPELAQLANIGYLLIGVGAFLAIMGFLGCCGAVKESKCMLLTFFIIVLIIFLVEVAAAVVLFVFEPVVQETLNEIGQKVAKSIKDNYGKDEP--FSSIWNTTMNELKCCGYNNYTDFS------GSNFVEETSMYPEKCCS-----------------SGSQRCDERAAEDAVIAGCFRTLVKLIEDNALLLAGVALGIAALEIAAMVVSMILYKN 231          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan18a (tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-232])

HSP 1 Score: 79.7221 bits (195), Expect = 1.005e-16
Identity = 71/259 (27.41%), Postives = 123/259 (47.49%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            K L+  FN   F+ G  + G+G+W+ VD +   E++              A   +F  V  +LI+ G+  L+ GF GCCGAI+E+KCLL  +  L+  + +A++A+ I A   +  +    ++   K L  H+ G  S +  VFT    +IM    CCG+N   DFD   D+      +  ++ P  CC   +L            ++S  +C     + +  +GC+ +V+D  E ++ +   + I +   E+  +VFA
Sbjct:   10 KYLMFIFNFFIFLGGSFLLGVGIWVLVDPTGFREIVA-------------ANSLLFTGVYAILIMGGMLFLL-GFLGCCGAIRENKCLLLFFFMLILVIFLAELAVAILAFIFREHLT---RDYFTKELKTHYQGTNSTD--VFTSTWNAIMTTFNCCGVNSAEDFD---DQSLFRRLNPSRIVPEVCCQRTDL------------MMSKEEC-LRGIMPIRNKGCYSAVVDYFETYIYMAGALAIVVLTIELFAMVFA 233          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan18a (tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-232])

HSP 1 Score: 79.7221 bits (195), Expect = 1.005e-16
Identity = 71/259 (27.41%), Postives = 123/259 (47.49%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            K L+  FN   F+ G  + G+G+W+ VD +   E++              A   +F  V  +LI+ G+  L+ GF GCCGAI+E+KCLL  +  L+  + +A++A+ I A   +  +    ++   K L  H+ G  S +  VFT    +IM    CCG+N   DFD   D+      +  ++ P  CC   +L            ++S  +C     + +  +GC+ +V+D  E ++ +   + I +   E+  +VFA
Sbjct:   10 KYLMFIFNFFIFLGGSFLLGVGIWVLVDPTGFREIVA-------------ANSLLFTGVYAILIMGGMLFLL-GFLGCCGAIRENKCLLLFFFMLILVIFLAELAVAILAFIFREHLT---RDYFTKELKTHYQGTNSTD--VFTSTWNAIMTTFNCCGVNSAEDFD---DQSLFRRLNPSRIVPEVCCQRTDL------------MMSKEEC-LRGIMPIRNKGCYSAVVDYFETYIYMAGALAIVVLTIELFAMVFA 233          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: tspan18a (tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-232])

HSP 1 Score: 79.7221 bits (195), Expect = 1.116e-16
Identity = 71/259 (27.41%), Postives = 123/259 (47.49%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            K L+  FN   F+ G  + G+G+W+ VD +   E++              A   +F  V  +LI+ G+  L+ GF GCCGAI+E+KCLL  +  L+  + +A++A+ I A   +  +    ++   K L  H+ G  S +  VFT    +IM    CCG+N   DFD   D+      +  ++ P  CC   +L            ++S  +C     + +  +GC+ +V+D  E ++ +   + I +   E+  +VFA
Sbjct:   22 KYLMFIFNFFIFLGGSFLLGVGIWVLVDPTGFREIVA-------------ANSLLFTGVYAILIMGGMLFLL-GFLGCCGAIRENKCLLLFFFMLILVIFLAELAVAILAFIFREHLT---RDYFTKELKTHYQGTNSTD--VFTSTWNAIMTTFNCCGVNSAEDFD---DQSLFRRLNPSRIVPEVCCQRTDL------------MMSKEEC-LRGIMPIRNKGCYSAVVDYFETYIYMAGALAIVVLTIELFAMVFA 245          
BLAST of Tetraspanin vs. Ensembl Zebrafish
Match: cd151l (CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-040426-1868])

HSP 1 Score: 77.7962 bits (190), Expect = 5.429e-16
Identity = 61/260 (23.46%), Postives = 123/260 (47.31%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            K LL TFN  F++ GV++  +G+W  ++KS+ + +L                  I+ + A +LI+ G+  ++ G  GCC   KE + LL  Y  L+  + + ++  G+ A     ++  +L+ +L + + + +N +   +    T  +  +  E KCCG N  SD+  +   W ++S++  ++ P  CC  K   +    +++           + +N+     GC   + + I  HL+I+  V +G+   +I+ + F C
Sbjct:   17 KYLLFTFNFLFWLAGVAVMAVGIWTVIEKSDYISLL---------------SSKIYAVSAYILIMAGVIVMITGVLGCCATFKEQRRLLRVYFVLLLCIFLLEILAGVLAYIYYQQLNDELKENLRETMVQKYNQSEQEH---VTKAVDKLQQEFKCCGSNSSSDW--VDSAWIRSSEADGRLVPDSCC--KSPVRKFCGRRD-----------HPSNIYKVEGGCITKLENFILNHLQIIGAVGVGVASVQIVGMFFTC 243          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: gpr88 (G protein-coupled receptor 88 [Source:Xenbase;Acc:XB-GENE-984668])

HSP 1 Score: 91.2781 bits (225), Expect = 9.672e-21
Identity = 72/266 (27.07%), Postives = 129/266 (48.50%), Query Frame = 1
Query:  127 GESIS--KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            G+++S  K L+  FN   F+ G ++ G+GVW+ VD +   E+              IA   +  + A L++ +G    + GF GCCGAI+E+KCLL  +   +  + +A+++  I A   +  +    ++   + + KH++G    +  VF+    SIM    CCG+NG  DF+  A +++      P   P  CC  +  S+          I+S  +C        N +GC+  +++ +E ++ I   + IG+   E+L +VFA
Sbjct:    3 GDNLSCIKYLMFIFNFFIFLGGATLLGLGVWVFVDPTGFREI--------------IATTPLLFMGAYLVLAMGGMLFLLGFLGCCGAIRENKCLLVFFFMFILVIFLAELSAAILAFLFRENLS---KDFFAREVKKHYHG--DNSTEVFSSTWNSIMITFGCCGVNGPEDFN-DAHRFRAMHPFAPV--PEACCRREVQSRA-------GKIVSRAECLTGGENYQNRQGCYSVIVNSVEPYVYIAGALAIGVLAIELLSMVFA 239          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 80.4925 bits (197), Expect = 8.621e-17
Identity = 66/240 (27.50%), Postives = 112/240 (46.67%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTY-SFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK--VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            +W+ VDK++ + +L+                S     + +LI +G FT+V GF GC GA+ E +CLL  Y SFL+  ++IAQVA GI     ++ +K ++ +S+I  L   ++     N S  T     I   L+CCG     +       W  N+  +   +   C  +K  S              +  C Y+  V+  V   GC Q V   ++ +L I++GVC+G+ + E+L ++ +
Sbjct:   33 IWILVDKTSFIAVLQ-------------TSSSYLRTGSYILIAVGGFTMVMGFLGCLGAVNEIRCLLGLYFSFLL-IILIAQVAAGILIYLQRDTLKTEM-SSIIHELIVTYDYEDGKNTSAET-TWDYIQTNLRCCGWTNYQN-------WTANTVVQNSTNQYPCSCMKNQSS------------PNGFCQYNGTVESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILS 237          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd82 (CD82 molecule [Source:NCBI gene;Acc:394799])

HSP 1 Score: 79.7221 bits (195), Expect = 2.215e-16
Identity = 68/241 (28.22%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQ--CPYSNNVK--VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            +W+ VDK++ + +L+                S     + +LI +G FT+V GF GC GA+ E +CLL  Y   +  ++IAQVA GI     ++ +K ++ +S+I  L   ++     N S  T     I   L+CCG     ++   A+   QNS ++   +P  C             KN     S P   C Y+  V+  V   GC Q V   ++ +L I++GVC+G+ + E+L ++ +
Sbjct:   46 IWILVDKTSFIAVLQ-------------TSSSYLRTGSYILIAVGGFTMVMGFLGCLGAVNEIRCLLGLYFSFLLIILIAQVAAGILIYLQRDTLKTEM-SSIIHELIVTYDYEDGKNTSAET-TWDYIQTNLRCCGWTNYQNWT--ANTVVQNSTNQ---YPCSC------------MKN----QSSPNGFCQYNGTVESAVYQTGCMQGVESWLQDNLGIILGVCVGVAVIELLGLILS 250          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: tspan1 (tetraspanin 1 [Source:NCBI gene;Acc:548861])

HSP 1 Score: 75.485 bits (184), Expect = 4.220e-15
Identity = 74/260 (28.46%), Postives = 117/260 (45.00%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSI---FNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIV 912
            KV++I FN+  F+ G ++ G+G+W+ VD ++ +++            FG    S    F  V   LI IG   ++ GF GCCGA +ESKCLL T+  ++  + IA+VA  + A    +  +  L   L  +L   +      NP V T +  S M  L CCG N  +DF   +  +  N Q  P      CC     +  +  ++  +N               +  GCF  +I  I ++  IV GV  G+   E+  +V
Sbjct:    8 KVMMILFNVFIFLGGGTLLGVGIWVSVDSNSFLKI------------FGTVSASAALQFVNVGYFLIAIGSLLVILGFLGCCGAQRESKCLLLTFFSIILIIFIAEVAGAVVALVYSSLAETILGPLLKPVLQNEY----GSNPDV-TKIWNSTMENLHCCGFNNYTDFSN-STFYNNNHQQYPSY----CCNSTSSANSVCTQQGAMN--------------SHVSGCFSQLIYLIRQNAAIVGGVAAGICALELAAMV 231          
BLAST of Tetraspanin vs. Ensembl Xenopus
Match: cd151 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:100144686])

HSP 1 Score: 75.485 bits (184), Expect = 4.231e-15
Identity = 67/267 (25.09%), Postives = 117/267 (43.82%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPS-IFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDF-DVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAHN 936
            K LL TFN  F++ G+++  +G+W  + KS+ + +L                PS  +   A +L++ G   ++ G  GCC   KE K LL  Y  L+  + I +V  GI A     ++  +L+ SL + +   +     P     T  +  +  E KCCG N   D+ D I   W  + +++ ++ P  CC  K +++          I   P     +N+     GC   +   I  HL I+  V IG+   ++  ++F C +  +
Sbjct:   17 KYLLFTFNFFFWLAGLAVMAVGIWTLIQKSDYISLL----------------PSNTYAATAYILVIAGAIVMITGILGCCATFKERKSLLKVYFILLLCIFILEVLAGILAYIYYQQLNAELKQSLKQTMTTKYK---QPGEEKVTNAVDKLQQEFKCCGSNNSEDWRDSI---WINSPEAEKRLVPDSCC--KTVTQRC-------GIRDHP-----SNIYKTEGGCITKLETFIRAHLLIIGAVGIGIACVQLFGMIFTCCLYRS 247          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 86.6557 bits (213), Expect = 4.420e-19
Identity = 63/238 (26.47%), Postives = 110/238 (46.22%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQ---SKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK---VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEIL 903
            VW+  DK++ + +L+                S   + A + I +G  T+V GF GC GA+ E +CLL  Y   +  ++IAQV +G+    + +K+K ++ N+++ I+  +   A S     +  V      ++KCCG        V    W +N +        +P  C  +KE    +  KK      +D      NN +   VNTEGC +     ++++  I++GVC G+ + E+L
Sbjct:   32 VWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGW-------VSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCE--ADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELL 243          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 86.6557 bits (213), Expect = 4.420e-19
Identity = 63/238 (26.47%), Postives = 110/238 (46.22%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQ---SKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK---VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEIL 903
            VW+  DK++ + +L+                S   + A + I +G  T+V GF GC GA+ E +CLL  Y   +  ++IAQV +G+    + +K+K ++ N+++ I+  +   A S     +  V      ++KCCG        V    W +N +        +P  C  +KE    +  KK      +D      NN +   VNTEGC +     ++++  I++GVC G+ + E+L
Sbjct:   32 VWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGW-------VSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCE--ADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELL 243          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 86.6557 bits (213), Expect = 4.420e-19
Identity = 63/238 (26.47%), Postives = 110/238 (46.22%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQ---SKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK---VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEIL 903
            VW+  DK++ + +L+                S   + A + I +G  T+V GF GC GA+ E +CLL  Y   +  ++IAQV +G+    + +K+K ++ N+++ I+  +   A S     +  V      ++KCCG        V    W +N +        +P  C  +KE    +  KK      +D      NN +   VNTEGC +     ++++  I++GVC G+ + E+L
Sbjct:   32 VWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGW-------VSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCE--ADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELL 243          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd82 (CD82 antigen [Source:MGI Symbol;Acc:MGI:104651])

HSP 1 Score: 86.6557 bits (213), Expect = 4.420e-19
Identity = 63/238 (26.47%), Postives = 110/238 (46.22%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQ---SKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK---VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEIL 903
            VW+  DK++ + +L+                S   + A + I +G  T+V GF GC GA+ E +CLL  Y   +  ++IAQV +G+    + +K+K ++ N+++ I+  +   A S     +  V      ++KCCG        V    W +N +        +P  C  +KE    +  KK      +D      NN +   VNTEGC +     ++++  I++GVC G+ + E+L
Sbjct:   32 VWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGW-------VSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCE--ADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELL 243          
BLAST of Tetraspanin vs. Ensembl Mouse
Match: Cd37 (CD37 antigen [Source:MGI Symbol;Acc:MGI:88330])

HSP 1 Score: 71.2478 bits (173), Expect = 1.048e-13
Identity = 49/203 (24.14%), Postives = 92/203 (45.32%), Query Frame = 1
Query:  325 LLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSD--PQ---------CPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEI 900
            +L V G+ T+     GC GA+KE +CLL  Y  ++  +   Q+ +GI   T + +++ ++Q  +++ +  +     +P+ +          F+L+CCG     D++  A   K N   +P V P  C      +      K   + LS   P+         C       +  EGC QS+   +  ++  ++G+C+G+GL E+
Sbjct:   60 VLAVSGVLTMALALLGCVGALKELRCLLGLYFGMLLLLFATQITLGILISTQRVRLERRVQELVLRTIQSYRT---NPDETAAEESWDYAQFQLRCCGWQSPRDWNK-AQMLKANESEEPFV-PCSCYNSTATNDSTVFDKLFFSQLSRLGPRAKLRQTADICALPAKAHIYREGCAQSLQKWLHNNIISIVGICLGVGLLEV 257          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P40237|CD82_MOUSE (CD82 antigen OS=Mus musculus OX=10090 GN=Cd82 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.092e-18
Identity = 63/238 (26.47%), Postives = 110/238 (46.22%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQ---SKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK---VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEIL 903
            VW+  DK++ + +L+                S   + A + I +G  T+V GF GC GA+ E +CLL  Y   +  ++IAQV +G+    + +K+K ++ N+++ I+  +   A S     +  V      ++KCCG        V    W +N +        +P  C  +KE    +  KK      +D      NN +   VNTEGC +     ++++  I++GVC G+ + E+L
Sbjct:   32 VWILADKNSFISVLQ-------------TSSSSLQVGAYVFIGVGAITIVMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVGVLFYFNADKLKKEMGNTVMDIIRNYTANATSSREEAWDYV----QAQVKCCGW-------VSHYNWTENEELMGFTKTTYPCSCEKIKEEDNQLIVKKGFCE--ADNSTVSENNPEDWPVNTEGCMEKAQAWLQENFGILLGVCAGVAVIELL 243          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|O70352|CD82_RAT (CD82 antigen OS=Rattus norvegicus OX=10116 GN=Cd82 PE=1 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 2.405e-16
Identity = 62/238 (26.05%), Postives = 108/238 (45.38%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQN---SQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK---VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEIL 903
            VW+  DKS+ + +L+                S   + A + I +G  T++ GF GC GA+ E +CLL  Y   +  ++IAQV + +    + NK+K ++ N+++ I+  +   A S     +  V      ++KCCG    S+       W +N     S    +P  C   KE    +  KK      SD      N+ +   V+ EGC +     ++++  I++GVC G+ + E+L
Sbjct:   32 VWILADKSSFISVLQ-------------TSSSSLQVGAYVFIGVGAITMLMGFLGCIGAVNEVRCLLGLYFVFLLLILIAQVTVEVLFYFNANKLKQEMGNTVMDIIQNYSVNASSSREEAWDYV----QAQVKCCGWVSPSN-------WTRNPVLKNSTKTTYPCSCEKTKEEDNQLIVKKGFCE--SDNSTASENSPEDWPVHPEGCMEKAQAWLQENFGILLGVCAGVAVIELL 243          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|Q2KIS9|TSN8_BOVIN (Tetraspanin-8 OS=Bos taurus OX=9913 GN=TSPAN8 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 6.107e-16
Identity = 65/228 (28.51%), Postives = 104/228 (45.61%), Query Frame = 1
Query:  247 LRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCG-INGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVV 927
            +R   +G    + G A  ++F  V IL I +G   ++ GF GCCGA+KE++ ++  +   +  +++ QVA GI A T K+K +  L  +L  +++     +   N  VF    + +  ELKCCG +NG SD       W  N Q     H    C   E               SD  C   +   +  + CF S+     K L IV+ +  GL   E+L ++F+ V+
Sbjct:   33 IRAGKIGQEILAPGDADLNLFIAVNIL-IFVGAVIMILGFLGCCGAMKENQFMMILFFVGLLMILLLQVAAGIVATTRKSKTEQALNKTL--LINARLLSSTDENERVFQKAFSELQEELKCCGLVNGASD-------WGSNFQ-----HYYRTC---ECPSE-----------SDSSCTKYSGKTIYKQSCFASISQMFSKRLFIVLALAFGLAAIEVLGLIFSIVL 231          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P19075|TSN8_HUMAN (Tetraspanin-8 OS=Homo sapiens OX=9606 GN=TSPAN8 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 1.300e-14
Identity = 61/202 (30.20%), Postives = 92/202 (45.54%), Query Frame = 1
Query:  325 LLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCG-INGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVV 927
            +LI +G   ++ GF GCCGAIKES+C+L  +   +  +++ QVA GI     K+K    +  +L +  +     A   +   F   I     E KCCG +NG +D       W  N Q  P++    C  L +                   C   N  +V  E C   + D + K+L IVIG+  GL + EIL +VF+ V+
Sbjct:   58 ILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYE--NTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAAD-------WGNNFQHYPEL----CACLDK----------------QRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVL 230          
BLAST of Tetraspanin vs. UniProt/SwissProt
Match: sp|P08962|CD63_HUMAN (CD63 antigen OS=Homo sapiens OX=9606 GN=CD63 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 6.670e-14
Identity = 51/205 (24.88%), Postives = 99/205 (48.29%), Query Frame = 1
Query:  310 NIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHI-FNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            +++ +++I +G+F  +  F GCCGA KE+ CL+ T++  +  +++ +VA  I     ++KV  +  N+  + +  +      P  +    ++  +  + KCCG    +D++      K  S SK +V P  CC+   +   I FN+K                  ++ EGC + +   + K++ +V    +G+   E+L IVFAC
Sbjct:   51 SLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENY------PKNNHTASILDRMQADFKCCGAANYTDWE------KIPSMSKNRV-PDSCCINVTVGCGINFNEK-----------------AIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFAC 225          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A267ERG2 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig023279g1 PE=3 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 7.102e-35
Identity = 94/285 (32.98%), Postives = 155/285 (54.39%), Query Frame = 1
Query:  133 SISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLR----KINLGNNDDSF-GIAKPSIFNIVA-ILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHF-------NGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKW---KQNSQSKPQVHPIGCCVLKELSKHI-----FNKKNLLN-ILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            S++K++L  FNI FF++G +  G+G+W+ V+KS+L  ++     +++ G+N      +A  +   +VA  +LI IG FTLV GFCGCCGA+KESKCLL  Y+FLVG V+  +VA  I A   + +++   ++ +  +  K F       + + S N    T +I  +     CCG     D    +  W    ++ + +    PI CC +++  K       +N  + LN  L DP CP++   + +T+ C+  ++D I K    +IGVC G+ +FE+ CI+ AC
Sbjct:    6 SLAKMILFIFNIVFFLLGAASVGVGIWVAVNKSDLFRVINLIDARVDQGDNKGQIDSVANQNGLVMVAGFILIGIGAFTLVVGFCGCCGAVKESKCLLGMYAFLVGLVLAVEVAAAILAAVYQARIRTAAEDGMYGLQEKMFVAMTDYLSDSTSDNNKTVTTLINYLQMSFDCCGAKKPGDI-ANSSSWLLSNRSWEGRELQTPITCCQIRQDQKTAAAAPGYNWVSKLNGTLVDPSCPFTGTTQ-HTKTCYSGIMDFIGKFAGPLIGVCAGIAVFELFCIIVAC 288          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8GD10 (Tetraspanin OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006680g1 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.290e-34
Identity = 92/286 (32.17%), Postives = 153/286 (53.50%), Query Frame = 1
Query:  133 SISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLR----KINLGNND---DSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHF-------NGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKW---KQNSQSKPQVHPIGCCVLKELSKHI-----FNKKNLLN-ILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            S++K++L  FNI FF++G +  G+G+W+ V+KS+L  ++     +++ G+N    DS    +  +  +   +LI IG FTLV GFCGCCGA+KESKCLL  Y+FLVG V+  +V   I A   + +++   ++ +  +  K F       + + S N    T +I  +     CCG     D    +  W    ++ + +    PI CC +++  K       +N  + LN  L DP CP++   + +T+ C+  ++D I K    +IGVC G+ +FE+ CI+ AC
Sbjct:    6 SLAKMILFIFNIVFFLLGAASVGVGIWVAVNKSDLFRVINLIDARVDQGDNKGQIDSVA-NQNGLVTVAGFILIGIGAFTLVVGFCGCCGAVKESKCLLGMYAFLVGLVLAVEVTAAILAAVYQARIRTAAEDGMYGLQEKMFVAMTDYLSDSTSDNNKTVTTLINYLQMSFDCCGAKKPGDI-ANSSSWLLSNRSWEGRELQTPITCCQIRQDQKTAAAAPGYNWVSKLNGTLVDPSCPFTGTTQ-HTKTCYSGIMDFIGKFAGPLIGVCAGIAVFELFCIIVAC 288          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8GBP6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010912g1 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 4.695e-33
Identity = 97/300 (32.33%), Postives = 157/300 (52.33%), Query Frame = 1
Query:  133 SISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFN---------IVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHF-------------NGALSPNPSV-FTLVITSIMFELKCCGINGESDFDVIADKWKQNS---QSKPQVHPIGCCVLK------ELSKHIFNKKNLLNILSDPQCPYS-NNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAH 933
            S +K++L  FN+ FF+ GV+   +G+W+   K    E+ R INL +   S G  K  I           I A +LI +G+FTL+ GFCGCCGAIKES CLLYTY+ L+G V+  ++   I A   +N+++   + +L  + + +F              G  +   +V + L +  I F+  CCG    +D    +  W  +    + +  V+P+ CC LK      E+    FN  N  + L D  CP++ N+  +N + C+Q ++D I K+   +IGVC+ +GL E++ I+ AC +A+
Sbjct:    6 SFAKLILFIFNVAFFLFGVASLAVGIWVTASKD---ELFRFINLLDGQISAGDGKEQIDTVANQSGLIVIAAYVLIGVGVFTLLVGFCGCCGAIKESTCLLYTYAALIGIVLTIEIVTAILAAVFQNRIRGTAEKALFDLQNNYFVSIPTYEATKAKTTGNDAAKAAVTYLLNLAQISFD--CCGAQQVNDIKN-SSSWLGSDLKFKGRTLVNPMTCCQLKSSSLKTEIKSPAFNWTNFDSYLQDSNCPFTANSPALNQKTCYQGLLDYINKYSLPLIGVCVAIGLIELVGILLACCLAN 299          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8HCC8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.519e-32
Identity = 97/300 (32.33%), Postives = 157/300 (52.33%), Query Frame = 1
Query:  133 SISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFN---------IVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHF-------------NGALSPNPSV-FTLVITSIMFELKCCGINGESDFDVIADKWKQNS---QSKPQVHPIGCCVLK------ELSKHIFNKKNLLNILSDPQCPYS-NNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAH 933
            S +K++L  FN+ FF+ GV+   +G+W+   K    E+ R INL +   S G  K  I           I A +LI +G+FTL+ GFCGCCGAIKES CLLYTY+ L+G V+  ++   I A   +N+++   + +L  + + +F              G  +   +V + L +  I F+  CCG    +D    +  W  +    + +  V+P+ CC LK      E+    FN  N  + L D  CP++ N+  +N + C+Q ++D I K+   +IGVC+ +GL E++ I+ AC +A+
Sbjct:   62 SFAKLILFIFNVAFFLFGVASLAVGIWVTASKD---ELFRFINLLDGQISAGDGKEQIDTVANQSGLIVIAAYVLIGVGVFTLLVGFCGCCGAIKESTCLLYTYAALIGIVLTIEIVTAILAAVFQNRIRGTAEKALFDLQNNYFVSIPTYEATKAKTTGNDAAKAAVTYLLNLAQISFD--CCGAQQVNDIKN-SSSWLGSDLKFKGRTLVNPMTCCQLKSSSLKTEIKSPAFNWTNFDSYLQDSNCPFTANSPALNQKTCYQGLLDYINKYSLPLIGVCVAIGLIELVGILLACCLAN 355          
BLAST of Tetraspanin vs. TrEMBL
Match: A0A1I8GDM2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 4.466e-32
Identity = 97/300 (32.33%), Postives = 157/300 (52.33%), Query Frame = 1
Query:  133 SISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFN---------IVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHF-------------NGALSPNPSV-FTLVITSIMFELKCCGINGESDFDVIADKWKQNS---QSKPQVHPIGCCVLK------ELSKHIFNKKNLLNILSDPQCPYS-NNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAH 933
            S +K++L  FN+ FF+ GV+   +G+W+   K    E+ R INL +   S G  K  I           I A +LI +G+FTL+ GFCGCCGAIKES CLLYTY+ L+G V+  ++   I A   +N+++   + +L  + + +F              G  +   +V + L +  I F+  CCG    +D    +  W  +    + +  V+P+ CC LK      E+    FN  N  + L D  CP++ N+  +N + C+Q ++D I K+   +IGVC+ +GL E++ I+ AC +A+
Sbjct:   79 SFAKLILFIFNVAFFLFGVASLAVGIWVTASKD---ELFRFINLLDGQISAGDGKEQIDTVANQSGLIVIAAYVLIGVGVFTLLVGFCGCCGAIKESTCLLYTYAALIGIVLTIEIVTAILAAVFQNRIRGTAEKALFDLQNNYFVSIPTYEATKAKTTGNDAAKAAVTYLLNLAQISFD--CCGAQQVNDIKN-SSSWLGSDLKFKGRTLVNPMTCCQLKSSSLKTEIKSPAFNWTNFDSYLQDSNCPFTANSPALNQKTCYQGLLDYINKYSLPLIGVCVAIGLIELVGILLACCLAN 372          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: ENSAMXT00000057296.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:7338257:7344161:1 gene:ENSAMXG00000036081.1 transcript:ENSAMXT00000057296.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 4.499e-21
Identity = 63/225 (28.00%), Postives = 105/225 (46.67%), Query Frame = 1
Query:  277 DSFGIAKPSIFNI--VAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQ---NSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAHN 936
            D    A P +  +  V  LLI +G    + GF GCCGAI ESKC+L T+  +V  + IA+VA  I     +   K  LQ   +S +  + +++          FT ++   M ELKCCG N  +DFD     + +N+      +P+ CC                 + +   C  +   +   +GCF +++D +E +  ++ GV +G+   EI  +V + V+ +N
Sbjct:    7 DQIKDAPPELAQLANVGYLLIAVGAILAIMGFLGCCGAITESKCMLLTFFIIVLLIFIAEVAGAIVVFVFQPLAKELLQKVSDSFVLTIRENYG-----EEKTFTSLMNDTMTELKCCGFNNYTDFD--GSPFLKNTSH----YPVTCC-----------------LETSTACSLTEASEQEVKGCFDAILDLLEDNAALLGGVALGIAALEIAAMVVSMVLYNN 203          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan18b (tetraspanin-18-like [Source:NCBI gene;Acc:103035514])

HSP 1 Score: 83.1889 bits (204), Expect = 5.082e-18
Identity = 74/260 (28.46%), Postives = 123/260 (47.31%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVL-KELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            K L+  FN   F+ G  + G+GVW+ VD ++  E++              A P +F  V I+L + G+  L+ GF GCCGA++E+KCLL  +   +  + +A++A  I A   +  +    +    K L KH+ G  + +  V T    +IM    CCG+N   DF    ++   +  +  QV P  CC     L    F+ K+        +C   N +  N +GC+ SV+D  E ++ I   + I +   E+  ++FA
Sbjct:   22 KYLMFVFNFLIFLGGSFLLGVGVWMLVDPTDFREIVA-------------ANPLLFTGVYIILAMGGMLFLL-GFLGCCGALRENKCLLLFFFMFILVIFLAELATAILAFIFREHLT---KEYFTKELRKHYQGYNTSD--VLTTTWNAIMKTFDCCGVNSPEDF----EESLFHVLNPSQVVPEACCRKNSHLGDVSFSNKD--------ECLSGNMLYRNNKGCYSSVVDYFEMYIYIAGALAIVVLTIELFAMIFA 250          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan18b (tetraspanin-18-like [Source:NCBI gene;Acc:103035514])

HSP 1 Score: 78.9518 bits (193), Expect = 1.543e-16
Identity = 70/241 (29.05%), Postives = 114/241 (47.30%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVL-KELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKI 861
            K L+  FN   F+ G  + G+GVW+ VD ++  E++              A P +F  V I+L + G+  L+ GF GCCGA++E+KCLL  +   +  + +A++A  I A   +  +    +    K L KH+ G  + +  V T    +IM    CCG+N   DF    ++   +  +  QV P  CC     L    F+ K+        +C   N +  N +GC+ SV+D  E ++ I
Sbjct:   10 KYLMFVFNFLIFLGGSFLLGVGVWMLVDPTDFREIVA-------------ANPLLFTGVYIILAMGGMLFLL-GFLGCCGALRENKCLLLFFFMFILVIFLAELATAILAFIFREHLT---KEYFTKELRKHYQGYNTSD--VLTTTWNAIMKTFDCCGVNSPEDF----EESLFHVLNPSQVVPEACCRKNSHLGDVSFSNKD--------ECLSGNMLYRNNKGCYSSVVDYFEMYIYI 219          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan11 (tetraspanin-11-like [Source:NCBI gene;Acc:103024246])

HSP 1 Score: 75.0998 bits (183), Expect = 4.383e-15
Identity = 65/270 (24.07%), Postives = 119/270 (44.07%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQC---PYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAHNKV 942
            K LL  FN  F++ G  +  +G+W  +DK   + +L                 S F + A +LI+ G   +V GF GCC  I+E + LL TY   +  + + ++  G+ A     ++  +L+  L K + ++++          T  +  +  + KCCG N  SD+      + Q+ +++ +V P  CC  K ++               P+C    + +N+     GC   +   +  HL I+  V IG+   +I  +VF C + H ++
Sbjct:   18 KYLLFVFNFLFWMGGGVVMAVGIWTLIDKGEYLSLL---------------ASSTFAVSAYILILAGALVMVTGFLGCCAVIREQRSLLSTYFSCLLLIFLIELVAGVLAYVYYQRLSEELKQHLSKTMTENYD---QLGKEGITRAVDRLQQDFKCCGSNNSSDWK--HSVYVQSPEAQGRVVPDSCC--KTIT---------------PECGRRDHPSNIYKVEGGCITKLEHFLADHLLIIGAVGIGVACLQICGMVFTCCL-HRQI 249          
BLAST of Tetraspanin vs. Ensembl Cavefish
Match: tspan35 (tetraspanin-1-like [Source:NCBI gene;Acc:103021497])

HSP 1 Score: 73.9442 bits (180), Expect = 8.036e-15
Identity = 74/260 (28.46%), Postives = 119/260 (45.77%), Query Frame = 1
Query:  121 CFGESISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEI 900
            CFG    K L+  FN   F+ G  I  +G+W+KVD  +++  L+ +N     ++ G  K  + N V  LLI +G   +V GF GCCGA++ES+C+L  +  ++  V IA+VA  I     K  V+ +L   +  I+          NP +  L+ T+ M  LKCCG N  +DF      +  N  + P      CC                   +   C   N +     GCF +++  +  +  I++GV +G+   E+
Sbjct:    3 CFG--FLKALMFVFNGVIFLAGAGILAVGIWVKVDSGSILNFLQNLN-----NAPGELK-QVLN-VGYLLIALGSVLMVMGFLGCCGAVRESRCMLLLFFVILLIVFIAEVAGAIVLLVFKGVVQ-QLITEVGVIIVNSIKKDYGKNPDITGLLNTT-MNTLKCCGFNNYTDFR--NSTFSNNGTTYPPY----CC-------------------NVTICNEGNAIIAKVPGCFLALVSLVNSNASIIVGVALGIAALEL 226          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009492.1 (pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-1 gene:ENSPMAG00000008573.1 transcript:ENSPMAT00000009492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 3.026e-17
Identity = 61/222 (27.48%), Postives = 107/222 (48.20%), Query Frame = 1
Query:  319 AILLIVIGLFTLVAGFCGCCGAIKESKC---LLYTYSFLVGSVIIAQVAIG-IYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVA----HNKVD*TQNP 960
            A+ +IV G   L+ G  GC  A++ES+C          ++ S+ +A VA+G IY G    KV+V++Q      +HK F   + P+    +  +  +  EL+CCG    SD++    +W +  + K    P+ CC          + KN   +LS P        K+  +GC   + D++++ L  +IGV +G    +++ +V ACV+A    H++ +    P
Sbjct:   54 ALAIIVAGAVLLLIGVIGCWAAVRESRCALASFALLLLIIFSLEVAAVALGYIYHG----KVEVEVQQK----MHKAFQNYMGPDYDPESRAVDYMQKELQCCGFANYSDWNTT--EWAR--RHKYNSVPLSCCKR--------SAKNCTGLLSLP-------AKLYQQGCLLKLGDEVQQILTYLIGVAVGFAFLQVMGLVAACVIACRRKHDENERAYEP 248          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: cd82b (CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2857])

HSP 1 Score: 71.633 bits (174), Expect = 1.051e-14
Identity = 54/205 (26.34%), Postives = 93/205 (45.37%), Query Frame = 1
Query:  307 FNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQN-----SQSKPQV-HPIGCCVLKELSKHIFNKKNLLNILSDPQ-CPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEI 900
              I A  L+ IG  T +    GC GA KE +CLL  Y   +  +++AQVAIG     +K K+  KL      I+  ++N + + +P     +  SI  +  CCG+NG  D       WK N       + P + +P  C           N  ++    ++ Q C  S    +  +GC   + D ++ ++ +++ VC+ + +FE+
Sbjct:   32 LTIPAYALVGIGSITCLVSLFGCLGASKEVRCLLAVYFICLVGLLVAQVAIGTVVYINKEKINNKLNGVAFNIIKSYWNLS-TEDPLHTWRLWDSIQQKFNCCGLNGTED-------WKDNVYICDQATYPDITYPCSC---------FNNSSSVQKDHNNTQFCISSPTFAIAEQGCEMHIKDWLQANMSVILAVCVAIAVFEV 219          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: CD151 (CD151 molecule (Raph blood group) [Source:HGNC Symbol;Acc:HGNC:1630])

HSP 1 Score: 62.7734 bits (151), Expect = 1.331e-11
Identity = 58/260 (22.31%), Postives = 116/260 (44.62%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            K +L+ FN  F++ G  +  +GVW  V+K + + +L                 S F   A +LI+ G   ++ G  GCC  ++E +  L  Y  L+  + + +V  GI A   + ++  +L++ + K + + +     P+    T  +  +  E KCCG +  +D+      W + + ++ ++ P  CC  K  +     + +  NI         N V+    GC   +   +++HL ++  V IG+   ++L ++  C
Sbjct:   18 KYVLLVFNFIFWLTGAGVMAVGVWTLVEKGDYLSLL---------------ASSTFAATAYILILAGSVVMLTGLLGCCAVVRERRGCLAAYCGLLLLIFLLEVIAGILAYLYRQQLSEELKSHMNKTIVESYG---QPDQQRVTDAMDKLQQEFKCCGSHDWNDWQ--RSDWVKVAAAEGRLVPDSCC--KSPTTRCGRRDHPSNI---------NRVE---GGCITKLEVILQEHLLLIGAVGIGVACLQVLGMILTC 243          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005284.1 (pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 gene:ENSPMAG00000004798.1 transcript:ENSPMAT00000005284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 5.224e-11
Identity = 45/200 (22.50%), Postives = 95/200 (47.50%), Query Frame = 1
Query:  325 LLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK-VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            ++I +G+   V    GCCGA KES  ++ T+S  +  + +A++A GI A   K++++  ++     +++ +      P        + ++  EL+CCG+    D+   +  W  +  + P   P  CC+            N+ +        + N    + T+GC + +   +++++ +V GV IG+G  +++ I+ AC
Sbjct:   63 VIIAVGVVIFVVAAFGCCGAHKESYFMVATFSVFLFLIFVAELAAGIGAYIFKDQLRDVVETKAKVVINDYPTKNKDP--------VDNMQKELQCCGVVHYQDW-FNSTNWVTSDPNNPNSVPDSCCL------------NVTSGCGQDDIRFKNATAIIYTKGCVEKLEATMKENIVLVGGVAIGIGFAQLIGIILAC 241          
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Match: tspan3a (tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-7787])

HSP 1 Score: 58.151 bits (139), Expect = 4.666e-10
Identity = 36/132 (27.27%), Postives = 66/132 (50.00%), Query Frame = 1
Query:  313 IVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCC 708
            +  ++++ +G+F  V G  GCC  ++ESKC L T+  L+  +   +V   +     + +VK K++ ++ ++ ++ +NG  S   S     I  +  +LKCCG+    D+    D+   N      V PI CC
Sbjct:   54 LAPLVVVAVGIFLFVVGIVGCCATVRESKCGLSTFFILLLMIFSLEVVAALLGYAYRGQVKDKVERTISQVFNE-YNGTDSNTAS---RAIDYVQHQLKCCGVKNYLDWK---DRPWFNHTGNNSV-PISCC 177          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO30837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZN5])

HSP 1 Score: 85.8853 bits (211), Expect = 1.875e-19
Identity = 77/272 (28.31%), Postives = 129/272 (47.43%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSV-FTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTE-GCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVA---HNKV 942
            K LL  FN  F+++G+S+  +G+W ++  S+ M+      L ++D          +   A +LI IG    + GF GCCGA+KE  CLL T+  ++G + + ++   I     ++++K  L + L        + AL   P   F      +   LKCCG    +D+ ++A  W   +     V P  CC      K    K   L +LS P+        +N+E GC+ + +   E  L I+ GV +GL +F+++ I F+C +A   HN +
Sbjct:   14 KFLLFGFNALFWLMGLSVLAVGIWARIQFSDYMK------LSSHD----------YATAAYILIGIGFLIAIIGFIGCCGALKEHTCLLKTFGVILGLLFLVELGTAITGYIFRSEIKTGLSDGL--------DTALKDYPEQGFKDAWNDMQKNLKCCGSRNYTDWFMVA--WAGPNTKNGSV-PESCC------KDTKVKSCNLEVLSHPE-------TINSEQGCYGAAVKYFEDKLVIIGGVALGLAVFQLIGIAFSCCLASTLHNNL 245          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO34309 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPQ7])

HSP 1 Score: 72.7886 bits (177), Expect = 7.123e-15
Identity = 65/266 (24.44%), Postives = 109/266 (40.98%), Query Frame = 1
Query:  133 SISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVH-PIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVV 927
            S +K  L  FN  +  I  ++  + VWL     N  ++          D++ I    I       ++ +G   LV    G CG  +ESKC L  +  L+  V   ++  G+     KN+ K +++N L   +  +     S     F   +  +   L CCG  G +D       W  ++  K + H P  CC                   SD   PY      NT+GC+ +++DK  K+L  +IG+ IG  + +++ ++ AC V
Sbjct:    2 SCAKAFLFFFNFIYLGISAALIYVAVWLMQSYGNYSKI--------TSDTYTIVPAGI-------IVGVGCLVLVTALVGICGTCRESKCCLSIFFILLLVVFSLEITAGVLGAIYKNQAKDEVKNGLTDAIDHY-----SKEEQGFQKAVDKLQENLDCCGSTGPND-------WVNSTFWKEKHHLPKSCCTHD----------------SDVCFPYDKF--HNTKGCYTTLLDKFNKNLSYIIGIGIGFAVLQLIGMLSACCV 222          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO35938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK25])

HSP 1 Score: 71.633 bits (174), Expect = 2.083e-14
Identity = 70/263 (26.62%), Postives = 121/263 (46.01%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTY-SFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKI-LHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK-VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFAC 921
            K LL  FN  F++ G+++ GIG+W KVD                 DSF     S ++I A  +I  G F    GF GCCGA+KES+C+L T+  +L+  ++     + ++    K  +        IKI L +        +  V +  I ++   LKCCG  GE   D +  KWK++  +K ++ P+ CC                   +   C   +  K V + GC   +   ++KH+ ++  + +G+ + ++L ++F+C
Sbjct:    8 KYLLFVFNFFFWLSGLAVLGIGIWTKVDAGQF-------------DSF--LGSSGYSIPAWTMIGAGAFVTFVGFFGCCGAVKESRCMLATWLKYLLTILLSLSKQVNLFELYLKFFLLWHQVQEEIKINLDEQIRNTYGYDSEVESH-INNLQIRLKCCG--GERPGDWLGSKWKRD-LNKDKIVPLSCCTENA---------------NKTTCYKDDTYKEVYSSGCVNELKTFVDKHMILIGAIAVGISIVQLLGMIFSC 236          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO38288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDC9])

HSP 1 Score: 70.8626 bits (172), Expect = 4.505e-14
Identity = 55/201 (27.36%), Postives = 96/201 (47.76%), Query Frame = 1
Query:  319 AILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVK-VNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            A  LI++G    + GF GC GA++E+ CLL  +S ++  +   Q+A+G++    ++KV+  +   L   + K+ + A   N      +I  +  E KCCG  G +D+D        +  S+    P  CC+     K   N++    I      P S+  K +   GC  +V D  + ++ I+ G  +G+ L +I+ I FA
Sbjct:   56 AFALIIVGGIMFILGFSGCIGALRENICLLKFFSVVLAIIFFLQLALGVFVFVFQDKVEAVIVEKLQTAVTKYRDNADLQN------LIDGVQQEFKCCGAKGINDWDKNIYFNCSSPGSEACGVPYSCCI-----KDTINRQCGYGIRKSGT-PTSDQSKIIFIGGCVNAVKDWFKSNMIIIGGAAVGIALLQIMGICFA 244          
BLAST of Tetraspanin vs. Ensembl Nematostella
Match: EDO30884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZI2])

HSP 1 Score: 67.3958 bits (163), Expect = 4.351e-13
Identity = 55/198 (27.78%), Postives = 92/198 (46.46%), Query Frame = 1
Query:  325 LLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            LLI +G    +  F GCCGA KE+KC+L  +  L+  V+  ++A  +    +K+K++  L + +I+ + ++        P      I ++  + +CCG  G SD       W    Q K +  P  CC           K N     +D   P + N K    GCF+++ D +   L I+ G+ IGL + +IL ++ A
Sbjct:   55 LLIAVGCIITIIAFFGCCGAWKENKCMLILFFILLLIVLGLEIAAAVLGYINKDKIQSDLTDDIIRNIKEY--------PKNNKAAIDAMQMDFECCGAKGPSD-------WTFYGQMKYKAGPGSCC----------GKPN-----NDACLPGTRNSK----GCFEAMKDFVNDKLIIIAGLAIGLIVIQILGMILA 218          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan34 (tetraspanin-1 [Source:NCBI gene;Acc:101174246])

HSP 1 Score: 80.1073 bits (196), Expect = 5.707e-17
Identity = 75/266 (28.20%), Postives = 120/266 (45.11%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGI----YAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESD-----FDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIV 912
            KV++  FN   F+ G    G+G+WLKVD  +L+ +L  I  G+  D            VA +LI +G   ++ GF GCCGA+KES+C+L T+  +V  + I +VA  I    + G + +K+   ++N +   L   F           T V  S M + KCCG    +D     F+V++ +           +P  CC                   SD  C  +     +  GCF+ + + +E++  IV GV +G+   EI  +V
Sbjct:    8 KVMMFIFNGGIFLAGAGCLGMGIWLKVDSGSLLGLLEGIENGDGLDQL--------VHVAYVLIGVGAALVIIGFLGCCGAVKESRCMLLTFFCIVLVIFIVEVAGAIVLFAFDGLA-DKILDNVENEVRSKLQTEFG-----RDESLTSVWGSTMEQFKCCGYRNYTDFTGSPFNVVSGE-----------YPSPCCGRS----------------SDSFCSLNEVETSDIPGCFEKLKEFLEENALIVAGVALGIAALEIAAMV 232          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan35 (tetraspanin-1 [Source:NCBI gene;Acc:101164063])

HSP 1 Score: 76.6406 bits (187), Expect = 1.450e-15
Identity = 83/270 (30.74%), Postives = 125/270 (46.30%), Query Frame = 1
Query:  121 CFGESISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIV---AILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTE---GCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIV 912
            CFG    K+++  FN   F+ G +I G+G+W+KVD S+++  L K+      D+     PS FN V     LLI IG   ++ GF GCCGA KE+KC+L  +  ++  V IA+VA  I     +  V   LQ + +  +          NP + T +  S M  L+CCG N  SDF+        +  +K + +P  CC                   S PQ P  N     T+   GCF      I+ +  +++GV +G+   EI  +V
Sbjct:   22 CFG--FLKIMMFIFNGIIFLAGAAILGVGIWVKVDSSSILGFLGKL-----PDA-----PSEFNQVLNVGYLLIAIGALLVLIGFLGCCGASKENKCMLLLFFIIILLVFIAEVAGAIVILAFRPLVDNLLQKASVNAV-ASIQMEYGKNPDL-TGLWNSTMTTLQCCGFNNYSDFN------NSDYYNKTKGYPPQCC-------------------SSPQ-PPCNQTMAETKGVIGCFSKFKKLIDDNSVVIVGVALGIAALEICAMV 251          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan11 (tetraspanin 11 [Source:NCBI gene;Acc:101168088])

HSP 1 Score: 72.4034 bits (176), Expect = 3.442e-14
Identity = 64/269 (23.79%), Postives = 118/269 (43.87%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAHN-KVD 945
            K LL  FN  F++ G ++ G+GVW  V+KS+ + +L                 S F + A +LI+ G   +V GF GCC  I+E +  L  Y F +  + + ++  G+ A     ++  +L+  L + + +++     P     T  +  +  + KCCG N   D+      +  +  ++ +V P  CC   +   H   K++           + +N+     GC   +   +  HL ++  V IG+   +I  +VF C +    K+D
Sbjct:   18 KYLLFIFNFLFWMGGAAVLGVGVWTLVEKSDYLSLL---------------ASSTFAVSAYILILAGSLVVVTGFLGCCAVIRERRRCLSVYFFFLLVIFLIELVAGVLAYVYYQRLSEELKQHLNQTMSENYA---QPGKEAITAAVDRLQQDFKCCGSNNSQDW--AHSVYISSIAAEQRVVPDSCC---KTITHACGKRD-----------HPSNIYKVEGGCITKLEQFLADHLLVIGAVGIGVACLQICGMVFTCCLYRRIKID 252          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: tspan18b (tetraspanin 18 [Source:NCBI gene;Acc:101168705])

HSP 1 Score: 71.633 bits (174), Expect = 6.202e-14
Identity = 76/260 (29.23%), Postives = 121/260 (46.54%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKP-QVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFA 918
            K L+  FN   F+ G  + G+GVW+ VD +   E++              A P +F  V ++L + G+  L+ GF GCCGAI+E+KCLL  +  L+  + +A++A  I A   +  +    +    K L +H+ G    N  VFT    +IM    CCG+N   DF     K  +     P  V P  CC+         ++   L   S  QC   N +  N +GC+ +V+D  E ++ +   + I +   E+  +VFA
Sbjct:   22 KYLMFVFNFLIFLGGSFLLGVGVWVLVDPTGFREIV-------------AANPLLFTGVYVILGMGGMLFLL-GFLGCCGAIRENKCLLLFFFMLILLIFLAELAAAILAFIFREHLT---REYFTKELKRHYQG--YNNTDVFTSTWNAIMTTFDCCGVNSPEDF-----KDSRFRLINPNHVVPEACCLR-------VSQNGELAYTSRDQCLSGNMMFRNNKGCYSAVVDYFELYIYVAGALAIVVLTIELFAMVFA 250          
BLAST of Tetraspanin vs. Ensembl Medaka
Match: ENSORLT00000001610.2 (CD151 molecule (Raph blood group) [Source:NCBI gene;Acc:101161865])

HSP 1 Score: 69.3218 bits (168), Expect = 3.268e-13
Identity = 79/272 (29.04%), Postives = 122/272 (44.85%), Query Frame = 1
Query:  142 KVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPS-IFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIG----IYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNS--QSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAHN 936
            K LL TFN  F++ GV + G+GVW  ++KS+ + +L                PS  +   A +L++ G   +V G  GCC   KE + LL  Y  L+  + + +V  G    IY      ++K+ L+ +LI+   K+  G+        T  +  +  E KCCG N  SD       WK+NS      +  P  CC  K L++          +   P    SN  KV   GC   +   I+ HLKI+  V IG+   +I+ +VF C +  +
Sbjct:   17 KYLLFTFNFFFWLAGVVVMGVGVWTLLEKSDYISLL----------------PSKTYAASAYILVLAGAIVMVTGVLGCCATFKEQRRLLRVYFVLLLCIFLLEVLAGVLAYIYYQQLNEELKLNLKETLIR---KYEVGSYEH----ITRAVDKLQQEFKCCGSNSSSD-------WKENSWVMDTGRKVPDSCC--KTLTEKC-------GVRDHP----SNIYKVEG-GCITKLEKFIQDHLKIIGAVGIGIACVQIVGMVFTCCLYRS 244          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019450.1 (SMESG000019450.1)

HSP 1 Score: 400.208 bits (1027), Expect = 1.123e-140
Identity = 204/231 (88.31%), Postives = 205/231 (88.74%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEI 900
            VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYT                         VKVKLQNSLIKILHKHFNGALSPNPS FTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFE+
Sbjct:   58 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYT-------------------------VKVKLQNSLIKILHKHFNGALSPNPSAFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEV 263          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019443.1 (SMESG000019443.1)

HSP 1 Score: 288.115 bits (736), Expect = 2.852e-96
Identity = 153/277 (55.23%), Postives = 194/277 (70.04%), Query Frame = 1
Query:  118 MCFGESISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKEL----SKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAHN 936
            M F ESI+K+LLI FNICFF+IG  I GIG+W+K+DKSNL EMLR I L     SF     S+F+ +AI LIV+G  T + GFCGCCGAIKES+CLL+ YS  V  VI+ Q+ +GIYAG  KNKV+  L++SL+ +L   FNG +SPNPS+FT  +T+IMFE+KCCGI  E+DF +    WKQ  Q + QVHPIGCC +K+     S++  N   L +IL DP CP +   K+N EGC   +I+KI  +L IVI VC+GLGLFE+LCIVFAC VA  
Sbjct:    1 MSFCESIAKLLLIIFNICFFLIGALILGIGIWVKIDKSNLFEMLRNIKLEETASSFDNTNSSLFDTIAIFLIVLGAITFITGFCGCCGAIKESQCLLFLYSLFVTVVIVGQIGVGIYAGVQKNKVQYYLESSLVSVLENEFNGIISPNPSMFTKALTAIMFEMKCCGIRNENDFKITKQNWKQTIQGQNQVHPIGCCKIKQSFSFDSENKLNYTILSDILVDPLCPVTKATKLNYEGCISVLIEKIRNNLTIVISVCVGLGLFEMLCIVFACCVARR 277          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019444.1 (SMESG000019444.1)

HSP 1 Score: 268.47 bits (685), Expect = 7.355e-89
Identity = 139/237 (58.65%), Postives = 174/237 (73.42%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNI------LSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEI 900
            +W+KVDKSNL EM+R INL     SF     S+F+IVAI+LI++G FT + GFCGCCGAIKES CLL+ YSFLV +VI+AQVA+GIYA   +NK + +L+ SLIKI+ K FNGALS NPS+FT V T++MFE+KCCG+ GE+DF+ I D WKQ    + Q+HPIGCC LK  S H FN K  LN+      + DP C +    K+N +GC  S+IDKI+ HLKIVIGVCIGLGLFE+
Sbjct:   31 IWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTISGRKQIHPIGCCKLKN-SFH-FNSKEKLNLTVVENTIEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEV 265          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000078545.1 (SMESG000078545.1)

HSP 1 Score: 261.922 bits (668), Expect = 5.195e-86
Identity = 148/277 (53.43%), Postives = 186/277 (67.15%), Query Frame = 1
Query:  130 ESISKVLLITFNXXXXXXXXXXXXXXVWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLN----ILSDPQCPYSNN---VKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEILCIVFACVVAHNK 939
            ES SK LLI FN+ FFI+G    G+G+W+KVDKSNL E++RK+NL     SF  +  S  NIVAI+LIV+G FT + GFCGCCGAIKE+ CLLY YSFLVG VI+ +V IGIYAG  K K K  +  +L KIL   FNG +SPN ++FT V T++M ELKCCGI  + DF+     W+Q   +K Q +PIGCC  KE+  +  N K +L+       +P CP + N    K+N  GC QS+ID I K+L IVIGVC+GLGLFEI CI+FAC V   K
Sbjct:    5 ESFSKTLLIIFNVLFFILGGVFLGVGIWVKVDKSNLFEIMRKVNLDGTASSFDSSSSSFLNIVAIVLIVLGTFTFIIGFCGCCGAIKENHCLLYLYSFLVGVVILIEVGIGIYAGVEKGKFKNGIDQALTKILKSEFNGIMSPNATIFTKVFTAVMLELKCCGIKDQEDFNSTKVNWRQIIDNKTQANPIGCCAEKEVYVYNTNDKFVLDKVKPFFKNPDCPTTTNRTQAKLNPTGCSQSLIDLINKNLGIVIGVCVGLGLFEIFCIIFACCVISKK 281          
BLAST of Tetraspanin vs. Planmine SMEST
Match: SMESG000019444.1 (SMESG000019444.1)

HSP 1 Score: 269.24 bits (687), Expect = 3.395e-85
Identity = 139/237 (58.65%), Postives = 174/237 (73.42%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNI------LSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEI 900
            +W+KVDKSNL EM+R INL     SF     S+F+IVAI+LI++G FT + GFCGCCGAIKES CLL+ YSFLV +VI+AQVA+GIYA   +NK + +L+ SLIKI+ K FNGALS NPS+FT V T++MFE+KCCG+ GE+DF+ I D WKQ    + Q+HPIGCC LK  S H FN K  LN+      + DP C +    K+N +GC  S+IDKI+ HLKIVIGVCIGLGLFE+
Sbjct:  344 IWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTINGRKQIHPIGCCKLKN-SFH-FNSKEKLNLTVVENTMEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEV 578          

HSP 2 Score: 268.855 bits (686), Expect = 4.434e-85
Identity = 139/237 (58.65%), Postives = 174/237 (73.42%), Query Frame = 1
Query:  208 VWLKVDKSNLMEMLRKINLGNNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTYSFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPSVFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLKELSKHIFNKKNLLNI------LSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVIGVCIGLGLFEI 900
            +W+KVDKSNL EM+R INL     SF     S+F+IVAI+LI++G FT + GFCGCCGAIKES CLL+ YSFLV +VI+AQVA+GIYA   +NK + +L+ SLIKI+ K FNGALS NPS+FT V T++MFE+KCCG+ GE+DF+ I D WKQ    + Q+HPIGCC LK  S H FN K  LN+      + DP C +    K+N +GC  S+IDKI+ HLKIVIGVCIGLGLFE+
Sbjct:   31 IWVKVDKSNLFEMMRNINLDETAKSFSSTNSSLFDIVAIILIILGAFTFITGFCGCCGAIKESSCLLFMYSFLVAAVIVAQVAVGIYASVQQNKFQARLEKSLIKIVAKDFNGALSSNPSMFTKVFTALMFEMKCCGVKGEADFNGIGDAWKQTISGRKQIHPIGCCKLKN-SFH-FNSKEKLNLTVVENTIEDPNCIFEKETKLNQKGCVVSLIDKIKSHLKIVIGVCIGLGLFEV 265          
The following BLAST results are available for this feature:
BLAST of Tetraspanin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSPAN82.707e-1530.20tetraspanin 8 [Source:HGNC Symbol;Acc:HGNC:11855][more]
TSPAN82.707e-1530.20tetraspanin 8 [Source:HGNC Symbol;Acc:HGNC:11855][more]
TSPAN82.707e-1530.20tetraspanin 8 [Source:HGNC Symbol;Acc:HGNC:11855][more]
CD634.900e-1525.12CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692][more]
CD631.389e-1424.88CD63 molecule [Source:HGNC Symbol;Acc:HGNC:1692][more]
back to top
BLAST of Tetraspanin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tsp-112.880e-1528.35Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
tsp-112.880e-1528.35Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q17526][more]
tsp-121.615e-1226.00Tetraspanin-12 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-175.858e-1126.76Tetraspanin-17 [Source:UniProtKB/Swiss-Prot;Acc:Q... [more]
tsp-138.851e-1127.89Tetraspanin [Source:UniProtKB/TrEMBL;Acc:Q9NET3][more]
back to top
BLAST of Tetraspanin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsp66E4.787e-2129.23gene:FBgn0035936 transcript:FBtr0076507[more]
Tsp66E4.787e-2129.23gene:FBgn0035936 transcript:FBtr0076506[more]
Tsp66E4.787e-2129.23gene:FBgn0035936 transcript:FBtr0076508[more]
Tsp39D1.226e-1424.75gene:FBgn0032943 transcript:FBtr0273404[more]
Tsp42Ed7.615e-1423.38gene:FBgn0029507 transcript:FBtr0345536[more]
back to top
BLAST of Tetraspanin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan341.462e-1726.04tetraspanin 34 [Source:ZFIN;Acc:ZDB-GENE-060825-20... [more]
tspan18a1.005e-1627.41tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-2... [more]
tspan18a1.005e-1627.41tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-2... [more]
tspan18a1.116e-1627.41tetraspanin 18a [Source:ZFIN;Acc:ZDB-GENE-040718-2... [more]
cd151l5.429e-1623.46CD151 antigen, like [Source:ZFIN;Acc:ZDB-GENE-0404... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpr889.672e-2127.07G protein-coupled receptor 88 [Source:Xenbase;Acc:... [more]
cd828.621e-1727.50CD82 molecule [Source:NCBI gene;Acc:394799][more]
cd822.215e-1628.22CD82 molecule [Source:NCBI gene;Acc:394799][more]
tspan14.220e-1528.46tetraspanin 1 [Source:NCBI gene;Acc:548861][more]
cd1514.231e-1525.09CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cd824.420e-1926.47CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd824.420e-1926.47CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd824.420e-1926.47CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd824.420e-1926.47CD82 antigen [Source:MGI Symbol;Acc:MGI:104651][more]
Cd371.048e-1324.14CD37 antigen [Source:MGI Symbol;Acc:MGI:88330][more]
back to top
BLAST of Tetraspanin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40237|CD82_MOUSE3.092e-1826.47CD82 antigen OS=Mus musculus OX=10090 GN=Cd82 PE=1... [more]
sp|O70352|CD82_RAT2.405e-1626.05CD82 antigen OS=Rattus norvegicus OX=10116 GN=Cd82... [more]
sp|Q2KIS9|TSN8_BOVIN6.107e-1628.51Tetraspanin-8 OS=Bos taurus OX=9913 GN=TSPAN8 PE=2... [more]
sp|P19075|TSN8_HUMAN1.300e-1430.20Tetraspanin-8 OS=Homo sapiens OX=9606 GN=TSPAN8 PE... [more]
sp|P08962|CD63_HUMAN6.670e-1424.88CD63 antigen OS=Homo sapiens OX=9606 GN=CD63 PE=1 ... [more]
back to top
BLAST of Tetraspanin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267ERG27.102e-3532.98Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A1I8GD101.290e-3432.17Tetraspanin OS=Macrostomum lignano OX=282301 GN=BO... [more]
A0A1I8GBP64.695e-3332.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HCC81.519e-3232.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GDM24.466e-3232.33Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000057296.14.499e-2128.00pep primary_assembly:Astyanax_mexicanus-2.0:12:733... [more]
tspan18b5.082e-1828.46tetraspanin-18-like [Source:NCBI gene;Acc:10303551... [more]
tspan18b1.543e-1629.05tetraspanin-18-like [Source:NCBI gene;Acc:10303551... [more]
tspan114.383e-1524.07tetraspanin-11-like [Source:NCBI gene;Acc:10302424... [more]
tspan358.036e-1528.46tetraspanin-1-like [Source:NCBI gene;Acc:103021497... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009492.13.026e-1727.48pep scaffold:Pmarinus_7.0:GL476618:258874:270129:-... [more]
cd82b1.051e-1426.34CD82 molecule b [Source:ZFIN;Acc:ZDB-GENE-030131-2... [more]
CD1511.331e-1122.31CD151 molecule (Raph blood group) [Source:HGNC Sym... [more]
ENSPMAT00000005284.15.224e-1122.50pep scaffold:Pmarinus_7.0:GL480552:16638:25636:-1 ... [more]
tspan3a4.666e-1027.27tetraspanin 3a [Source:ZFIN;Acc:ZDB-GENE-030131-77... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tetraspanin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO308371.875e-1928.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343097.123e-1524.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359382.083e-1426.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382884.505e-1427.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308844.351e-1327.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tetraspanin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tspan345.707e-1728.20tetraspanin-1 [Source:NCBI gene;Acc:101174246][more]
tspan351.450e-1530.74tetraspanin-1 [Source:NCBI gene;Acc:101164063][more]
tspan113.442e-1423.79tetraspanin 11 [Source:NCBI gene;Acc:101168088][more]
tspan18b6.202e-1429.23tetraspanin 18 [Source:NCBI gene;Acc:101168705][more]
ENSORLT00000001610.23.268e-1329.04CD151 molecule (Raph blood group) [Source:NCBI gen... [more]
back to top
BLAST of Tetraspanin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019450.11.123e-14088.31SMESG000019450.1[more]
SMESG000019443.12.852e-9655.23SMESG000019443.1[more]
SMESG000019444.17.355e-8958.65SMESG000019444.1[more]
SMESG000078545.15.195e-8653.43SMESG000078545.1[more]
SMESG000019444.13.395e-8558.65SMESG000019444.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026207 ID=SMED30026207|Name=Tetraspanin|organism=Schmidtea mediterranea sexual|type=transcript|length=1078bp
CGGTTTTCTGTTATTAGAGTTCTAGTTTTGCCTGCGCAATCAGTAAAACA
ACCAATCCGATCAGAACATTACATATAAATATCTACACTTATTTTTTATA
GATTAATCTACTTTGAAATGTGTTTCGGTGAATCAATCTCGAAAGTTCTT
TTGATTACTTTCAACATTTGTTTCTTCATCATTGGAGTGTCTATTTTTGG
AATTGGGGTATGGCTAAAGGTCGACAAGTCGAATTTGATGGAAATGCTAA
GAAAGATCAATCTTGGAAATAATGACGATTCATTTGGAATCGCAAAGCCT
TCAATATTTAACATTGTTGCAATACTTCTAATAGTTATCGGTTTATTCAC
ACTTGTCGCCGGTTTCTGTGGCTGTTGTGGAGCGATTAAAGAAAGCAAAT
GTTTATTATATACCTATTCATTCCTCGTGGGTTCGGTCATTATTGCTCAG
GTTGCAATCGGAATCTATGCAGGTACTTCAAAAAATAAAGTAAAAGTTAA
ATTACAAAATTCTTTAATTAAAATCTTGCACAAACATTTCAATGGAGCAC
TTTCTCCAAACCCTTCAGTGTTCACACTGGTTATCACCAGTATAATGTTT
GAGCTGAAATGCTGCGGCATTAATGGAGAATCTGATTTTGATGTCATTGC
AGATAAATGGAAACAAAACTCTCAATCAAAACCTCAAGTTCACCCAATTG
GATGTTGTGTATTGAAAGAGTTGTCCAAGCATATCTTTAACAAAAAGAAT
TTATTAAACATTTTGAGTGATCCTCAATGTCCGTATTCTAATAATGTAAA
AGTTAATACAGAAGGATGCTTTCAGTCTGTAATAGATAAAATCGAAAAAC
ATCTGAAGATTGTTATCGGAGTTTGCATCGGTTTGGGATTGTTTGAGATT
CTCTGCATCGTGTTCGCTTGTGTTGTGGCACATAATAAAGTTGACTGAAC
TCAAAATCCTGAAGACAAATGCTAGAAACGCTTTCCTTTAAAACTGTTTA
ATTTAAAACTAAACTTTGAAAAGTATATTTGACATTTATTTATTTATTTT
AATTATATGTTGACTTTCTAAAAAAAAA
back to top

protein sequence of SMED30026207-orf-1

>SMED30026207-orf-1 ID=SMED30026207-orf-1|Name=SMED30026207-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=277bp
MCFGESISKVLLITFNICFFIIGVSIFGIGVWLKVDKSNLMEMLRKINLG
NNDDSFGIAKPSIFNIVAILLIVIGLFTLVAGFCGCCGAIKESKCLLYTY
SFLVGSVIIAQVAIGIYAGTSKNKVKVKLQNSLIKILHKHFNGALSPNPS
VFTLVITSIMFELKCCGINGESDFDVIADKWKQNSQSKPQVHPIGCCVLK
ELSKHIFNKKNLLNILSDPQCPYSNNVKVNTEGCFQSVIDKIEKHLKIVI
GVCIGLGLFEILCIVFACVVAHNKVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000224cement gland
PLANA:0000232copulatory apparatus
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000301Tetraspanin
IPR018499Tetraspanin/Peripherin
IPR008952Tetraspanin_EC2_sf
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000301TetraspaninPRINTSPR00259TMFOURcoord: 208..234
score: 24.51
coord: 24..50
score: 35.46
coord: 51..79
score: 29.05
IPR000301TetraspaninPIRSFPIRSF002419Tetraspanincoord: 6..236
e-value: 1.3E-31
score: 107.3
IPR018499Tetraspanin/PeripherinPFAMPF00335Tetraspanincoord: 23..231
e-value: 1.9E-34
score: 119.4
NoneNo IPR availablePANTHERPTHR19282TETRASPANINcoord: 17..230
NoneNo IPR availablePANTHERPTHR19282:SF402TETRASPANINcoord: 17..230
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 208..230
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
IPR008952Tetraspanin, EC2 domain superfamilySUPERFAMILYSSF48652Tetraspanincoord: 88..206