Sarcoma antigen NY-SAR-91

Overview
NameSarcoma antigen NY-SAR-91
Smed IDSMED30026205
Length (bp)444
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sarcoma antigen NY-SAR-91 (SMED30026205) t-SNE clustered cells

Violin plots show distribution of expression levels for Sarcoma antigen NY-SAR-91 (SMED30026205) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sarcoma antigen NY-SAR-91 (SMED30026205) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sarcoma antigen NY-SAR-91 (SMED30026205) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026205

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026205h1SMcG0009040 SmedASXL_001474SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Human
Match: MEAF6 (MYST/Esa1 associated factor 6 [Source:HGNC Symbol;Acc:HGNC:25674])

HSP 1 Score: 79.337 bits (194), Expect = 1.366e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Human
Match: MEAF6 (MYST/Esa1 associated factor 6 [Source:HGNC Symbol;Acc:HGNC:25674])

HSP 1 Score: 78.9518 bits (193), Expect = 1.705e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Human
Match: MEAF6 (MYST/Esa1 associated factor 6 [Source:HGNC Symbol;Acc:HGNC:25674])

HSP 1 Score: 78.9518 bits (193), Expect = 1.744e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Human
Match: MEAF6 (MYST/Esa1 associated factor 6 [Source:HGNC Symbol;Acc:HGNC:25674])

HSP 1 Score: 78.9518 bits (193), Expect = 2.017e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Human
Match: MEAF6 (MYST/Esa1 associated factor 6 [Source:HGNC Symbol;Acc:HGNC:25674])

HSP 1 Score: 70.0922 bits (170), Expect = 3.159e-15
Identity = 35/69 (50.72%), Postives = 44/69 (63.77%), Query Frame = 2
Query:   92 SLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   10 TLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 78          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Celegans
Match: B0025.4 (pep chromosome:WBcel235:I:6027194:6028370:1 gene:WBGene00015001.1 transcript:B0025.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0025.4)

HSP 1 Score: 63.5438 bits (153), Expect = 2.505e-13
Identity = 38/115 (33.04%), Postives = 59/115 (51.30%), Query Frame = 2
Query:   35 NEADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGY-------RKFKESDRLFSMSSATFKKSVEDSVEESAKIESQPQKDHKF 358
            +E   +L    +K+  +V SL+ LE QIYN EG+YLE+T++YGN+IKGW       +    P+  G        R  ++ +RLFS SS T     + +   +   ES    D+ +
Sbjct:    8 SELKSELEGWIRKKNDIVESLEALEMQIYNFEGSYLEDTAEYGNVIKGWGN----FANAPPPSKSGRIDKKFSKRSVRDEERLFSKSSTTSPYGTKSTTNGTGSGESTSGGDNGY 118          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Fly
Match: Eaf6 (gene:FBgn0035624 transcript:FBtr0077126)

HSP 1 Score: 67.781 bits (164), Expect = 2.546e-14
Identity = 39/80 (48.75%), Postives = 48/80 (60.00%), Query Frame = 2
Query:   53 LMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHG---YRKFKESDRLFSMSSAT 283
            L DL KK+      L NLE QIY  EG+YLE+T   GNII+GW++    L+     NS      RKFKE++RLFS SS T
Sbjct:   38 LADLIKKKAETSEQLANLERQIYAFEGSYLEDTQLCGNIIRGWER---YLTSNKATNSKADKRNRKFKEAERLFSKSSIT 114          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Zebrafish
Match: meaf6 (MYST/Esa1-associated factor 6 [Source:NCBI gene;Acc:445300])

HSP 1 Score: 74.7146 bits (182), Expect = 5.082e-17
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         +      RKFKE++RLFS SS T   +V
Sbjct:   17 RELSELVKRKQELAETLVNLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKTDRRNRKFKEAERLFSKSSVTSVAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Zebrafish
Match: meaf6 (MYST/Esa1-associated factor 6 [Source:NCBI gene;Acc:445300])

HSP 1 Score: 74.7146 bits (182), Expect = 6.188e-17
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         +      RKFKE++RLFS SS T   +V
Sbjct:   17 RELSELVKRKQELAETLVNLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKTDRRNRKFKEAERLFSKSSVTSVAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Xenopus
Match: pwp2 (PWP2, small subunit processome component [Source:Xenbase;Acc:XB-GENE-6257709])

HSP 1 Score: 78.9518 bits (193), Expect = 4.445e-18
Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 2
Query:   29 EFNEADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            +  +  ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   60 QIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 149          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Xenopus
Match: pwp2 (PWP2, small subunit processome component [Source:Xenbase;Acc:XB-GENE-6257709])

HSP 1 Score: 78.5666 bits (192), Expect = 6.587e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   66 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 149          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Mouse
Match: Meaf6 (MYST/Esa1-associated factor 6 [Source:MGI Symbol;Acc:MGI:1917338])

HSP 1 Score: 79.337 bits (194), Expect = 7.374e-19
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Mouse
Match: Meaf6 (MYST/Esa1-associated factor 6 [Source:MGI Symbol;Acc:MGI:1917338])

HSP 1 Score: 79.337 bits (194), Expect = 1.010e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Mouse
Match: Meaf6 (MYST/Esa1-associated factor 6 [Source:MGI Symbol;Acc:MGI:1917338])

HSP 1 Score: 78.9518 bits (193), Expect = 1.075e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Mouse
Match: Meaf6 (MYST/Esa1-associated factor 6 [Source:MGI Symbol;Acc:MGI:1917338])

HSP 1 Score: 71.633 bits (174), Expect = 4.499e-16
Identity = 36/72 (50.00%), Postives = 45/72 (62.50%), Query Frame = 2
Query:   83 LVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:    1 LAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 72          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Mouse
Match: Meaf6 (MYST/Esa1-associated factor 6 [Source:MGI Symbol;Acc:MGI:1917338])

HSP 1 Score: 51.6026 bits (122), Expect = 1.210e-8
Identity = 26/54 (48.15%), Postives = 33/54 (61.11%), Query Frame = 2
Query:  137 YLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:    3 YLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 56          
BLAST of Sarcoma antigen NY-SAR-91 vs. UniProt/SwissProt
Match: sp|Q5ZIX3|EAF6_CHICK (Chromatin modification-related protein MEAF6 OS=Gallus gallus OX=9031 GN=MEAF6 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 5.049e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   19 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 102          
BLAST of Sarcoma antigen NY-SAR-91 vs. UniProt/SwissProt
Match: sp|Q9HAF1|EAF6_HUMAN (Chromatin modification-related protein MEAF6 OS=Homo sapiens OX=9606 GN=MEAF6 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.559e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. UniProt/SwissProt
Match: sp|Q52KD8|EAF6_XENLA (Chromatin modification-related protein MEAF6 OS=Xenopus laevis OX=8355 GN=meaf6 PE=2 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 6.573e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. UniProt/SwissProt
Match: sp|Q2VPQ9|EAF6_MOUSE (Chromatin modification-related protein MEAF6 OS=Mus musculus OX=10090 GN=Meaf6 PE=1 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 7.065e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. UniProt/SwissProt
Match: sp|Q58CU0|EAF6_BOVIN (Chromatin modification-related protein MEAF6 OS=Bos taurus OX=9913 GN=MEAF6 PE=2 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 7.530e-18
Identity = 39/84 (46.43%), Postives = 54/84 (64.29%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         + N    RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLANLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKNDRRNRKFKEAERLFSKSSVTSAAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. TrEMBL
Match: A0A564YDJ4 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5374 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.312e-20
Identity = 47/89 (52.81%), Postives = 62/89 (69.66%), Query Frame = 2
Query:   41 ADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNV-----RLSYKTTPNSHG---YRKFKESDRLFSMSSAT 283
            A +KL++L ++R+ LV +L NLE Q+Y  EGNYLEET+ YGNIIKGWD++ V      LS  T  N HG    R+++ESDR+FS SS T
Sbjct:    9 AREKLVELIRQRQFLVDNLSNLERQLYQFEGNYLEETAPYGNIIKGWDRSLVTATGSALSAVTAANGHGEKRPRRYRESDRIFSHSSVT 97          
BLAST of Sarcoma antigen NY-SAR-91 vs. TrEMBL
Match: A0A0R3T0N1 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS387 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.629e-20
Identity = 47/89 (52.81%), Postives = 60/89 (67.42%), Query Frame = 2
Query:   41 ADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNV-----RLSYKTTPNSHG---YRKFKESDRLFSMSSAT 283
            A +KL++L ++R  LV +L NLE Q+Y  EGNYLEET+ YGNIIKGWD+N V      LS  T  N HG    R+++E DR+FS SS T
Sbjct:    9 AREKLVELIRQRRFLVENLSNLERQLYQFEGNYLEETAPYGNIIKGWDRNLVTATGSALSAVTAANGHGEKRPRRYRECDRIFSHSSVT 97          
BLAST of Sarcoma antigen NY-SAR-91 vs. TrEMBL
Match: T1G819 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20217216 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.189e-18
Identity = 40/85 (47.06%), Postives = 56/85 (65.88%), Query Frame = 2
Query:   29 EFNEADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSAT 283
            ++ +  Q+L +L K+R  +  +L NLE QIY  EG+YLE+T QYGNII+GWD+  + +    +      RKFKE+DRLFS SS T
Sbjct:   11 QYTDTRQELAELVKRRAEIAETLANLERQIYAFEGSYLEDTQQYGNIIRGWDRYLINIKNTNSKGDKRNRKFKEADRLFSKSSVT 95          
BLAST of Sarcoma antigen NY-SAR-91 vs. TrEMBL
Match: A0A0R3S8V6 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS618 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 4.639e-18
Identity = 45/89 (50.56%), Postives = 61/89 (68.54%), Query Frame = 2
Query:   41 ADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNV-----RLSYKTTPNSHG---YRKFKESDRLFSMSSAT 283
            A +KL++L ++R+  + +L NLE Q+Y  EGNYLEET+ YGNIIKGWD++ V      LS  T  N HG    R+++ESDR+FS SS T
Sbjct:    9 AREKLVELIRQRQ-FLDNLSNLERQLYQFEGNYLEETAPYGNIIKGWDRSLVTATGSALSAVTAANGHGEKRPRRYRESDRIFSHSSVT 96          
BLAST of Sarcoma antigen NY-SAR-91 vs. TrEMBL
Match: U4UFH9 (Uncharacterized protein OS=Dendroctonus ponderosae OX=77166 GN=D910_09107 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 1.160e-17
Identity = 56/137 (40.88%), Postives = 85/137 (62.04%), Query Frame = 2
Query:   38 EADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHG---YRKFKESDRLFSMSSATFKKSVEDSVEESAKIESQPQKDHKFLPHHKFEKNASKR*KL*INRFLVFQKK 439
            +A Q+L DL K++  +  +L NLE QIY  EG+YLE+T  YGNII+GWD+    LS   T NS      RKFKE++RLFS SS T   +V   V+     ++Q +K+ + L   K+E N+ K+ ++ + +F++ QK+
Sbjct:    9 DARQELADLVKRKAEIGETLANLERQIYAFEGSYLEDTQLYGNIIRGWDR---YLSSNKTTNSKADKRNRKFKEAERLFSKSSITSMAAVSGIVD-----QTQDKKEEQEL-LKKYETNSDKKIEV-LQKFMIEQKQ 135          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Cavefish
Match: meaf6 (MYST/Esa1-associated factor 6 [Source:NCBI gene;Acc:445300])

HSP 1 Score: 74.7146 bits (182), Expect = 1.054e-16
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         +      RKFKE++RLFS SS T   +V
Sbjct:   63 RELSELVKRKQELAETLVNLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKTDRRNRKFKEAERLFSKSSVTSVAAV 146          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Cavefish
Match: meaf6 (MYST/Esa1-associated factor 6 [Source:NCBI gene;Acc:445300])

HSP 1 Score: 74.3294 bits (181), Expect = 1.317e-16
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         +      RKFKE++RLFS SS T   +V
Sbjct:   63 RELSELVKRKQELAETLVNLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKTDRRNRKFKEAERLFSKSSVTSVAAV 146          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Sea Lamprey
Match: meaf6 (MYST/Esa1-associated factor 6 [Source:NCBI gene;Acc:445300])

HSP 1 Score: 77.7962 bits (190), Expect = 4.480e-19
Identity = 40/95 (42.11%), Postives = 58/95 (61.05%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV-----EDSVEE 316
             +L +L K+++ +  +LKNLE QIY  EG+YLE+T  YGNI++GWD+        + P     R+FKE++RLFS SS T   +V     +D  EE
Sbjct:   17 HELSELVKRQQEIAETLKNLERQIYAFEGSYLEDTQVYGNIVRGWDRYLSNQRGGSGPVERKSRRFKEAERLFSKSSVTSSAAVGVVVNQDGAEE 111          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Nematostella
Match: EDO38341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD87])

HSP 1 Score: 73.1738 bits (178), Expect = 4.554e-18
Identity = 41/79 (51.90%), Postives = 51/79 (64.56%), Query Frame = 2
Query:   53 LMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPN--SHGYRKFKESDRLFSMSSAT 283
            L +L KKR  +  SL NLE QIY  EG+YLE+T  YGNII+GWD+    L+ K T        RKFK+++RLFS SS T
Sbjct:    6 LAELIKKRAEIADSLANLERQIYAFEGSYLEDTQLYGNIIRGWDR---LLTNKNTNTKVERRNRKFKDAERLFSKSSIT 81          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Medaka
Match: meaf6 (MYST/Esa1 associated factor 6 [Source:NCBI gene;Acc:101165572])

HSP 1 Score: 75.0998 bits (183), Expect = 2.925e-17
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         +      RKFKE++RLFS SS T   +V
Sbjct:   17 RELAELVKRKQELAETLVNLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKTDRRNRKFKEAERLFSKSSVTSVAAV 100          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Medaka
Match: meaf6 (MYST/Esa1 associated factor 6 [Source:NCBI gene;Acc:101165572])

HSP 1 Score: 75.485 bits (184), Expect = 6.513e-17
Identity = 38/90 (42.22%), Postives = 55/90 (61.11%), Query Frame = 2
Query:   29 EFNEADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            +  +  ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         +      RKFKE++RLFS SS T   +V
Sbjct:   72 QIPDTRRELAELVKRKQELAETLVNLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKTDRRNRKFKEAERLFSKSSVTSVAAV 161          
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Medaka
Match: meaf6 (MYST/Esa1 associated factor 6 [Source:NCBI gene;Acc:101165572])

HSP 1 Score: 75.0998 bits (183), Expect = 7.898e-17
Identity = 38/84 (45.24%), Postives = 53/84 (63.10%), Query Frame = 2
Query:   47 QKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSV 298
            ++L +L K+++ L  +L NLE QIY  EG+YLE+T  YGNII+GWD+         +      RKFKE++RLFS SS T   +V
Sbjct:   78 RELAELVKRKQELAETLVNLERQIYAFEGSYLEDTQMYGNIIRGWDRYLTNQKNSNSKTDRRNRKFKEAERLFSKSSVTSVAAV 161          
BLAST of Sarcoma antigen NY-SAR-91 vs. Planmine SMEST
Match: SMESG000072742.1 (SMESG000072742.1)

HSP 1 Score: 253.062 bits (645), Expect = 3.740e-88
Identity = 123/124 (99.19%), Postives = 123/124 (99.19%), Query Frame = 2
Query:   26 MEFNEADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSVEDSVEESAKIESQPQKDHKFLPHHKFEKNASKR 397
            MEFNEADQKLMDLFKKRE LVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSVEDSVEESAKIESQPQKDHKFLPHHKFEKNASKR
Sbjct:    1 MEFNEADQKLMDLFKKRENLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSVEDSVEESAKIESQPQKDHKFLPHHKFEKNASKR 124          
BLAST of Sarcoma antigen NY-SAR-91 vs. Planmine SMEST
Match: SMESG000028683.1 (SMESG000028683.1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.524e-19
Identity = 45/82 (54.88%), Postives = 57/82 (69.51%), Query Frame = 2
Query:   50 KLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIKGWDK---NNVRLSYKTTPNSH-GYRKFKESDRLFSMSSAT 283
            +L+DL K+R+ L  SL +LE QIY  EG+YLEET+ YGNIIKGWDK    +  ++ +   NS    RKF+ESDRLFS SS T
Sbjct:   16 ELLDLVKQRKLLTDSLNSLEKQIYLFEGSYLEETAPYGNIIKGWDKYLITSGGMNSQNCLNSRMSGRKFRESDRLFSKSSVT 97          
The following BLAST results are available for this feature:
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MEAF61.366e-1846.43MYST/Esa1 associated factor 6 [Source:HGNC Symbol;... [more]
MEAF61.705e-1846.43MYST/Esa1 associated factor 6 [Source:HGNC Symbol;... [more]
MEAF61.744e-1846.43MYST/Esa1 associated factor 6 [Source:HGNC Symbol;... [more]
MEAF62.017e-1846.43MYST/Esa1 associated factor 6 [Source:HGNC Symbol;... [more]
MEAF63.159e-1550.72MYST/Esa1 associated factor 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
B0025.42.505e-1333.04pep chromosome:WBcel235:I:6027194:6028370:1 gene:W... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Eaf62.546e-1448.75gene:FBgn0035624 transcript:FBtr0077126[more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
meaf65.082e-1745.24MYST/Esa1-associated factor 6 [Source:NCBI gene;Ac... [more]
meaf66.188e-1745.24MYST/Esa1-associated factor 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pwp24.445e-1843.33PWP2, small subunit processome component [Source:... [more]
pwp26.587e-1846.43PWP2, small subunit processome component [Source:... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Meaf67.374e-1946.43MYST/Esa1-associated factor 6 [Source:MGI Symbol;A... [more]
Meaf61.010e-1846.43MYST/Esa1-associated factor 6 [Source:MGI Symbol;A... [more]
Meaf61.075e-1846.43MYST/Esa1-associated factor 6 [Source:MGI Symbol;A... [more]
Meaf64.499e-1650.00MYST/Esa1-associated factor 6 [Source:MGI Symbol;A... [more]
Meaf61.210e-848.15MYST/Esa1-associated factor 6 [Source:MGI Symbol;A... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5ZIX3|EAF6_CHICK5.049e-1846.43Chromatin modification-related protein MEAF6 OS=Ga... [more]
sp|Q9HAF1|EAF6_HUMAN6.559e-1846.43Chromatin modification-related protein MEAF6 OS=Ho... [more]
sp|Q52KD8|EAF6_XENLA6.573e-1846.43Chromatin modification-related protein MEAF6 OS=Xe... [more]
sp|Q2VPQ9|EAF6_MOUSE7.065e-1846.43Chromatin modification-related protein MEAF6 OS=Mu... [more]
sp|Q58CU0|EAF6_BOVIN7.530e-1846.43Chromatin modification-related protein MEAF6 OS=Bo... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YDJ41.312e-2052.81Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3T0N11.629e-2052.81Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
T1G8191.189e-1847.06Uncharacterized protein OS=Helobdella robusta OX=6... [more]
A0A0R3S8V64.639e-1850.56Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
U4UFH91.160e-1740.88Uncharacterized protein OS=Dendroctonus ponderosae... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
meaf61.054e-1645.24MYST/Esa1-associated factor 6 [Source:NCBI gene;Ac... [more]
meaf61.317e-1645.24MYST/Esa1-associated factor 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
meaf64.480e-1942.11MYST/Esa1-associated factor 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383414.554e-1851.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
meaf62.925e-1745.24MYST/Esa1 associated factor 6 [Source:NCBI gene;Ac... [more]
meaf66.513e-1742.22MYST/Esa1 associated factor 6 [Source:NCBI gene;Ac... [more]
meaf67.898e-1745.24MYST/Esa1 associated factor 6 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Sarcoma antigen NY-SAR-91 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072742.13.740e-8899.19SMESG000072742.1[more]
SMESG000028683.11.524e-1954.88SMESG000028683.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026205 ID=SMED30026205|Name=Sarcoma antigen NY-SAR-91|organism=Schmidtea mediterranea sexual|type=transcript|length=444bp
ATCATATTCAAAAATTTAATATAAAATGGAATTTAATGAAGCTGATCAGA
AGCTCATGGATTTATTTAAAAAGCGAGAAACTCTTGTCTCATCACTAAAA
AATTTAGAAAACCAAATTTACAATTTAGAAGGAAATTATTTAGAAGAGAC
ATCACAATATGGTAATATTATTAAAGGCTGGGATAAAAACAATGTGAGAT
TGTCGTATAAAACTACTCCAAACAGTCATGGTTACCGGAAATTCAAGGAA
TCAGACAGGCTATTTTCCATGTCTTCAGCAACTTTCAAGAAATCAGTCGA
AGATAGCGTTGAGGAATCCGCCAAAATAGAAAGCCAACCACAGAAAGATC
ACAAATTTCTGCCCCATCATAAATTTGAGAAAAATGCGTCTAAAAGATGA
AAATTATAAATAAATCGGTTTTTAGTTTTTCAAAAAAAAAGATC
back to top

protein sequence of SMED30026205-orf-1

>SMED30026205-orf-1 ID=SMED30026205-orf-1|Name=SMED30026205-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=125bp
MEFNEADQKLMDLFKKRETLVSSLKNLENQIYNLEGNYLEETSQYGNIIK
GWDKNNVRLSYKTTPNSHGYRKFKESDRLFSMSSATFKKSVEDSVEESAK
IESQPQKDHKFLPHHKFEKNASKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR015418Eaf6
Vocabulary: cellular component
TermDefinition
GO:0000123histone acetyltransferase complex
GO:0000775chromosome, centromeric region
GO:0000776kinetochore
GO:0000777condensed chromosome kinetochore
GO:0005634nucleus
GO:0005694chromosome
GO:0005730nucleolus
GO:0035267NuA4 histone acetyltransferase complex
GO:0070776MOZ/MORF histone acetyltransferase complex
Vocabulary: biological process
TermDefinition
GO:0016573histone acetylation
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0016569covalent chromatin modification
GO:0043968histone H2A acetylation
GO:0043981histone H4-K5 acetylation
GO:0043982histone H4-K8 acetylation
GO:0043983histone H4-K12 acetylation
GO:0044154histone H3-K14 acetylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 10..44
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..124
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 97..115
IPR015418Chromatin modification-related protein Eaf6PFAMPF09340NuA4coord: 9..87
e-value: 1.6E-23
score: 82.4
IPR015418Chromatin modification-related protein Eaf6PANTHERPTHR13476UNCHARACTERIZEDcoord: 5..109