Limb development membrane protein 1

Overview
NameLimb development membrane protein 1
Smed IDSMED30026206
Length (bp)1719
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Limb development membrane protein 1 (SMED30026206) t-SNE clustered cells

Violin plots show distribution of expression levels for Limb development membrane protein 1 (SMED30026206) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Limb development membrane protein 1 (SMED30026206) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Limb development membrane protein 1 (SMED30026206) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026206

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30026206h1SMcG0018459 dd_Smed_v4_9923_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30026206h1SMcG0018459 DN315729smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30026206h1SMcG0018459 DN315729smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30026206h1SMcG0018459 DN315729smed_ncbi_20240424PMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30026206h1SMcG0018459 dd_Smed_v4_9923_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Limb development membrane protein 1 vs. Ensembl Human
Match: LMBR1L (limb development membrane protein 1 like [Source:HGNC Symbol;Acc:HGNC:18268])

HSP 1 Score: 228.794 bits (582), Expect = 1.320e-67
Identity = 154/454 (33.92%), Postives = 235/454 (51.76%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXX----XXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FHE +R C+   L+F TL I+            +   +DD       D    ++AL  CTF+ +I+L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+       N     SL D W YYLP +YS +S +GV++L V +PLG   +   + K L          + L   + E+ A  RR           D E  H   ++   + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   S+LG FGA +Q+VLI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDD------EDATVNKIALELCTFTLAIALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLMLLTLLVLGMVWVASAIVDKNKANRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLH---RQVLALQTQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGSFGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAG 445          
BLAST of Limb development membrane protein 1 vs. Ensembl Human
Match: LMBR1 (limb development membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:13243])

HSP 1 Score: 224.942 bits (572), Expect = 3.206e-66
Identity = 133/389 (34.19%), Postives = 219/389 (56.30%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN--DSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFC 1448
             D    +++L   TF+ ++S  A  LLP SIISNEI++ +P++YY+QW+N SLI  LWN  SL SN+ +F+LMPFA  FL+SEGF GLK  I  R++E +        +ILG VW+      ++     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I++E+ A +RR N   S   +   + E  + +  TL  K + +   + +   L+   + + L ++   +  + V  N + +++   A+PK      +G    S  G+ GAA++I+LI YL++SSV   YS+    N+TPK+  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F 
Sbjct:   52 EDAIVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLSFPQNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERNLVYPAVMVLL-LIETSISVLLVACNILCLLVDETAMPKGTRGPGIGNASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFA 439          
BLAST of Limb development membrane protein 1 vs. Ensembl Human
Match: LMBR1 (limb development membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:13243])

HSP 1 Score: 210.305 bits (534), Expect = 2.441e-60
Identity = 139/429 (32.40%), Postives = 223/429 (51.98%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN-------DSEYHHFYKQEE---------------------PTVSSSNTLNEKQQTQVNKNCYFLYLILSMLT---------IWLAILIIGLL-----TIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFC 1448
             D    +++L   TF+ ++S  A  LLP SIISNEI++ +P++YY+QW+N SLI  LWN  SL SN+ +F+LMPFA  FL+SEGF GLK  I  R++E +        +ILG VW+      ++     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I++E+ A +RR N       + E     +  E                     P +SSS   N  +  Q  +N   L   L             ++ A++++ L+      + V  N + +++   A+PK      +G    S  G+ GAA++I+LI YL++SSV   YS+    N+TPK+  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F 
Sbjct:   50 EDAIVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLSFPQNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNVGMLCAGNPEVATGRQVPEEQAGQLLLGKWIQEGGDMIANPRLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERNLVYPAVMVLLLIETSISVLLVACNILCLLVDETAMPKGTRGPGIGNASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFA 478          
BLAST of Limb development membrane protein 1 vs. Ensembl Human
Match: LMBR1L (limb development membrane protein 1 like [Source:HGNC Symbol;Acc:HGNC:18268])

HSP 1 Score: 203.756 bits (517), Expect = 1.881e-58
Identity = 146/454 (32.16%), Postives = 225/454 (49.56%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXX----XXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FHE +R C+   L+F TL I+            +   +DD       D    ++AL  CTF+ +I+L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+       N     SL D W YYLP +YS +S +GV++L V +PLG   +   + K L          + L   + E+ A  RR           D E  H   ++   + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+                     +Q+VLI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDD------EDATVNKIALELCTFTLAIALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLMLLTLLVLGMVWVASAIVDKNKANRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLH---RQVLALQTQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAIHILELLIDEAAMPR--------------------GMQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAG 425          
BLAST of Limb development membrane protein 1 vs. Ensembl Human
Match: LMBR1 (limb development membrane protein 1 [Source:HGNC Symbol;Acc:HGNC:13243])

HSP 1 Score: 98.9821 bits (245), Expect = 1.898e-22
Identity = 69/249 (27.71%), Postives = 127/249 (51.00%), Query Frame = 3
Query:  621 GAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTND--SEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGL 1361
            G VW+      ++     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I++E+ A +RR N   S   +   + E  + +  TL  K + +   + +   L+   + + L ++   +  + V  N + +++   A+PK      +G    S  G+ GAA++I+LI YL++SSV   YS+    N+TPK+  T +  ++ N +  L++ SA+P+ SR LGL
Sbjct:   11 GIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDLDEQIYIITLEEEALQRRLNGLSSSVEYNIMELEQELENVKTLKTKLERRKKASAWERNLVYPAVMVLL-LIETSISVLLVACNILCLLVDETAMPKGTRGPGIGNASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGL 258          
BLAST of Limb development membrane protein 1 vs. Ensembl Celegans
Match: R05D3.2 (LIMR family protein R05D3.2 [Source:UniProtKB/Swiss-Prot;Acc:P34535])

HSP 1 Score: 98.9821 bits (245), Expect = 2.027e-21
Identity = 63/229 (27.51%), Postives = 120/229 (52.40%), Query Frame = 3
Query:  267 DRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLK--NNIHNRVMEAIC---FFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSD---DLLEISVEKPASERRTNDSEYHHFYKQEEP 929
            +  +  + D+  Y+V++   + + + S+ + TLLP S+I  E++  Y  +YY+QW++ SLI  LWN V + SN+++F+L+PF+  F++S+GF   K  N++  R+ EA+     F+F L  +   V  +        +   S   +    LPL+YS VS IG ++L + +P G   +   +    RD + + +++D   +  E S +    +  ++D   H   + + P
Sbjct:   97 EALYAGEEDYFVYRVSVWISSTATATSIGSLTLLPFSVIGVELLQLYDGNYYLQWLSYSLIGALWNYVFVLSNVSLFVLLPFSYFFIESQGFSTSKIGNDMTQRIYEAMAISFLFAFVLLCLAEVVLTIL-------DYPVSFLSITSVNLPLIYSCVSFIGAVLLLISTPYGFAKMFSLA----RDFLVTEETADIEEENSEQSEDVTEPKNSSSDETIHQVDRSDTP 314          

HSP 2 Score: 73.9442 bits (180), Expect = 1.405e-13
Identity = 61/224 (27.23%), Postives = 103/224 (45.98%), Query Frame = 3
Query:  867 PASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGFQKIANIYVHKVVLVDSLREVWK 1538
            P S  R   SE    +K    TV SS       + Q      F+ L   +    L +L    L I V  N + ++ G ++LP     +++  H     G FGA ++ +LI Y++++S   +YS+  + +  P R  T +  ++ NS   L++ SA+P+    +G+TTF+ LG+   L WL S  +V+AYN  F      + F ++              R++WK
Sbjct:  498 PLSPARRTKSE-EAIWKPVLHTVKSSKLYKRAIEKQGRLVKLFMSLRFPVAAAALLVLTTCSL-IMVATNTLKLLFGYRSLPVYAQYIEV--HTRHSFGLFGACIETLLIIYVMITSFVGLYSLPVLRSLRPVRKDTPMPTIIINSSIVLVVASALPVAVNTVGMTTFDLLGSHSSLQWLGSFRVVVAYNTLFVVLSVAFLFNQLT---------ASMRRQIWK 708          
BLAST of Limb development membrane protein 1 vs. Ensembl Fly
Match: lili (gene:FBgn0027539 transcript:FBtr0331697)

HSP 1 Score: 197.593 bits (501), Expect = 4.685e-56
Identity = 131/442 (29.64%), Postives = 221/442 (50.00%), Query Frame = 3
Query:  285 KSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLW-----HYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHH-----------------------FYK------------QEEPTVSSSNTLNE---------KQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAI 1463
            + +   Y+++   CTF+ +++  A  LLP+SI SNE+++ YP SYY++W+N+SLIQ LWN V L SN+++FI +PF  LF +S GF G K  I  RV E     +FT+FM++  + +V             L+  W       +LP +YS VS +GVM++ + +P G   +    ++ L   M     +++     +E+ + +R+    E H+                       FY             Q +   S  + LN+         K+  ++  +  F    +  L + L +    +  + V+ N + ++IG++ALP +  +  LG    S+LG FGA +++ LI YL  +SV   YS+  M    PKR  T +  L+ N    L++ SA+P+ SR++G+T F+ LG FG ++WL +  +VL YN+ F    A+
Sbjct:   58 EDEVLVYRISFWLCTFTLAVAEGAAMLLPVSIASNEVLLLYPNSYYVKWLNSSLIQGLWNHVFLFSNLSLFIFLPFVYLFSESTGFVGNKKGILPRVYE-----TFTVFMLMAIIVLVLTAVLSAVFGIEKLQFFWFLNLGSVHLPFLYSCVSFLGVMLMLICTPYGFVRLFGVVNQVLVRPMLLRDVNEEFSAFYMEEASVKRKLAHIELHNVSIADAANGGRLGNRIGLGRGRTFYPQPLLQHSQAHLYQRKAMASDVDELNDRLRELDSERKELDKLRTSSTFQRTFVYPLAMLLLLFCTAVTILLVVQNTLELLIGIKALPLSTRQFALGISSLSKLGPFGAGLEVCLIFYLGATSVVGFYSMPFMRKVCPKRRQTSLPQLMLNCGFMLVLSSALPLLSRIIGITNFDLLGDFGAIEWLGNFQIVLLYNLVFGTTTAL 494          
BLAST of Limb development membrane protein 1 vs. Ensembl Fly
Match: lili (gene:FBgn0027539 transcript:FBtr0084739)

HSP 1 Score: 197.593 bits (501), Expect = 6.543e-56
Identity = 131/442 (29.64%), Postives = 221/442 (50.00%), Query Frame = 3
Query:  285 KSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLW-----HYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHH-----------------------FYK------------QEEPTVSSSNTLNE---------KQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAI 1463
            + +   Y+++   CTF+ +++  A  LLP+SI SNE+++ YP SYY++W+N+SLIQ LWN V L SN+++FI +PF  LF +S GF G K  I  RV E     +FT+FM++  + +V             L+  W       +LP +YS VS +GVM++ + +P G   +    ++ L   M     +++     +E+ + +R+    E H+                       FY             Q +   S  + LN+         K+  ++  +  F    +  L + L +    +  + V+ N + ++IG++ALP +  +  LG    S+LG FGA +++ LI YL  +SV   YS+  M    PKR  T +  L+ N    L++ SA+P+ SR++G+T F+ LG FG ++WL +  +VL YN+ F    A+
Sbjct:   58 EDEVLVYRISFWLCTFTLAVAEGAAMLLPVSIASNEVLLLYPNSYYVKWLNSSLIQGLWNHVFLFSNLSLFIFLPFVYLFSESTGFVGNKKGILPRVYE-----TFTVFMLMAIIVLVLTAVLSAVFGIEKLQFFWFLNLGSVHLPFLYSCVSFLGVMLMLICTPYGFVRLFGVVNQVLVRPMLLRDVNEEFSAFYMEEASVKRKLAHIELHNVSIADAANGGRLGNRIGLGRGRTFYPQPLLQHSQAHLYQRKAMASDVDELNDRLRELDSERKELDKLRTSSTFQRTFVYPLAMLLLLFCTAVTILLVVQNTLELLIGIKALPLSTRQFALGISSLSKLGPFGAGLEVCLIFYLGATSVVGFYSMPFMRKVCPKRRQTSLPQLMLNCGFMLVLSSALPLLSRIIGITNFDLLGDFGAIEWLGNFQIVLLYNLVFGTTTAL 494          
BLAST of Limb development membrane protein 1 vs. Ensembl Zebrafish
Match: lmbr1 (limb development membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-090128-4])

HSP 1 Score: 213.772 bits (543), Expect = 3.667e-62
Identity = 134/405 (33.09%), Postives = 221/405 (54.57%), Query Frame = 3
Query:  264 DDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDS--------EYHHFYKQEEPTVSSSNTLNEKQQTQV-NKNCYFLYLILSMLT-IWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFC 1448
            DD+      D    ++++  CTF+ ++S  A  LLP SIISNEI++  PK+YY+QW+N SLI  LWN VSL SN+++F+LMPFA  FL+SEGF G K  I  RV+E          +ILG VW+      ++     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I +++ A ERR N          +  H +K+ +   +  + L  +++     KN  +  ++L +L    +++L++ L  +Y++ +         A+PK   +  +G    S  G   A V+I+L+ YLL+SSV   YS+      TP++  T++  ++   +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F 
Sbjct:   45 DDQ---EDEDAIVNRISMYLCTFTLAVSGGAVLLLPFSIISNEILLSLPKNYYIQWLNGSLIHGLWNLVSLFSNLSLFVLMPFAYFFLESEGFAGSKKGIKARVLETFVMLFLLGLLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGGLLLLMCTPVGLSRMFTVMGQLLVKPTILEDLDEQIYCIQLQEEALERRLNGECLFTSVKYDILHLHKELDSVRNQRHKLERRKKASAWEKNLLYPIVMLILLAGTTISVLLVALNIVYLLVDET-------AMPKGSTERDIGNASLSTFGVAQAVVEIILMFYLLVSSVVGFYSLRIFQELTPRKDDTNMTTIIGCCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFA 439          
BLAST of Limb development membrane protein 1 vs. Ensembl Zebrafish
Match: lmbr1l (limb development membrane protein 1-like [Source:NCBI gene;Acc:321314])

HSP 1 Score: 200.675 bits (509), Expect = 2.657e-57
Identity = 137/398 (34.42%), Postives = 213/398 (53.52%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERR----TND---SEYHHFYKQEEPTVSSSNTLNE--KQQTQVNKN-CYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
             D    ++AL  CTF+ S+++ A  LLP+SI+SNE+++ +P SYYMQW+N SLI+ LWN V L SN+++  LMPFA  F +SEGF G K  +  RV E          ++LG VW+       N     SL DLW YYLP +YS +SL GV++L + +P G   +   +  SL       ++ ++ +  +V + AS  R    TN    S +     +E  +V S     E  K+ +   +N  Y + ++L +    +++L+       V ++ + ++    A+P+  +   LG    S LG  GAAVQ+V+I YL++SSV   YS        P+   T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  DWL S  +V  YN+ F  
Sbjct:   53 EDATVNKIALWLCTFTLSVAVCAVLLLPISILSNEVLLTFPHSYYMQWLNGSLIRGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSKKGVMARVYETAVMLLLLSLLVLGIVWVASALLHHN-TARESLYDLWEYYLPYLYSGISLFGVLLLLLCTPFGLSRMFSVTG-SLLVKPRLLENLEETMNCAVFEEASLSRKLKSTNTCWISAHLEALNKEFLSVQSKRITLELRKRASPWQRNLVYPVAMLLLLALTAVSVLM-------VCFHVLELLFDESAMPRGMEDPHLGLASFSMLGSLGAAVQVVIILYLMVSSVVGFYSSPLFTGLLPRAQDTTLTQIIGNCVSLLILSSALPVFSRTLGITKFDLLGDFGRHDWLGSFHIVFLYNMLFAG 441          
BLAST of Limb development membrane protein 1 vs. Ensembl Zebrafish
Match: lmbr1 (limb development membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-090128-4])

HSP 1 Score: 183.726 bits (465), Expect = 1.470e-51
Identity = 123/399 (30.83%), Postives = 206/399 (51.63%), Query Frame = 3
Query:  264 DDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN-DSEYHHFYKQEEPTVSSSNTLNEKQQTQV-NKNCYFLYLILSMLT-IWLAILIIGLLTIYVIYNAVGIVIGLQALPKAR-DKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFC 1448
            DD+      D    ++++  CTF+ ++S  A  LLP SIISNEI++  PK+YY+QW+N SLI  LWN VSL SN+++F+LMPFA  FL+SEGF G K  I  RV+E          +ILG VW+      ++     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I +++ A ERR N +  +HH +K+ +   +  + L  +++     KN  +  ++L +L    +++L++ L  +Y++ +         A+PK + DKL                                      +   TP++  T++  ++   +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F 
Sbjct:   30 DDQ---EDEDAIVNRISMYLCTFTLAVSGGAVLLLPFSIISNEILLSLPKNYYIQWLNGSLIHGLWNLVSLFSNLSLFVLMPFAYFFLESEGFAGSKKGIKARVLETFVMLFLLGLLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGGLLLLMCTPVGLSRMFTVMGQLLVKPTILEDLDEQIYCIQLQEEALERRLNGECLFHHLHKELDSVRNQRHKLERRKKASAWEKNLLYPIVMLILLAGTTISVLLVALNIVYLLVDET-------AMPKVKGDKL--------------------------------------VNELTPRKDDTNMTTIIGCCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFA 380          
BLAST of Limb development membrane protein 1 vs. Ensembl Zebrafish
Match: lmbr1 (limb development membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-090128-4])

HSP 1 Score: 175.252 bits (443), Expect = 1.807e-48
Identity = 123/396 (31.06%), Postives = 201/396 (50.76%), Query Frame = 3
Query:  264 DDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLT-IWLAILIIGLLTIYVIYNAVGIVIGLQALPKAR-DKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGF 1445
            DD+      D    ++++  CTF+ ++S  A  LLP SIISNEI++  PK+YY+QW+N SLI  LWN VSL SN+++F+LMPFA  FL+SEGF G K  I  RV+E          +ILG VW+      ++     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I +++ A ERR N  +     +  E  +S S     K+ +   KN  +  ++L +L    +++L++ L  +Y++ +         A+PK + DKL                                      +   TP++  T++  ++   +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F
Sbjct:   34 DDQ---EDEDAIVNRISMYLCTFTLAVSGGAVLLLPFSIISNEILLSLPKNYYIQWLNGSLIHGLWNLVSLFSNLSLFVLMPFAYFFLESEGFAGSKKGIKARVLETFVMLFLLGLLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGGLLLLMCTPVGLSRMFTVMGQLLVKPTILEDLDEQIYCIQLQEEALERRLNGDQ--STIRTLELFLSPSILERRKKASAWEKNLLYPIVMLILLAGTTISVLLVALNIVYLLVDET-------AMPKVKGDKL--------------------------------------VNELTPRKDDTNMTTIIGCCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLF 379          
BLAST of Limb development membrane protein 1 vs. Ensembl Zebrafish
Match: lmbr1 (limb development membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-090128-4])

HSP 1 Score: 172.555 bits (436), Expect = 1.765e-47
Identity = 122/402 (30.35%), Postives = 201/402 (50.00%), Query Frame = 3
Query:  264 DDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNE-----KQQTQVNKNCYFLYLILSMLT-IWLAILIIGLLTIYVIYNAVGIVIGLQALPKAR-DKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFC 1448
            DD+      D    ++++  CTF+ ++S  A  LLP SIISNEI++  PK+YY+QW+N SLI  LWN VSL SN+++F+LMPFA  FL+SEGF G K  I  RV+E          +ILG VW+      ++     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I +++ A ERR N          +   ++  N  +E     K+ +   KN  +  ++L +L    +++L++ L  +Y++ +         A+PK + DKL                                      +   TP++  T++  ++   +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F 
Sbjct:   30 DDQ---EDEDAIVNRISMYLCTFTLAVSGGAVLLLPFSIISNEILLSLPKNYYIQWLNGSLIHGLWNLVSLFSNLSLFVLMPFAYFFLESEGFAGSKKGIKARVLETFVMLFLLGLLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGGLLLLMCTPVGLSRMFTVMGQLLVKPTILEDLDEQIYCIQLQEEALERRLNGECLFLSPSPDYKVMNGQNKYSESLERRKKASAWEKNLLYPIVMLILLAGTTISVLLVALNIVYLLVDET-------AMPKVKGDKL--------------------------------------VNELTPRKDDTNMTTIIGCCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFA 383          
BLAST of Limb development membrane protein 1 vs. Ensembl Xenopus
Match: mctp1 (multiple C2 domains, transmembrane 1 [Source:Xenbase;Acc:XB-GENE-5812768])

HSP 1 Score: 228.409 bits (581), Expect = 1.244e-67
Identity = 146/429 (34.03%), Postives = 232/429 (54.08%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFY--KQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIA---IYGFQKIANIYVHKVVLVDSLREVWKCLDS-SP 1556
             D    +V+L  CTF+ ++S  A  LLP SIISNEI++ +PKSYY+QW+N SLI  LWN VSL SN+ +F+LMPFA  FL+SEGF GLK  I  R++E I        +I G VW+      ++     SL DLW  YLP +YS +SL+G ++L + +P+G   +     + L          + +  IS+++ A +R+ N   Y   Y  K+ E  + ++ ++  K + + N + +   L+   + I L I     + I V  N + +++   A+PK       G       G+ GA ++I+LI YL++SSV   YS+    ++TP++  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +V+AYN+ F        +  F       + K + +D L+   K  DS SP
Sbjct:   51 EDATVNRVSLFLCTFTLAVSGGAVLLLPFSIISNEILLCFPKSYYIQWLNGSLIHGLWNLVSLFSNLCLFVLMPFAFFFLESEGFAGLKKGIKARILETIIMLILLALLIFGIVWVASALIDNSSASMESLYDLWDCYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDIDEQMYIISLQEEALQRKLNGGNYTADYSRKKIEHDLLNARSMKSKLERRKNASAWQRNLVYPAVMILLLIATFSSV-ILVSLNILRLLVDETAMPKGSKGSGFGDASLFTFGFAGATLEIILIFYLMVSSVVGFYSLRFFSSFTPRKDDTTMTKVIGNCLSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVVAYNLMFAVMTTLCLVRKFTSAVREELLKAIGLDRLQLSNKSSDSPSP 478          
BLAST of Limb development membrane protein 1 vs. Ensembl Xenopus
Match: mctp1 (multiple C2 domains, transmembrane 1 [Source:Xenbase;Acc:XB-GENE-5812768])

HSP 1 Score: 228.409 bits (581), Expect = 1.244e-67
Identity = 146/429 (34.03%), Postives = 232/429 (54.08%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFY--KQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIA---IYGFQKIANIYVHKVVLVDSLREVWKCLDS-SP 1556
             D    +V+L  CTF+ ++S  A  LLP SIISNEI++ +PKSYY+QW+N SLI  LWN VSL SN+ +F+LMPFA  FL+SEGF GLK  I  R++E I        +I G VW+      ++     SL DLW  YLP +YS +SL+G ++L + +P+G   +     + L          + +  IS+++ A +R+ N   Y   Y  K+ E  + ++ ++  K + + N + +   L+   + I L I     + I V  N + +++   A+PK       G       G+ GA ++I+LI YL++SSV   YS+    ++TP++  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +V+AYN+ F        +  F       + K + +D L+   K  DS SP
Sbjct:   51 EDATVNRVSLFLCTFTLAVSGGAVLLLPFSIISNEILLCFPKSYYIQWLNGSLIHGLWNLVSLFSNLCLFVLMPFAFFFLESEGFAGLKKGIKARILETIIMLILLALLIFGIVWVASALIDNSSASMESLYDLWDCYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDIDEQMYIISLQEEALQRKLNGGNYTADYSRKKIEHDLLNARSMKSKLERRKNASAWQRNLVYPAVMILLLIATFSSV-ILVSLNILRLLVDETAMPKGSKGSGFGDASLFTFGFAGATLEIILIFYLMVSSVVGFYSLRFFSSFTPRKDDTTMTKVIGNCLSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVVAYNLMFAVMTTLCLVRKFTSAVREELLKAIGLDRLQLSNKSSDSPSP 478          
BLAST of Limb development membrane protein 1 vs. Ensembl Xenopus
Match: adora1 (adenosine A1 receptor [Source:Xenbase;Acc:XB-GENE-944026])

HSP 1 Score: 215.698 bits (548), Expect = 9.065e-63
Identity = 151/451 (33.48%), Postives = 240/451 (53.22%), Query Frame = 3
Query:  123 MHTDEIISSETETFHEILRSCVTXXXXXXXXXXXXXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSK-----SLRDLMSSHKSSDDLLEISVEKPASERRTN--DSEYHHFYKQEEPTVSSSNTLNEKQQTQV-NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            M  ++ +S   + FH+ +R C+   L+F TL ++S+I+I KFK     D   V   D    ++AL  CTF+ ++S+ A  LLP SIISNE+++  P +YY+QW+N SL+  LWN V L SN+++  LMPFA LF ++EGF G K  + +RV E          ++ G VW+    F D+     SL DLW YYLP +YS +SL GV++L + +P G   +   + K      L + +  H S     E ++ +  S + +   +       K+     S   TL  +++     +N  +   +L +L       + G+  + V  N + ++I   A+PK     +LG+   S  G FGAAVQ++LI YL+ SSV   YS    +   P++  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  L+L YN+ F  
Sbjct:    1 MEVNQDVSVREQIFHDWVRECIICTLLFSTLYLLSYIVITKFKKHA--DFATVDVEDAAVNRIALWMCTFTLAVSVGAVLLLPFSIISNEVLLSVPHNYYIQWLNGSLVHGLWNLVFLFSNLSLVFLMPFAYLFTEAEGFAGSKKGVMSRVYETSVVLLLLTLLVFGIVWVASAIFDDDSAGRESLYDLWEYYLPYLYSGISLFGVLLLLLCTPFGLSRMFSVTGKLLVKPRLLENLDEHLSCTAFEEAAISRKISTKASCWLNLNMEALQKRLLAIQSHRITLEMRRRASPWQRNLVYPLAMLLLLA------LTGITVLIVCVNVLELLIDEAAMPKGIQGSQLGKVSFSVFGSFGAAVQVILIFYLMASSVVGFYSSPLFIWLLPQKQNTTMTKIIGNCVSLLILSSALPVFSRTLGITRFDLLGDFGRFNWLGNFYLILLYNMMFAG 443          
BLAST of Limb development membrane protein 1 vs. Ensembl Xenopus
Match: adora1 (adenosine A1 receptor [Source:Xenbase;Acc:XB-GENE-944026])

HSP 1 Score: 213.001 bits (541), Expect = 9.912e-62
Identity = 154/461 (33.41%), Postives = 241/461 (52.28%), Query Frame = 3
Query:  123 MHTDEIISSETETFHEILRSCVTXXXXXXXXXXXXXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGV-MILCVMS---------PLGCWDIIKTSSK-----SLRDLMSSHKSSDDLLEISVEKPASERRTN--DSEYHHFYKQEEPTVSSSNTLNEKQQTQV-NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            M  ++ +S   + FH+ +R C+   L+F TL ++S+I+I KFK     D   V   D    ++AL  CTF+ ++S+ A  LLP SIISNE+++  P +YY+QW+N SL+  LWN V L SN+++  LMPFA LF ++EGF G K  + +RV E          ++ G VW+    F D+     SL DLW YYLP +YS +SL GV ++LCV S         P G   +   + K      L + +  H S     E ++ +  S + +   +       K+     S   TL  +++     +N  +   +L +L       + G+  + V  N + ++I   A+PK     +LG+   S  G FGAAVQ++LI YL+ SSV   YS    +   P++  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  L+L YN+ F  
Sbjct:    1 MEVNQDVSVREQIFHDWVRECIICTLLFSTLYLLSYIVITKFKKHA--DFATVDVEDAAVNRIALWMCTFTLAVSVGAVLLLPFSIISNEVLLSVPHNYYIQWLNGSLVHGLWNLVFLFSNLSLVFLMPFAYLFTEAEGFAGSKKGVMSRVYETSVVLLLLTLLVFGIVWVASAIFDDDSAGRESLYDLWEYYLPYLYSGISLFGVLLLLCVPSNIPFCLLCTPFGLSRMFSVTGKLLVKPRLLENLDEHLSCTAFEEAAISRKISTKASCWLNLNMEALQKRLLAIQSHRITLEMRRRASPWQRNLVYPLAMLLLLA------LTGITVLIVCVNVLELLIDEAAMPKGIQGSQLGKVSFSVFGSFGAAVQVILIFYLMASSVVGFYSSPLFIWLLPQKQNTTMTKIIGNCVSLLILSSALPVFSRTLGITRFDLLGDFGRFNWLGNFYLILLYNMMFAG 453          
BLAST of Limb development membrane protein 1 vs. Ensembl Xenopus
Match: mctp1 (multiple C2 domains, transmembrane 1 [Source:Xenbase;Acc:XB-GENE-5812768])

HSP 1 Score: 210.305 bits (534), Expect = 7.892e-61
Identity = 142/429 (33.10%), Postives = 228/429 (53.15%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFY--KQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIA---IYGFQKIANIYVHKVVLVDSLREVWKCLDS-SP 1556
             D    +V+L  CTF+ ++S  A  LLP SIISNEI++ +PKSYY+QW+N SLI  LWN VSL SN+ +F+LMPFA  FL+SEGF GLK  I  R++E I        +I G VW+      ++     SL DLW  YLP +YS +SL+G ++L + +P+G   +     + L          + +  IS+++ A +R+ N   Y   Y  K+ E  + ++ ++  K + + N + +   L+   + I L I     + I V  N + +++   A+PK       G       G+ GA ++I+LI YL++SSV   YS+    ++TP++   D   + K+++  L+     P +S+ +G+T F+ LG FG  +WL +  +V+AYN+ F        +  F       + K + +D L+   K  DS SP
Sbjct:   51 EDATVNRVSLFLCTFTLAVSGGAVLLLPFSIISNEILLCFPKSYYIQWLNGSLIHGLWNLVSLFSNLCLFVLMPFAFFFLESEGFAGLKKGIKARILETIIMLILLALLIFGIVWVASALIDNSSASMESLYDLWDCYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDIDEQMYIISLQEEALQRKLNGGNYTADYSRKKIEHDLLNARSMKSKLERRKNASAWQRNLVYPAVMILLLIATFSSV-ILVSLNILRLLVDETAMPKGSKGSGFGDASLFTFGFAGATLEIILIFYLMVSSVVGFYSLRFFSSFTPRK---DDTTMTKSTLHPLI---PFPPKSKRVGITRFDLLGDFGRFNWLGNFYIVVAYNLMFAVMTTLCLVRKFTSAVREELLKAIGLDRLQLSNKSSDSPSP 472          
BLAST of Limb development membrane protein 1 vs. Ensembl Mouse
Match: Lmbr1l (limb region 1 like [Source:MGI Symbol;Acc:MGI:1289247])

HSP 1 Score: 225.713 bits (574), Expect = 1.185e-66
Identity = 153/458 (33.41%), Postives = 240/458 (52.40%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXX----XXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEI----SVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FH+ +R C+   L+F TL I+            +   +DD       D    ++AL  CTF+ +++L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+      ++     SL D W YYLP +YS +S +GV++L V +PLG   +   + K    L+   +  +DL E     + E+ A  RR           D E  H   ++   + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   S+LG FGA +Q+VLI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFKKPAEFTTVDD------EDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTLLVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGK----LLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLH---RQVLALQAQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAVHILELLIDEAAMPRGMQDAALGQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAG 445          
BLAST of Limb development membrane protein 1 vs. Ensembl Mouse
Match: Lmbr1 (limb region 1 [Source:MGI Symbol;Acc:MGI:1861746])

HSP 1 Score: 220.705 bits (561), Expect = 1.065e-64
Identity = 137/425 (32.24%), Postives = 230/425 (54.12%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN--DSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGFQKIAN---------IYVHKVVLVDSLRE 1529
             D    +++L   TF+ ++S  A  LLP SIISNEI++ +P +YY+QW+N SLI  LWN  SL SN+ +F+LMPFA  FL+SEGF GLK  I  R++E +        +ILG VW+       +     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I++E+ A +RR +   S   +   + E  + +   L  K + +   + +   L+   + + L ++   +  + V  N + +++   A+PK      +G    S  G+ GAA++I+LI YL++SSV   YS+    N+TPK+  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F     +   +K  +         + +HK+ L D+ R+
Sbjct:   52 EDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQELENVKILKTKLERRKKASAWERNLVYPAVMVLL-LIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRD 475          
BLAST of Limb development membrane protein 1 vs. Ensembl Mouse
Match: Lmbr1 (limb region 1 [Source:MGI Symbol;Acc:MGI:1861746])

HSP 1 Score: 173.326 bits (438), Expect = 2.178e-47
Identity = 122/427 (28.57%), Postives = 213/427 (49.88%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERR----TNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGFQKIAN---------IYVHKVVLVDSLRE 1529
             D    +++L   TF+ ++S  A  LLP SIISNEI++ +P +YY+QW+N SLI                            EGF GLK  I  R++E +        +ILG VW+       +     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I++E+ A +RR    ++  EY+    ++E  + +   L  K + +   + +   L+   + + L ++   +  + V  N + +++   A+PK      +G    S  G+ GAA++I+LI YL++SSV   YS+    N+TPK+  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F     +   +K  +         + +HK+ L D+ R+
Sbjct:   52 EDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIH---------------------------EGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQE--LENVKILKTKLERRKKASAWERNLVYPAVMVLL-LIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRD 448          
BLAST of Limb development membrane protein 1 vs. Ensembl Mouse
Match: Lmbr1 (limb region 1 [Source:MGI Symbol;Acc:MGI:1861746])

HSP 1 Score: 168.318 bits (425), Expect = 1.074e-45
Identity = 119/427 (27.87%), Postives = 212/427 (49.65%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERR----TNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGFQKIAN---------IYVHKVVLVDSLRE 1529
             D    +++L   TF+ ++S  A  LLP SIISNEI++ +P +YY+QW+N SLI                             G+ G+K  I  R++E +        +ILG VW+       +     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I++E+ A +RR    ++  EY+    ++E  + +   L  K + +   + +   L+   + + L ++   +  + V  N + +++   A+PK      +G    S  G+ GAA++I+LI YL++SSV   YS+    N+TPK+  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F     +   +K  +         + +HK+ L D+ R+
Sbjct:   52 EDAVVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLAFPHNYYIQWLNGSLIH----------------------------GYAGMKGGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQE--LENVKILKTKLERRKKASAWERNLVYPAVMVLL-LIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRD 447          
BLAST of Limb development membrane protein 1 vs. Ensembl Mouse
Match: Lmbr1 (limb region 1 [Source:MGI Symbol;Acc:MGI:1861746])

HSP 1 Score: 148.673 bits (374), Expect = 2.735e-39
Identity = 104/355 (29.30%), Postives = 184/355 (51.83%), Query Frame = 3
Query:  504 MPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERR----TNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGFQKIAN---------IYVHKVVLVDSLRE 1529
            MPFA  FL+SEGF GLK  I  R++E +        +ILG VW+       +     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I++E+ A +RR    ++  EY+    ++E  + +   L  K + +   + +   L+   + + L ++   +  + V  N + +++   A+PK      +G    S  G+ GAA++I+LI YL++SSV   YS+    N+TPK+  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F     +   +K  +         + +HK+ L D+ R+
Sbjct:    1 MPFAFFFLESEGFAGLKKGIRARILETLVMLLLLALLILGMVWVASALIDSDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPAILEDLDEQIYMITLEEEALQRRLHGLSSSVEYNVMELEQE--LENVKILKTKLERRKKASAWERNLVYPAVMVLL-LIETSISVLLVACNILCLLVDETAMPKGTRGPGIGSASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFAIMTTLCLIRKFTSAVREELFKALGLHKLHLSDTSRD 352          
BLAST of Limb development membrane protein 1 vs. UniProt/SwissProt
Match: sp|Q5RBY7|LMBRL_PONAB (Protein LMBR1L OS=Pongo abelii OX=9601 GN=LMBR1L PE=2 SV=1)

HSP 1 Score: 230.72 bits (587), Expect = 1.144e-67
Identity = 154/454 (33.92%), Postives = 235/454 (51.76%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXX----XXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FHE +R C+   L+F TL I+            +   +DD       D    ++AL  CTF+ +I+L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+      +N     SL D W YYLP +YS +S +GV++L V +PLG   +   + K L          + L   + E+ A  RR           D E  H   ++   + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   SRLG FGA +Q+ LI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDD------EDATVNKIALELCTFTLAIALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRRGVLGRVYETVVMLMLLTLLVLGMVWVASAILDNNKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAAPTRRICNPTSCWLPLDMELLH---RQVLALQTQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAIHILELLIDEAAMPRGMQDASLGQVSFSRLGSFGAVIQVALIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAG 445          
BLAST of Limb development membrane protein 1 vs. UniProt/SwissProt
Match: sp|Q4R7X9|LMBRL_MACFA (Protein LMBR1L OS=Macaca fascicularis OX=9541 GN=LMBR1L PE=2 SV=1)

HSP 1 Score: 230.335 bits (586), Expect = 1.627e-67
Identity = 155/454 (34.14%), Postives = 237/454 (52.20%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXX----XXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FHE +R C+   L+F TL I+            +   +DD      +D    ++AL  CTF+ +I+L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+      +N     SL D W YYLP +YS +S +GV++L V +PLG   +   + K L          + L   + E+ A  RR           D E  H   ++   + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   S+LG FGA VQ+VLI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDD------ADATVNKIALELCTFTLAIALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLMLLTLLVLGMVWVASAIVDNNKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLH---RQLLALQTQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAIHILELLIDEAAMPRGMQGASLGQVSFSKLGSFGAVVQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAG 445          
BLAST of Limb development membrane protein 1 vs. UniProt/SwissProt
Match: sp|Q6UX01|LMBRL_HUMAN (Protein LMBR1L OS=Homo sapiens OX=9606 GN=LMBR1L PE=1 SV=2)

HSP 1 Score: 228.794 bits (582), Expect = 6.339e-67
Identity = 154/454 (33.92%), Postives = 235/454 (51.76%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXX----XXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FHE +R C+   L+F TL I+            +   +DD       D    ++AL  CTF+ +I+L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+       N     SL D W YYLP +YS +S +GV++L V +PLG   +   + K L          + L   + E+ A  RR           D E  H   ++   + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   S+LG FGA +Q+VLI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDD------EDATVNKIALELCTFTLAIALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLMLLTLLVLGMVWVASAIVDKNKANRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLH---RQVLALQTQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGSFGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAG 445          
BLAST of Limb development membrane protein 1 vs. UniProt/SwissProt
Match: sp|Q5U4X7|LMBR1_XENTR (Limb region 1 protein homolog OS=Xenopus tropicalis OX=8364 GN=lmbr1 PE=2 SV=1)

HSP 1 Score: 228.409 bits (581), Expect = 6.589e-67
Identity = 146/429 (34.03%), Postives = 232/429 (54.08%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFY--KQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIA---IYGFQKIANIYVHKVVLVDSLREVWKCLDS-SP 1556
             D    +V+L  CTF+ ++S  A  LLP SIISNEI++ +PKSYY+QW+N SLI  LWN VSL SN+ +F+LMPFA  FL+SEGF GLK  I  R++E I        +I G VW+      ++     SL DLW  YLP +YS +SL+G ++L + +P+G   +     + L          + +  IS+++ A +R+ N   Y   Y  K+ E  + ++ ++  K + + N + +   L+   + I L I     + I V  N + +++   A+PK       G       G+ GA ++I+LI YL++SSV   YS+    ++TP++  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +V+AYN+ F        +  F       + K + +D L+   K  DS SP
Sbjct:   51 EDATVNRVSLFLCTFTLAVSGGAVLLLPFSIISNEILLCFPKSYYIQWLNGSLIHGLWNLVSLFSNLCLFVLMPFAFFFLESEGFAGLKKGIKARILETIIMLILLALLIFGIVWVASALIDNSSASMESLYDLWDCYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDIDEQMYIISLQEEALQRKLNGGNYTADYSRKKIEHDLLNARSMKSKLERRKNASAWQRNLVYPAVMILLLIATFSSV-ILVSLNILRLLVDETAMPKGSKGSGFGDASLFTFGFAGATLEIILIFYLMVSSVVGFYSLRFFSSFTPRKDDTTMTKVIGNCLSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVVAYNLMFAVMTTLCLVRKFTSAVREELLKAIGLDRLQLSNKSSDSPSP 478          
BLAST of Limb development membrane protein 1 vs. UniProt/SwissProt
Match: sp|Q9D1E5|LMBRL_MOUSE (Protein LMBR1L OS=Mus musculus OX=10090 GN=Lmbr1l PE=1 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 8.290e-66
Identity = 153/458 (33.41%), Postives = 240/458 (52.40%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXX----XXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEI----SVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FH+ +R C+   L+F TL I+            +   +DD       D    ++AL  CTF+ +++L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+      ++     SL D W YYLP +YS +S +GV++L V +PLG   +   + K    L+   +  +DL E     + E+ A  RR           D E  H   ++   + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   S+LG FGA +Q+VLI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFKKPAEFTTVDD------EDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTLLVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGK----LLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLH---RQVLALQAQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAVHILELLIDEAAMPRGMQDAALGQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAG 445          
BLAST of Limb development membrane protein 1 vs. TrEMBL
Match: A0A2Y9N982 (protein LMBR1L isoform X3 OS=Delphinapterus leucas OX=9749 GN=LMBR1L PE=3 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 7.718e-66
Identity = 155/458 (33.84%), Postives = 238/458 (51.97%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXX----XXXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEI----SVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FHE +R C+   L+F TL I             +   +DD       D    ++AL  CTF+ +++L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +    F   ++LG VW+      ++   + SL D W YYLP +YS +S +GV++L V +PLG   +   + K    L+   +  +DL E     + E+ A  RR           D E  H   +    + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   S+LG FGA VQ+VLI YL++SSV   YS        P+ H T +  ++ N +C L++ SA+P+ SR LGLT  + LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHEKVRECIISTLLFATLYILCHIALTRFKKPAEFTTVDD------EDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLARVYETVVMLMFLTLLVLGMVWVASAIVDNSKASTESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGK----LLVKPRLLEDLEEQLHCSAFEEAALTRRICNPTSCWLPLDMELLH---RRVLALQTQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAIHILELLIDEAAMPRGMQGASLGQVSFSKLGSFGAVVQVVLIFYLMVSSVVGFYSSPLFWGLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRLDLLGDFGRFNWLGNFYIVFLYNAAFAG 445          
BLAST of Limb development membrane protein 1 vs. TrEMBL
Match: A0A250Y1V0 (Limb region 1 protein OS=Castor canadensis OX=51338 GN=LMBR1 PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.094e-65
Identity = 135/389 (34.70%), Postives = 218/389 (56.04%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN--DSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFC 1448
             D    +++L   TF+ ++S  A  LLP SIISNEI++ +P++YY+QW+N SLI  LWN  SL SN+ +F+LMPFA  FL+SEGF GLK  I  RV+E +        +ILG VW+       +     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  IS+E+ A +RR N   S   +   + E  + +  TL  K + +   + +   L+   + + L ++   +  + V  N + +++   A+PK      +G    S  G+ GAA++I+LI YL++SSV   YS+    N+TPK+  T +  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F 
Sbjct:   52 EDAIVNRISLFLSTFTLAVSAGAVLLLPFSIISNEILLSFPQNYYIQWLNGSLIHGLWNLASLFSNLCLFVLMPFAFFFLESEGFAGLKKGIRARVLETVVMLLLLASLILGIVWVASALIDKDAASMESLYDLWEFYLPYLYSCISLMGCLLLLLCTPVGLSRMFTVMGQLLVKPTILEDLDEHIYIISLEEEALQRRLNGLSSSLEYSIMELEQELENVKTLKAKLERRKKASAWERNLVYPAVMVLL-LIETSISVLLVACNILCLLVDETAMPKGTRGPGIGHASLSTFGFVGAALEIILIFYLMVSSVVGFYSLRFFGNFTPKKDDTTMTKIIGNCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFA 439          
BLAST of Limb development membrane protein 1 vs. TrEMBL
Match: A0A5K1UXT6 (Uncharacterized protein OS=Macaca mulatta OX=9544 GN=LMBR1L PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.149e-65
Identity = 156/454 (34.36%), Postives = 237/454 (52.20%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXX----XXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FHE +R C+   L+F TL I+            +   +DD      +D    ++AL  CTF+ +I+L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+      +N     SL D W YYLP +YS +S +GV++L V +PLG   +   + K L          + L   + E+ A  RR           D E  H   ++   + +   L EK+Q      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   S+LG FGA VQ+VLI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDD------ADATVNKIALELCTFTLAIALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLMLLTLLVLGMVWVASAIVDNNKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLH---RQLLALQTQRVLLEKRQKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAIHILELLIDEAAMPRGMQGASLGQVSFSKLGSFGAVVQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAG 445          
BLAST of Limb development membrane protein 1 vs. TrEMBL
Match: A0A2Y9KMX4 (protein LMBR1L isoform X2 OS=Enhydra lutris kenyoni OX=391180 GN=LOC111157868 PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.194e-65
Identity = 155/450 (34.44%), Postives = 239/450 (53.11%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXXXXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FHE +R C+   L+F TL I+ HI +  F   +    F     D    ++AL  CTF+ +++L A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+      +N     SL D W YYLP +YS +S +GV++L V +PLG   +   + K L          + L   + E+ A  RR           D E  H   ++   + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   S+LG FGA +Q++LI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN GF  
Sbjct:    7 EVLSVREQLFHERVRECIISTLLFATLYILCHIALTHF---KKPAEFTTDDEDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLMLLTLLVLGMVWVASAIVDNNKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLHLDMELLH---RQVLALQTQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAIHILELLIDEAAMPRGMQDASLGQVSFSKLGSFGAVIQVILIFYLMVSSVVGFYSSPFFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAGFAG 444          
BLAST of Limb development membrane protein 1 vs. TrEMBL
Match: G1S839 (Limb development membrane protein 1 like OS=Nomascus leucogenys OX=61853 GN=LMBR1L PE=3 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 1.349e-65
Identity = 155/454 (34.14%), Postives = 236/454 (51.98%), Query Frame = 3
Query:  135 EIISSETETFHEILRSCVTXXXXXXXXXXX----XXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTN---------DSEYHHFYKQEEPTVSSSNTLNEKQQTQV--NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            E++S   + FHE +R C+   L+F TL I+            +   +DD       D    ++AL  CTF+ ++SL A  LLP SIISNE+++  P++YY+QW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G +  +  RV E +        ++LG VW+      DN     SL D W YYLP +YS +S +GV++L V +PLG   +   + K L          + L   + E+ A  RR           D E  H   ++   + +   L EK++      +N   L   L+ML +   +++ GL  + V  + + ++I   A+P+      LG+   S+LG FGA +Q+VLI YL++SSV   YS     +  P+ H T +  ++ N +C L++ SA+P+ SR LGLT F+ LG FG  +WL +  +V  YN  F  
Sbjct:    7 EVLSVREQLFHERIRECIISTLLFATLYILCHIFLTRFKKPAEFTTVDD------EDATVNKIALELCTFTLAVSLGAVLLLPFSIISNEVLLSLPRNYYIQWLNGSLIHGLWNLVFLFSNLSLIFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLMLLTLLVLGMVWVASAIVDDNKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLH---RQVLALQTQRVLLEKRRKASAWQRN---LGYPLAMLCL---LVLTGLSVLIVAIHILELLIDEAAMPRGMQGASLGQVSFSKLGSFGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAG 445          
BLAST of Limb development membrane protein 1 vs. Ensembl Cavefish
Match: lmbr1 (limb development membrane protein 1 [Source:NCBI gene;Acc:103023703])

HSP 1 Score: 211.46 bits (537), Expect = 2.057e-61
Identity = 134/406 (33.00%), Postives = 220/406 (54.19%), Query Frame = 3
Query:  258 QIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEY--------HHFYKQEEPTVSSSNTLNEKQQTQV-NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFC 1448
            + DD       D    ++++  CTF+ ++S  A  LLP SIISNEI++ +PK+YY+QW+N SLI  LWN VSL SN+ +F+LMPFA  FL+SEGF G K  I  RV+E          +ILG VW+      ++     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I +++ A + + N + +         H YK+ +   S  + L  K++     KN   LY I+ ++ +    + + L+ + ++Y    +++   ALPK      +G    S  G   A V+I+L+ YL++SSV   YS+      TP++  T + +++   +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F 
Sbjct:   44 KTDDH---EDEDAIVNRISMYLCTFTLAVSGGAVLLLPFSIISNEILLSFPKNYYIQWLNGSLIHGLWNLVSLFSNLCLFVLMPFAYFFLESEGFAGSKKGIKARVLETFVMLFLLGLLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGGLLLLMCTPVGLSRMFTVMGQLLVKPTILEDLDEQMYCIQLQEEALQHKLNGASFNSHLQPNSQHLYKELDNVRSQRHKLERKKKASAWEKN--LLYPIVMLILLAGTAISVFLVALNILY----LLVDETALPKGSADPDIGNASLSTFGVVQAVVEIILMIYLMVSSVVGFYSLRIFQGLTPRQDDTTMTSIIGCCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLFA 440          
BLAST of Limb development membrane protein 1 vs. Ensembl Cavefish
Match: lmbr1l (limb development membrane protein 1 like [Source:NCBI gene;Acc:103041135])

HSP 1 Score: 196.438 bits (498), Expect = 7.436e-56
Identity = 127/389 (32.65%), Postives = 205/389 (52.70%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQ---QTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGF 1445
             D    ++ L  CTF+ S+++ A  LLP+SI+SNE+++ +P+SYYMQW+N SLI  LWN V L SN+++  LMPFA  F ++EGF G K  + +RV E          ++LG VW+      DN     SL DLW YYLP +YS +SL GV++L + +P G   +   +   L          + +     E+ +  R+ N +         E       ++  K+   +T+   + +   L   ++ + L  L +  + + V ++ + ++    A+P+  +   LG    S  G  GAAVQ+VLI YL++SSV   YS     +  P+   T +  ++ N +C L++ SA+P+ SR LG+T F+ LG FG  +WL +  +V  YN+ F
Sbjct:   53 EDATVNKIVLWLCTFTLSVAVCAVLLLPISILSNEVLLTFPQSYYMQWLNGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTEAEGFTGSKRGVMSRVYETAVMLLLLSLLVLGIVWVASALLHDN-TARESLYDLWEYYLPYLYSCISLFGVLLLLLCTPFGMSRMFSVTGSLLVKPRLLENVEETMNCAVFEEASLSRKLNSNTSCWLNLNMEAMKRQFVSIQAKRMALETRRKASAWQRNLGYPLVMLLLLALTVVCVLM-VCFHVLELLFDESAMPRGMEDPHLGLASFSVFGSLGAAVQVVLILYLMVSSVVGFYSSPLFSSMLPRTQDTTLTQIIGNCVCLLVLSSALPVFSRTLGITRFDLLGDFGRYNWLGNFHIVFLYNMLF 439          
BLAST of Limb development membrane protein 1 vs. Ensembl Cavefish
Match: lmbr1 (limb development membrane protein 1 [Source:NCBI gene;Acc:103023703])

HSP 1 Score: 188.348 bits (477), Expect = 5.480e-53
Identity = 127/384 (33.07%), Postives = 205/384 (53.39%), Query Frame = 3
Query:  324 CTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDS-------EYHHFYKQEEPTVSSSNTLNEKQQTQV-NKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQI--VLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGF 1445
            CTF+ ++S  A  LLP SIISNEI++ +PK+YY+QW+N SLI  LWN VSL SN+ +F+LMPFA  FL+SEGF G K  I  RV+E          +ILG VW+      ++     SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I +++ A + + N            H YK+ +   S  + L  K++     KN   LY I+ ++ +    + + L+ + ++Y    +++   ALPK                  G+AV+    +  YL++SSV   YS+      TP++  T + +++   +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F
Sbjct:   63 CTFTLAVSGGAVLLLPFSIISNEILLSFPKNYYIQWLNGSLIHGLWNLVSLFSNLCLFVLMPFAYFFLESEGFAGSKKGIKARVLETFVMLFLLGLLILGIVWVASALIDNDAASMESLYDLWEFYLPYLYSCISLMGGLLLLMCTPVGLSRMFTVMGQLLVKPTILEDLDEQMYCIQLQEEALQHKLNGECVCCVTPNSQHLYKELDNVRSQRHKLERKKKASAWEKN--LLYPIVMLILLAGTAISVFLVALNILY----LLVDETALPK------------------GSAVRKSETVNDYLMVSSVVGFYSLRIFQGLTPRQDDTTMTSIIGCCVSILVLSSALPVMSRTLGITRFDLLGDFGRFNWLGNFYIVLSYNLLF 422          
BLAST of Limb development membrane protein 1 vs. Ensembl Cavefish
Match: lmbr1l (limb development membrane protein 1 like [Source:NCBI gene;Acc:103041135])

HSP 1 Score: 171.4 bits (433), Expect = 5.554e-47
Identity = 122/402 (30.35%), Postives = 201/402 (50.00%), Query Frame = 3
Query:  264 DDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQ---QTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKA-----RDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGF 1445
            +  F   K    + +  L  CTF+ S+++ A  LLP+SI+SNE+++ +P+SYYMQW+N SLI  LWN V L SN+++  LMPFA  F ++EGF G K  + +RV E          ++LG VW+      DN     SL DLW YYLP +YS +SL GV++L + +P G   +   +   L          + +     E+ +  R+ N +         E       ++  K+   +T+   + +   L   ++ + L  L +  + + V ++ + ++    A+P+      R+   LGR  S+   W           YL++SSV   YS     +  P+   T +  ++ N +C L++ SA+P+ SR LG+T F+ LG FG  +WL +  +V  YN+ F
Sbjct:   13 NAEFVTGKHKTASGESELWLCTFTLSVAVCAVLLLPISILSNEVLLTFPQSYYMQWLNGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTEAEGFTGSKRGVMSRVYETAVMLLLLSLLVLGIVWVASALLHDN-TARESLYDLWEYYLPYLYSCISLFGVLLLLLCTPFGMSRMFSVTGSLLVKPRLLENVEETMNCAVFEEASLSRKLNSNTSCWLNLNMEAMKRQFVSIQAKRMALETRRKASAWQRNLGYPLVMLLLLALTVVCVLM-VCFHVLELLFDESAMPRGMEVRFRENNLLGRVLST---W-----------YLMVSSVVGFYSSPLFSSMLPRTQDTTLTQIIGNCVCLLVLSSALPVFSRTLGITRFDLLGDFGRYNWLGNFHIVFLYNMLF 398          
BLAST of Limb development membrane protein 1 vs. Ensembl Sea Lamprey
Match: lmbr1l (limb development membrane protein 1-like [Source:NCBI gene;Acc:321314])

HSP 1 Score: 199.904 bits (507), Expect = 1.046e-57
Identity = 137/445 (30.79%), Postives = 222/445 (49.89%), Query Frame = 3
Query:  276 FVSKSDHCAY--QVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMIL---------CVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSML-----TIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFG--AAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGFQKIANIYVHKVVLVDSLREVWKCLDSSP 1556
            F+S  D  A   +++L  CTF+ ++SL A  LLP SI+SNEI++ +P+SYYMQW+N SLI  LWN + L SN+++  LMPFA  F +SEGF G +  I  R+ E +        ++ G VW+      D+     SL D W +YLP +YS +SL GV++L         C+ S  G   +     + L + +   +  +D ++  +    S  R     Y+H  K        ++ +   +   V+  C  L L L  L     +  +++LI+ +  + ++++   +  G Q  P A++         +R+  FG  A VQ++   YL+LSSV   YS+   +  TPK   T +  ++ N +  L++ SA+P+ SR LG+T F+ LG +G  +WL +  +VL YN+ F     +    K       +  L  +L     CLD  P
Sbjct:   48 FISDDDEDAMVNRISLWLCTFTLAMSLGAVLLLPFSIVSNEILLSFPQSYYMQWLNGSLIHGLWNLIFLFSNLSLVFLMPFAYFFTESEGFAGSRKGIAARLYETLVVLFLLSLLVAGMVWVASALIDDDAASKESLYDFWEFYLPYLYSCISLFGVLLLLLCTPLGLSCMFSVTGQLLVKPRLLEDLDEQIDCQRFEEDTIKRRLNGVFSAPR-----YNHHNKSRSGAGDQASGVRLPRGRAVSPRCVGLPLSLFFLFSLRCSKGVSVLIVSIHILELLFDETAMPKGAQRDPGAKN---------ARVCSFGCQATVQLMKEIYLMLSSVLGFYSLPTFMPLTPKSQDTPMTKIIGNCVSLLILSSALPVLSRTLGITNFDLLGDYGRFNWLGNFYIVLLYNLLFAGLTTLCLVTKFTAAVRQE--LFKALGNGSLCLDRLP 476          
BLAST of Limb development membrane protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001525.1 (pep scaffold:Pmarinus_7.0:GL476736:255142:335593:-1 gene:ENSPMAG00000001372.1 transcript:ENSPMAT00000001525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.548 bits (423), Expect = 1.824e-46
Identity = 130/403 (32.26%), Postives = 215/403 (53.35%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINT---SLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSL---RDLMSSHKSSDDLLEIS-VEKPASERRTNDSE--YHHF----YKQEEPTVSSSNTLNEKQ--QTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
             D    ++AL  CTF+ ++SLAA  LLP SI+SNE+++  P +YYMQW+N     +   LWN V L SN+++ +LMPFA  F++SEGF G +  +  RV EA       + ++LG VW+       +   + SLR LW +YLP +YS +SL GV++L V +PLG   +   + + L   R L    ++ D+ +E S +E+   +RR       + H      ++    VS   +  E++   +   +N  F  ++L +L +    +++    + V      ++I   A+PK   ++  G+   S  G  GA +++ LI YL++SSV   YS+       P+     +  ++ N +  L++ SA+P+ SR LGLT F+ LG FG  +WL +  +VL+YN+ F  
Sbjct:    3 EDAVVNRIALWMCTFTLAVSLAAALLLPFSIVSNEVLLSLPHNYYMQWLNALSAVVCPGLWNLVFLCSNLSLVLLMPFAYFFIESEGFTGSRKGVMGRVYEAAVVLCLLVLLVLGMVWVASSIMGKDPASTKSLRGLWDFYLPYLYSCISLFGVLLLLVCTPLGLSRMFGVTGQLLVKPRLL----ENLDEQIECSRLEEAVLKRRLKGRSACWQHLSVEALRERIFWVSKERSSMERRVGASVWQRNLCFPLVMLLLLLLTGVSVVLVCFHVLV------LLIDDAAMPKGSQEVGFGKASLSAFGPLGATLEVALIFYLMVSSVVGFYSLPHFCTLLPRNRSMPMTKIIGNCVSLLVLSSALPVLSRTLGLTNFDLLGNFGRFNWLGNFHIVLSYNLLFAG 395          
BLAST of Limb development membrane protein 1 vs. Ensembl Nematostella
Match: EDO49006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHN0])

HSP 1 Score: 187.578 bits (475), Expect = 2.311e-53
Identity = 126/404 (31.19%), Postives = 201/404 (49.75%), Query Frame = 3
Query:  264 DDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRD---LWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKT------SSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSE-YHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGF 1445
             D       D   Y+++   CTF+ S+SL A  LLP+SI+SNEI++ YP SYY++W+N SLI  +WN + L S I++F+ MPFA    +SEGF G +  I  RV E          +I   VW+V        + + SL D    W   LP +YS +SL+G ++L + +P+G   +           + LRDL       D++  I +E+ + +R+ N  +   HF   E           + + + + +NC                       IY I   + +++ +  L         G+  SS +G FGA ++IVLI YL+L+S+  +YSV   V   P    T +  ++ N +  L++ SA+P+ SR LG+T F+ +G FG LDWL +  +++ YN+ F
Sbjct:   48 KDEISSDDEDATVYRISRWLCTFTLSVSLGAVLLLPMSILSNEILVMYPNSYYIKWLNGSLIHGMWNQIFLGSYISLFVSMPFAYFITESEGFAGSRKGIMARVYETSVVLCLLAVLISSIVWVVSALLDKKWSTNPSLADPAGAWIPGLPFIYSCISLLGGLMLLICTPVGFARMFTVLGQYVVKPQFLRDL------DDEIQAIQMEEESLKRKLNGKQSITHFSIIER----------QSKASALQRNC-----------------------IYPISLLILLLLTVLVL---------GKVSSSMMGTFGALLEIVLIFYLMLASLVGLYSVPWFVRLRPVPKDTPMTKVIANCIVLLILSSALPVLSRTLGITNFDLMGEFGRLDWLGNIRVIIIYNVWF 403          
BLAST of Limb development membrane protein 1 vs. Ensembl Medaka
Match: lmbr1l (limb development membrane protein 1 like [Source:NCBI gene;Acc:101172494])

HSP 1 Score: 217.624 bits (553), Expect = 1.049e-63
Identity = 140/396 (35.35%), Postives = 211/396 (53.28%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRT----NDSEYHHF----YKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
             D    ++AL  CTF+ S+++ A  LLP+SI+SNE+++ +P SYYMQW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G K  +  RV EA+        ++LG VW+      DN     SL DLW YYLP +YS +SL GV++L + +P G   +   +  SL       +  +D L  S+ +  S RR     N S +        +QE  TV +     E ++          Y ++ M  + L ++ +    + V +N + +++   ALP+  +   LG    S  G  GAAVQ+VLI YL+LSSV   YS        P+   T++  ++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +V  YN+ F  
Sbjct:   53 EDATVNKIALWLCTFTLSVAVCAVLLLPISILSNEVLLTFPHSYYMQWLNGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSKKGVMARVYEAVVLLLLLALLVLGIVWVASALLHDNIA-RKSLYDLWEYYLPYLYSGISLFGVLMLLLCTPFGLSRMFSVTG-SLLVKPRLLEDIEDTLSCSMFEENSLRRKLNCGNKSCWSKLNMEALRQEYQTVRTKRVALEMRRKASPWQRNLGYPLVMMALLALTVMCV----LMVCFNVLELLLDETALPRGMEDPHLGMASFSMFGSLGAAVQVVLILYLMLSSVVGFYSSSLFSGLLPRAKDTNLTQIIANCVSLLILSSALPVFSRTLGITRFDLLGDFGRYNWLGNFYVVFLYNMMFAG 442          
BLAST of Limb development membrane protein 1 vs. Ensembl Medaka
Match: lmbr1 (limb development membrane protein 1 [Source:NCBI gene;Acc:101174959])

HSP 1 Score: 210.305 bits (534), Expect = 5.260e-61
Identity = 133/399 (33.33%), Postives = 218/399 (54.64%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNIS-SSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFY---------KQEEPTVSSSNTLNEKQQTQV-NKNCYFLYLILSMLT-IWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFC 1448
             D    +++L  CTF+ ++S  A  LLP SIISNEI++ +P++YY+QW+N SLI  LWN VSL SN+ +F+LMPFA  FL+SEGF G K  I  RV+E          +ILG VW+    F DN   S  SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I +++ A +RR N +  H +          K+ +   +  N L  +++     KN  +  ++L +L    ++++++ L  +Y++ +         A+PK      +G    S  G   A ++I+L+ YL++SSV   YS+      TP++  T +  ++   +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F 
Sbjct:   51 EDAVVNRISLYLCTFTLAVSGGAVFLLPFSIISNEILLSFPRNYYIQWLNGSLIHGLWNLVSLFSNLCLFVLMPFAYFFLESEGFAGSKKGIRARVLETFVMLFLLALLILGIVWVAS-AFIDNDAASMESLYDLWEFYLPYLYSCISLMGGLLLLMCTPVGLSRMFAVMGQLLVKPTILEDLDEQIYCIHLQEEALQRRLNGASSHSYVRGSFAHQLNKELDIIRNQRNKLERRKKASGWEKNLLYPMVMLILLAGTTISVIMVALNILYLLVDET-------AMPKGSTDRGIGNASLSTFGVAQAVLEIILMFYLMVSSVVGFYSLRVFEGLTPRKDDTTMTTIIGCCVSILVLSSALPVMSRTLGMTRFDLLGDFGRFNWLGNFYIVLSYNLLFA 441          
BLAST of Limb development membrane protein 1 vs. Ensembl Medaka
Match: lmbr1 (limb development membrane protein 1 [Source:NCBI gene;Acc:101174959])

HSP 1 Score: 190.274 bits (482), Expect = 1.055e-53
Identity = 127/389 (32.65%), Postives = 206/389 (52.96%), Query Frame = 3
Query:  288 SDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNIS-SSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQQTQV-NKNCYFLYLILSMLT-IWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGF 1445
             D    +++L  CTF+ ++S  A  LLP SIISNEI++ +P++YY+QW+N SLI  LWN VSL SN+ +F+LMPFA  FL+SEGF G K  I  RV+E          +ILG VW+    F DN   S  SL DLW +YLP +YS +SL+G ++L + +P+G   +     + L          + +  I +++ A +RR N                 +  L  +++     KN  +  ++L +L    ++++++ L  +Y++ +         A+PK     +      S +G        +L  YL++SSV   YS+      TP++  T +  ++   +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +VL+YN+ F
Sbjct:   52 EDAVVNRISLYLCTFTLAVSGGAVFLLPFSIISNEILLSFPRNYYIQWLNGSLIHGLWNLVSLFSNLCLFVLMPFAYFFLESEGFAGSKKGIRARVLETFVMLFLLALLILGIVWVAS-AFIDNDAASMESLYDLWEFYLPYLYSCISLMGGLLLLMCTPVGLSRMFAVMGQLLVKPTILEDLDEQIYCIHLQEEALQRRLNGMSVGEVLAHSRQGQGLTALLERRKKASGWEKNLLYPMVMLILLAGTTISVIMVALNILYLLVDET-------AMPKGSTCFR------SLIG--------LLNSYLMVSSVVGFYSLRVFEGLTPRKDDTTMTTIIGCCVSILVLSSALPVMSRTLGMTRFDLLGDFGRFNWLGNFYIVLSYNLLF 418          
BLAST of Limb development membrane protein 1 vs. Ensembl Medaka
Match: lmbr1l (limb development membrane protein 1 like [Source:NCBI gene;Acc:101172494])

HSP 1 Score: 183.726 bits (465), Expect = 2.952e-51
Identity = 127/377 (33.69%), Postives = 193/377 (51.19%), Query Frame = 3
Query:  324 CTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQQT-QVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCA 1451
            CTF+ S+++ A  LLP+SI+SNE+++ +P SYYMQW+N SLI  LWN V L SN+++  LMPFA  F +SEGF G K  +  RV EA+        ++LG VW+      DN     SL DLW YYLP +YS +SL GV++L + +P G   +   +  SL       +  +D L  S+ +  S RR  +   +HF  +      SS  +  K    Q N     + + L  LT+        +  + V +N + +++   ALP+  +   LG    S  G  GAAVQ++++                        HL  I +++ N +  L++ SA+P+ SR LG+T F+ LG FG  +WL +  +V  YN+ F  
Sbjct:   77 CTFTLSVAVCAVLLLPISILSNEVLLTFPHSYYMQWLNGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSKKGVMARVYEAVVLLLLLALLVLGIVWVASALLHDNIA-RKSLYDLWEYYLPYLYSGISLFGVLMLLLCTPFGLSRMFSVTG-SLLVKPRLLEDIEDTLSCSMFEENSLRRKLNC--NHFPIRSLILFVSSIEMRRKASPWQRNLGYPLVMMALLALTV--------MCVLMVCFNVLELLLDETALPRGMEDPHLGMASFSMFGSLGAAVQVMVL----------------------TNHL-KIISIIANCVSLLILSSALPVFSRTLGITRFDLLGDFGRYNWLGNFYVVFLYNMMFAG 418          
BLAST of Limb development membrane protein 1 vs. Planmine SMEST
Match: SMESG000062080.1 (SMESG000062080.1)

HSP 1 Score: 934.095 bits (2413), Expect = 0.000e+0
Identity = 481/483 (99.59%), Postives = 481/483 (99.59%), Query Frame = 3
Query:  123 MHTDEIISSETETFHEILRSCVTXXXXXXXXXXXXXXXXXXXXXXQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGFQKIANIYVHKVVLVDSLREVWKCLDSSPKVIQI 1571
            MHTDEIISSETETFHEILRSCVTIFLIFITLLIISHIIIYKFKIKQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSL GVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYF YLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGFQKIANIYVHKVVLVDSLREVWKCLDSSPKVIQI
Sbjct:    1 MHTDEIISSETETFHEILRSCVTIFLIFITLLIISHIIIYKFKIKQIDDRFFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYYMQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNRVMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSSVSLFGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPASERRTNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFFYLILSMLTIWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFGAAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLICSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGFQKIANIYVHKVVLVDSLREVWKCLDSSPKVIQI 483          
The following BLAST results are available for this feature:
BLAST of Limb development membrane protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMBR1L1.320e-6733.92limb development membrane protein 1 like [Source:H... [more]
LMBR13.206e-6634.19limb development membrane protein 1 [Source:HGNC S... [more]
LMBR12.441e-6032.40limb development membrane protein 1 [Source:HGNC S... [more]
LMBR1L1.881e-5832.16limb development membrane protein 1 like [Source:H... [more]
LMBR11.898e-2227.71limb development membrane protein 1 [Source:HGNC S... [more]
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R05D3.22.027e-2127.51LIMR family protein R05D3.2 [Source:UniProtKB/Swi... [more]
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lili4.685e-5629.64gene:FBgn0027539 transcript:FBtr0331697[more]
lili6.543e-5629.64gene:FBgn0027539 transcript:FBtr0084739[more]
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmbr13.667e-6233.09limb development membrane protein 1 [Source:ZFIN;A... [more]
lmbr1l2.657e-5734.42limb development membrane protein 1-like [Source:N... [more]
lmbr11.470e-5130.83limb development membrane protein 1 [Source:ZFIN;A... [more]
lmbr11.807e-4831.06limb development membrane protein 1 [Source:ZFIN;A... [more]
lmbr11.765e-4730.35limb development membrane protein 1 [Source:ZFIN;A... [more]
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mctp11.244e-6734.03multiple C2 domains, transmembrane 1 [Source:Xenba... [more]
mctp11.244e-6734.03multiple C2 domains, transmembrane 1 [Source:Xenba... [more]
adora19.065e-6333.48adenosine A1 receptor [Source:Xenbase;Acc:XB-GENE-... [more]
adora19.912e-6233.41adenosine A1 receptor [Source:Xenbase;Acc:XB-GENE-... [more]
mctp17.892e-6133.10multiple C2 domains, transmembrane 1 [Source:Xenba... [more]
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmbr1l1.185e-6633.41limb region 1 like [Source:MGI Symbol;Acc:MGI:1289... [more]
Lmbr11.065e-6432.24limb region 1 [Source:MGI Symbol;Acc:MGI:1861746][more]
Lmbr12.178e-4728.57limb region 1 [Source:MGI Symbol;Acc:MGI:1861746][more]
Lmbr11.074e-4527.87limb region 1 [Source:MGI Symbol;Acc:MGI:1861746][more]
Lmbr12.735e-3929.30limb region 1 [Source:MGI Symbol;Acc:MGI:1861746][more]
back to top
BLAST of Limb development membrane protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RBY7|LMBRL_PONAB1.144e-6733.92Protein LMBR1L OS=Pongo abelii OX=9601 GN=LMBR1L P... [more]
sp|Q4R7X9|LMBRL_MACFA1.627e-6734.14Protein LMBR1L OS=Macaca fascicularis OX=9541 GN=L... [more]
sp|Q6UX01|LMBRL_HUMAN6.339e-6733.92Protein LMBR1L OS=Homo sapiens OX=9606 GN=LMBR1L P... [more]
sp|Q5U4X7|LMBR1_XENTR6.589e-6734.03Limb region 1 protein homolog OS=Xenopus tropicali... [more]
sp|Q9D1E5|LMBRL_MOUSE8.290e-6633.41Protein LMBR1L OS=Mus musculus OX=10090 GN=Lmbr1l ... [more]
back to top
BLAST of Limb development membrane protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2Y9N9827.718e-6633.84protein LMBR1L isoform X3 OS=Delphinapterus leucas... [more]
A0A250Y1V01.094e-6534.70Limb region 1 protein OS=Castor canadensis OX=5133... [more]
A0A5K1UXT61.149e-6534.36Uncharacterized protein OS=Macaca mulatta OX=9544 ... [more]
A0A2Y9KMX41.194e-6534.44protein LMBR1L isoform X2 OS=Enhydra lutris kenyon... [more]
G1S8391.349e-6534.14Limb development membrane protein 1 like OS=Nomasc... [more]
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lmbr12.057e-6133.00limb development membrane protein 1 [Source:NCBI g... [more]
lmbr1l7.436e-5632.65limb development membrane protein 1 like [Source:N... [more]
lmbr15.480e-5333.07limb development membrane protein 1 [Source:NCBI g... [more]
lmbr1l5.554e-4730.35limb development membrane protein 1 like [Source:N... [more]
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lmbr1l1.046e-5730.79limb development membrane protein 1-like [Source:N... [more]
ENSPMAT00000001525.11.824e-4632.26pep scaffold:Pmarinus_7.0:GL476736:255142:335593:-... [more]
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO490062.311e-5331.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Limb development membrane protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
lmbr1l1.049e-6335.35limb development membrane protein 1 like [Source:N... [more]
lmbr15.260e-6133.33limb development membrane protein 1 [Source:NCBI g... [more]
lmbr11.055e-5332.65limb development membrane protein 1 [Source:NCBI g... [more]
lmbr1l2.952e-5133.69limb development membrane protein 1 like [Source:N... [more]
back to top
BLAST of Limb development membrane protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000062080.10.000e+099.59SMESG000062080.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026206 ID=SMED30026206|Name=Limb development membrane protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1719bp
TTTTTGTCGGTTTTTCGTTTATGTTTTTATTTTTACTTTAATTTGAAAGT
ATTCTTATTTTCCTATATTCTATTTTTGACTAGCTCTATTCTATAATTTA
GTTTATTATAATTTAGATATTTATGCATACTGATGAAATTATTTCATCAG
AAACTGAAACATTCCATGAAATACTCAGAAGCTGCGTCACAATATTTTTG
ATATTTATTACTTTATTGATAATATCTCATATTATAATATATAAATTTAA
AATTAAACAGATAGATGATCGCTTTTTTGTCAGTAAAAGCGATCACTGTG
CATATCAAGTGGCATTATTAACTTGCACATTTTCGTTTTCAATATCACTT
GCAGCAACTACATTGCTCCCATTATCGATTATCAGCAACGAAATCATGAT
ATATTATCCAAAATCATACTATATGCAATGGATTAATACTTCTTTAATTC
AAAATTTATGGAATACTGTTTCACTCAGCTCAAATATAACAATTTTTATA
TTAATGCCGTTTGCCACACTGTTTTTGGATTCCGAAGGCTTTTATGGGCT
CAAAAATAATATACATAACCGTGTCATGGAAGCAATTTGTTTCTTTTCAT
TTACATTATTTATGATTTTGGGAGCTGTTTGGATTGTATGTATTCCATTT
CGAGACAACCACAATATTTCTTCATCGCTTCGAGATTTATGGCATTATTA
TCTGCCGTTAGTGTATTCTAGCGTTTCTCTTATTGGAGTTATGATTCTCT
GTGTCATGTCACCTTTAGGGTGTTGGGATATCATAAAAACATCTTCTAAA
AGTTTGAGAGATTTAATGAGTAGTCACAAATCATCTGATGACCTACTAGA
AATTTCAGTGGAAAAGCCAGCATCGGAACGTCGAACGAACGATAGTGAAT
ATCATCATTTTTATAAACAAGAAGAACCAACTGTATCATCTTCAAACACA
TTAAATGAAAAACAACAAACGCAGGTTAACAAAAATTGTTATTTTTTGTA
TTTGATTTTATCGATGTTAACGATTTGGCTGGCAATTCTAATTATCGGGC
TGTTGACTATCTATGTCATATATAATGCGGTTGGTATTGTAATTGGACTT
CAAGCTTTACCGAAAGCACGAGATAAACTTAAGCTTGGTCGACACCCGTC
TTCAAGGCTAGGCTGGTTTGGAGCGGCTGTTCAGATCGTATTGATTCAGT
ATTTACTATTAAGTAGTGTCTGGGCGATTTATAGTGTCTTTCCTATGGTG
AATTATACTCCAAAACGCCATTTGACAGATATTCAAGCGTTACTGAAAAA
TTCCATGTGCACTTTGCTTATCTGTTCCGCTATTCCTATTCAGAGTCGAC
TGCTCGGTTTAACGACATTCAATCCGCTAGGAACTTTCGGACATCTCGAT
TGGTTGGATTCCGGCCTTCTCGTATTAGCATACAATATCGGTTTCTGTGC
TTTCATCGCAATTTACGGTTTTCAGAAAATCGCCAATATCTACGTTCACA
AAGTTGTTCTTGTCGATTCGTTGCGAGAGGTTTGGAAATGTCTGGATTCG
TCTCCAAAGGTCATACAGATCCTATCGAATAATCTCTTATCAAAAAATGA
GTTGAAAACAGCATAAACAGAAAGTTACTGAGAAAAGCTAATTTCTTGTT
TCTCAAAGATCCATATTAATTTTGTTAAATCTCGTAATTTGTATTTTATT
TTCATATGGGGTTCCTCTC
back to top

protein sequence of SMED30026206-orf-1

>SMED30026206-orf-1 ID=SMED30026206-orf-1|Name=SMED30026206-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=498bp
MHTDEIISSETETFHEILRSCVTIFLIFITLLIISHIIIYKFKIKQIDDR
FFVSKSDHCAYQVALLTCTFSFSISLAATTLLPLSIISNEIMIYYPKSYY
MQWINTSLIQNLWNTVSLSSNITIFILMPFATLFLDSEGFYGLKNNIHNR
VMEAICFFSFTLFMILGAVWIVCIPFRDNHNISSSLRDLWHYYLPLVYSS
VSLIGVMILCVMSPLGCWDIIKTSSKSLRDLMSSHKSSDDLLEISVEKPA
SERRTNDSEYHHFYKQEEPTVSSSNTLNEKQQTQVNKNCYFLYLILSMLT
IWLAILIIGLLTIYVIYNAVGIVIGLQALPKARDKLKLGRHPSSRLGWFG
AAVQIVLIQYLLLSSVWAIYSVFPMVNYTPKRHLTDIQALLKNSMCTLLI
CSAIPIQSRLLGLTTFNPLGTFGHLDWLDSGLLVLAYNIGFCAFIAIYGF
QKIANIYVHKVVLVDSLREVWKCLDSSPKVIQILSNNLLSKNELKTA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000204ovary
PLANA:0000208testis
Vocabulary: INTERPRO
TermDefinition
IPR008075LIMR
IPR006876LMBR1-like_membr_prot
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008075Lipocalin-interacting membrane receptorPRINTSPR01692LIPOCALINIMRcoord: 427..450
score: 29.17
coord: 70..92
score: 48.91
coord: 192..213
score: 46.02
coord: 385..406
score: 31.25
coord: 112..134
score: 55.98
coord: 355..375
score: 43.45
IPR008075Lipocalin-interacting membrane receptorPANTHERPTHR12625LIPOCALIN-1 INTERACTING MEMBRANE RECEPTOR LIMRcoord: 4..454
IPR006876LMBR1-like membrane proteinPFAMPF04791LMBR1coord: 226..451
e-value: 1.7E-18
score: 66.9
coord: 21..265
e-value: 2.8E-34
score: 118.9
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 196..218
NoneNo IPR availableTMHMMTMhelixcoord: 292..326
NoneNo IPR availableTMHMMTMhelixcoord: 154..176
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
NoneNo IPR availableTMHMMTMhelixcoord: 431..450
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 346..368