SMED30026186

Overview
NameSMED30026186
Smed IDSMED30026186
Length (bp)1257
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30026186 (SMED30026186) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30026186 (SMED30026186) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026186

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026186 SmedASXL_012871SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026186 SmedASXL_012871SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30026186 SmedASXL_060644SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30026186 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.005522:50944..52250 -6073
Homology
BLAST of SMED30026186 vs. Ensembl Human
Match: GIN1 (gypsy retrotransposon integrase 1 [Source:HGNC Symbol;Acc:HGNC:25959])

HSP 1 Score: 58.151 bits (139), Expect = 3.914e-9
Identity = 39/154 (25.32%), Postives = 72/154 (46.75%), Query Frame = -2
Query:  195 RIVLPKKFHFKEFQRLCHP-------GVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQ--KNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKK-YILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFI 626
            R+V+  +   K+  R CH        G++ T+ L+ S Y W  +   ++ W   C  CQ  KN +    K +L  L     ++++ +D++GP  + N    Y + + D  T W   +P+ ++S+   ++   N +   Y  P+ II D   +FI
Sbjct:   61 RLVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNTVIVAPKQHL--LKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAIINIFFL-YGPPQKIIMDQRDEFI 211          
BLAST of SMED30026186 vs. Ensembl Human
Match: GIN1 (gypsy retrotransposon integrase 1 [Source:HGNC Symbol;Acc:HGNC:25959])

HSP 1 Score: 57.7658 bits (138), Expect = 2.416e-8
Identity = 39/154 (25.32%), Postives = 72/154 (46.75%), Query Frame = -2
Query:  195 RIVLPKKFHFKEFQRLCHP-------GVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQ--KNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKK-YILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFI 626
            R+V+  +   K+  R CH        G++ T+ L+ S Y W  +   ++ W   C  CQ  KN +    K +L  L     ++++ +D++GP  + N    Y + + D  T W   +P+ ++S+   ++   N +   Y  P+ II D   +FI
Sbjct:   61 RLVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNTVIVAPKQHL--LKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAIINIFFL-YGPPQKIIMDQRDEFI 211          
BLAST of SMED30026186 vs. Ensembl Human
Match: NYNRIN (NYN domain and retroviral integrase containing [Source:HGNC Symbol;Acc:HGNC:20165])

HSP 1 Score: 54.299 bits (129), Expect = 3.498e-7
Identity = 31/114 (27.19%), Postives = 54/114 (47.37%), Query Frame = -2
Query:  198 WPRMKAQIRNWCKTCHMC-QKNKITRHTKSNLKELPER--GKFNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQF 527
            WP M+  ++++C++C  C  +N I    K      P R    ++ + I++VGP+  S    K++L + D +T W EA P+   +     +       AR+ VP  +    G QF
Sbjct: 1572 WPGMQEHVKDYCRSCLFCIPRNLIGSELKVIESPWPLRSTAPWSNLQIEVVGPVTISEEGHKHVLIVADPNTRWVEAFPLKPYTHTAVAQVLLQHVFARWGVPVRLEAAQGPQF 1685          
BLAST of SMED30026186 vs. Ensembl Zebrafish
Match: FO704673.1 (pep chromosome:GRCz11:12:14545475:14551077:-1 gene:ENSDARG00000112601.1 transcript:ENSDART00000188717.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:FO704673.1)

HSP 1 Score: 103.99 bits (258), Expect = 2.268e-23
Identity = 56/167 (33.53%), Postives = 95/167 (56.89%), Query Frame = -2
Query:   87 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKE---LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIAR-YRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTL 575
            HPG++ T+ L+ + + WP+M   I  + K+C +C ++K  R   S L +   +P R  ++ + ID V  LP+ NN   IL IIDR +     IP+  + + + T     + + R Y +PE I++D G QF S  +K  C++ +I+   T+ YHP+ NG+VER ++ +
Sbjct:  994 HPGISRTLNLVRNAFWWPKMNQDITTFVKSCAVCAQSKTPRELPSGLLQPLPIPHR-PWSHLSIDFVTDLPNSNNYTTILVIIDRFSKACRLIPLKGLPTAMETALELFQHVFRVYGIPEDIVSDRGPQFTSKVWKAFCKQLDINVSLTSGYHPESNGQVERLNQEI 1159          
BLAST of SMED30026186 vs. Ensembl Zebrafish
Match: CU929458.1 (pep chromosome:GRCz11:11:43363075:43368382:1 gene:ENSDARG00000114395.1 transcript:ENSDART00000179934.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU929458.1)

HSP 1 Score: 103.219 bits (256), Expect = 4.050e-23
Identity = 52/165 (31.52%), Postives = 91/165 (55.15%), Query Frame = -2
Query:   93 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKE---LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGL-TTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHR 575
            HPG+ AT++L+ +++ WP +   + N+ + C +CQ  K +  T + L +   +P+R  ++ I +D +  LP   N   ILT++DR +     IP+ ++ S   T     N     + +P+ I++D G QF S  +  LC+  NI+   T+ YHPQ NG+ ER ++
Sbjct: 1006 HPGITATLELVKARFWWPSLTKDVINYVQKCEICQSTKASHQTPAGLLQPLPVPQR-PWSHIAVDFITDLPVSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQ 1169          
BLAST of SMED30026186 vs. Ensembl Zebrafish
Match: BX571665.1 (pep chromosome:GRCz11:17:35431724:35437222:1 gene:ENSDARG00000111789.1 transcript:ENSDART00000190293.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571665.1)

HSP 1 Score: 103.219 bits (256), Expect = 4.555e-23
Identity = 52/165 (31.52%), Postives = 91/165 (55.15%), Query Frame = -2
Query:   93 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKE---LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGL-TTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHR 575
            HPG+ AT++L+ +++ WP +   + N+ + C +CQ  K +  T + L +   +P+R  ++ I +D +  LP   N   ILT++DR +     IP+ ++ S   T     N     + +P+ I++D G QF S  +  LC+  NI+   T+ YHPQ NG+ ER ++
Sbjct:  999 HPGITATLELVKARFWWPSLTKDVINYVQKCKICQSTKASHQTPAGLLQPLPVPQR-PWSHIAVDFITDLPVSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQ 1162          
BLAST of SMED30026186 vs. Ensembl Zebrafish
Match: CR533578.3 (pep chromosome:GRCz11:16:23466094:23471387:-1 gene:ENSDARG00000115891.1 transcript:ENSDART00000180899.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR533578.3)

HSP 1 Score: 103.219 bits (256), Expect = 4.818e-23
Identity = 52/165 (31.52%), Postives = 91/165 (55.15%), Query Frame = -2
Query:   93 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKE---LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGL-TTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHR 575
            HPG+ AT++L+ +++ WP +   + N+ + C +CQ  K +  T + L +   +P+R  ++ I +D +  LP   N   ILT++DR +     IP+ ++ S   T     N     + +P+ I++D G QF S  +  LC+  NI+   T+ YHPQ NG+ ER ++
Sbjct: 1006 HPGITATLELVKARFWWPSLTKDVINYVQKCKICQSTKASHQTPAGLLQPLPVPQR-PWSHIAVDFITDLPVSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTERMNQ 1169          
BLAST of SMED30026186 vs. Ensembl Zebrafish
Match: CR354395.2 (pep chromosome:GRCz11:12:13553730:13556536:-1 gene:ENSDARG00000101547.2 transcript:ENSDART00000166396.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354395.2)

HSP 1 Score: 102.834 bits (255), Expect = 5.707e-23
Identity = 51/165 (30.91%), Postives = 90/165 (54.55%), Query Frame = -2
Query:   93 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKE---LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGL-TTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHR 575
            HPG+ AT++L+ +++ WP +   + N+ + C +CQ  K +  T + L +   +P+R  ++ I +D +  LP   N   ILT++DR +     IP+ ++ S   T     N     + +P+ I++D G QF S  +  LC+  NI+   T+ YHPQ NG+ E  ++
Sbjct:  664 HPGITATLELVKARFWWPSLTKDVINYVQKCKICQSTKASHQTPAGLLQPLPVPQR-PWSHIAVDFITDLPVSQNNTVILTVVDRFSKACRLIPLPKLPSAFETAEALCNHVFRMFGLPDDIVSDRGSQFTSRVWSALCKNLNINVSLTSGYHPQSNGQTEHMNQ 827          
BLAST of SMED30026186 vs. Ensembl Xenopus
Match: nmbr (neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-6074611])

HSP 1 Score: 113.62 bits (283), Expect = 9.697e-28
Identity = 62/169 (36.69%), Postives = 94/169 (55.62%), Query Frame = -2
Query:   75 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPE-RGKFNVIHIDIVGPL-PSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 575
            H GV  T + I  ++ WP +  ++  +C +C  CQ +    H +S L  LP     F  I +D+VGP+  S    ++IL I+D  T +PEAIP+   SS    R   + + +R  +P+ I+TD G  F+S   KELC+   +    T+ YHPQ +G VERF++TLKS +
Sbjct:  157 HLGVEKTKERILQRFFWPGLHGEVEQYCSSCPDCQYSAPRPHFRSPLVPLPVIETPFERIAMDLVGPIVKSARGHQHILVIMDYATRYPEAIPLRNTSSKSIARELVHVF-SRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKSML 324          
BLAST of SMED30026186 vs. Ensembl Xenopus
Match: mybl2 (MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-GENE-982419])

HSP 1 Score: 113.62 bits (283), Expect = 1.200e-27
Identity = 62/169 (36.69%), Postives = 94/169 (55.62%), Query Frame = -2
Query:   75 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPE-RGKFNVIHIDIVGPL-PSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 575
            H GV  T + I  ++ WP +  ++  +C +C  CQ +    H +S L  LP     F  I +D+VGP+  S    ++IL I+D  T +PEAIP+   SS    R   + + +R  +P+ I+TD G  F+S   KELC+   +    T+ YHPQ +G VERF++TLKS +
Sbjct:   90 HLGVEKTKERILQRFFWPGLHGEVEQYCSSCPDCQYSAPRPHFRSPLVPLPVIETPFERIAMDLVGPIVKSARGHQHILVIMDYATRYPEAIPLRNTSSKSIARELVHVF-SRVGIPKEILTDQGTPFMSRVMKELCRLFKVVQLRTSVYHPQTDGLVERFNKTLKSML 257          
BLAST of SMED30026186 vs. Ensembl Xenopus
Match: ENSXETT00000023851.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV461115.1:7997:9051:-1 gene:ENSXETG00000015824.1 transcript:ENSXETT00000023851.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 3.038e-25
Identity = 60/194 (30.93%), Postives = 101/194 (52.06%), Query Frame = -2
Query:   75 RIVLPKKFHFK------EFQRLCHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQK-NKITRHTKSNLKELPERGK-FNVIHIDIVGPL--PSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 626
            ++++P KF  +      E     H G++ T   +   + WP +  Q+  +C++C  CQ+  K     K  L+ LP  G+ F  + +D++GPL  PS   K+YILT++D  T +PEA+ +  I +         +  +R   P  I++D G QF+S   + L Q+  +    ++ YHPQ NG  ERF+ TLK+ +
Sbjct:   75 QLLVPAKFRTQLLHLAHEVPLAGHQGISRTRYRLLQNFYWPGLSQQVAQFCRSCDSCQRVGKSGERNKHTLRPLPVIGEPFQRVAVDLIGPLSRPSRTGKQYILTMVDYATRYPEAVALRRIDAPAVADAL-IQIFSRVGFPSEILSDQGPQFMSQLLQCLWQRCGVTSLRSSPYHPQTNGLCERFNGTLKNML 267          
BLAST of SMED30026186 vs. Ensembl Xenopus
Match: ENSXETT00000023941.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV463742.1:21:4282:-1 gene:ENSXETG00000015734.1 transcript:ENSXETT00000023941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 7.891e-22
Identity = 56/171 (32.75%), Postives = 92/171 (53.80%), Query Frame = -2
Query:   75 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQK-NKITRHTKSNLKELPERGK-FNVIHIDIVGPL--PSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 575
            H GV  T   ++  + WP +  ++  +C+TC  CQ+  +     K  L  LP   + F  + +D++GPL  PS + K+YILT++D  T +PEA+ + +I +         +  +R   P  I++D G QF S   + L Q+  +   H++ YHPQ NG  ERF+ TLK+ +
Sbjct:  651 HQGVTRTRHRLTQNFYWPGISQEVTRYCRTCDSCQRTGRANDKPKFPLCPLPIISEPFQRVAVDLIGPLSRPSRSGKQYILTVMDYATRYPEAVALRKIDAPTVADAL-IQIFSRVGFPSEILSDQGPQFTSQLLQCLWQRCGVRAIHSSPYHPQTNGLCERFNGTLKTML 820          
BLAST of SMED30026186 vs. Ensembl Xenopus
Match: ENSXETT00000025355.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:1:22781891:22783779:1 gene:ENSXETG00000014447.1 transcript:ENSXETT00000025355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.9593 bits (206), Expect = 6.465e-17
Identity = 46/184 (25.00%), Postives = 83/184 (45.11%), Query Frame = -2
Query:   87 RIVLPKKFHFKEFQRL----CHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTL 626
            +++LP+K        L     H G + T+ L+  ++ WP MK  + ++C++C  C + K      + L  +      +++ ID +   P       +L + D  T + +A P  +  +    +     +   Y +P+ I +D G+ F S    EL     +    TT YHPQ + + ERF+RTL
Sbjct:  112 QLMLPQKHRDSVLMALHDEHGHLGYDKTLGLVRDRFYWPCMKQDVEDYCRSCLRCIQRKTLPSRAAPLSHMESHSPLDLVCIDFLSIEPDEGGTSNVLVVTDHYTRYAQAFPTKDQRAITVAKVLVERFFIHYGLPKRIHSDQGRDFESKLVHELMSMLGVLKSRTTPYHPQGDPQPERFNRTL 295          
BLAST of SMED30026186 vs. Ensembl Mouse
Match: Gin1 (gypsy retrotransposon integrase 1 [Source:MGI Symbol;Acc:MGI:2182036])

HSP 1 Score: 57.7658 bits (138), Expect = 1.565e-8
Identity = 40/153 (26.14%), Postives = 71/153 (46.41%), Query Frame = -2
Query:  195 RIVLPKKFHFKEFQRLCHP-------GVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGK-FNVIHIDIVGPLPSVNNKK-YILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFI 626
            R+V+  +   K+  R CH        G++ T+ L+ S Y W  +   ++ W   C  CQ  K T       + LP  G  ++V+ +D++GP  + N    Y + + D  T W   +P+ ++S+   ++   N +   Y  P+ II D   +FI
Sbjct:   61 RLVVVSEEEKKKVLRECHENGPGVHHGISRTLTLVESGYYWTSVTNDVKQWVYACQHCQVAKNTVIVAPQ-QHLPMVGNPWSVVTVDLMGPFHTSNRSHVYAIIMTDLFTKWVMILPLCDVSASEISKAIINIFFL-YGPPQKIIMDQRDEFI 211          
BLAST of SMED30026186 vs. Ensembl Mouse
Match: Nynrin (NYN domain and retroviral integrase containing [Source:MGI Symbol;Acc:MGI:2652872])

HSP 1 Score: 57.3806 bits (137), Expect = 2.571e-8
Identity = 36/130 (27.69%), Postives = 60/130 (46.15%), Query Frame = -2
Query:  198 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMC-QKNKITRHTKSNLKELPER--GKFNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQF 575
            H G+  T K +     WP M+  +R++C++C  C  +N I    K      P R    ++ + I++VGP+  S    K++L + D +T W EA P+   +     +       AR+ VP  +    G QF
Sbjct: 1499 HQGLEDTYKTVRLLGWWPGMQDHVRDYCRSCLFCIPRNLIGGELKVIESPWPLRSTAPWSSLQIEVVGPVTVSEEGHKHVLIVADANTRWVEAFPLKPYTHVAVAQVLLQHVFARWGVPIRLEAAQGPQF 1628          
BLAST of SMED30026186 vs. Ensembl Mouse
Match: Nynrin (NYN domain and retroviral integrase containing [Source:MGI Symbol;Acc:MGI:2652872])

HSP 1 Score: 57.3806 bits (137), Expect = 2.571e-8
Identity = 36/130 (27.69%), Postives = 60/130 (46.15%), Query Frame = -2
Query:  198 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMC-QKNKITRHTKSNLKELPER--GKFNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQF 575
            H G+  T K +     WP M+  +R++C++C  C  +N I    K      P R    ++ + I++VGP+  S    K++L + D +T W EA P+   +     +       AR+ VP  +    G QF
Sbjct: 1499 HQGLEDTYKTVRLLGWWPGMQDHVRDYCRSCLFCIPRNLIGGELKVIESPWPLRSTAPWSSLQIEVVGPVTVSEEGHKHVLIVADANTRWVEAFPLKPYTHVAVAQVLLQHVFARWGVPIRLEAAQGPQF 1628          
BLAST of SMED30026186 vs. UniProt/SwissProt
Match: sp|Q09575|YRD6_CAEEL (Uncharacterized protein K02A2.6 OS=Caenorhabditis elegans OX=6239 GN=K02A2.6 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 1.208e-22
Identity = 63/188 (33.51%), Postives = 97/188 (51.60%), Query Frame = -2
Query:   72 RIVLPKKFHFKEFQRL--CHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKN-KITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAIS 626
            R+++PK       ++L   HPG+    +   S   W  + + I N  + C+ CQ+N K+ R    N   +PE   +  IHID  GPL    N  Y+L ++D  T + E + ++   S +TT     E  + +  PE II+DNG Q  S  F ++CQ H I+H+ +  Y+P+ NG  ERF  TLK  I+
Sbjct:  775 RVIVPKSLQKIVLKQLHEGHPGIVQMKQKARSFVFWRGLDSDIENMVRHCNNCQENSKMPRVVPLNPWPVPE-APWKRIHIDFAGPL----NGCYLLVVVDAKTKYAE-VKLTRSISAVTTIDLLEEIFSIHGYPETIISDNGTQLTSHLFAQMCQSHGIEHKTSAVYYPRSNGAAERFVDTLKRGIA 956          
BLAST of SMED30026186 vs. UniProt/SwissProt
Match: sp|P0CT40|TF29_SCHPO (Transposon Tf2-9 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-9 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.192e-19
Identity = 56/199 (28.14%), Postives = 104/199 (52.26%), Query Frame = -2
Query:   75 NGIIVDTTTGLTRIVLPKKFHFKEFQRLCHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSN-LKELPERGK-FNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISE-ISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 662
            + I++   T LTR ++ KK+H  E  +L HPG+     +I  ++ W  ++ QI+ + + CH CQ NK   H     L+ +P   + +  + +D +  LP  +    +  ++DR +     +P ++ I++  T R F+   IA +  P+ II DN   F S T+K+   K+N   + +  Y PQ +G+ ER ++T++  +
Sbjct:  901 DQILLPNDTQLTRTII-KKYH--EEGKLIHPGIELLTNIILRRFTWKGIRKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPESSGYNALFVVVDRFSKMAILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLL 1096          
BLAST of SMED30026186 vs. UniProt/SwissProt
Match: sp|P0CT37|TF24_SCHPO (Transposon Tf2-4 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-4 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.192e-19
Identity = 56/199 (28.14%), Postives = 104/199 (52.26%), Query Frame = -2
Query:   75 NGIIVDTTTGLTRIVLPKKFHFKEFQRLCHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSN-LKELPERGK-FNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISE-ISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 662
            + I++   T LTR ++ KK+H  E  +L HPG+     +I  ++ W  ++ QI+ + + CH CQ NK   H     L+ +P   + +  + +D +  LP  +    +  ++DR +     +P ++ I++  T R F+   IA +  P+ II DN   F S T+K+   K+N   + +  Y PQ +G+ ER ++T++  +
Sbjct:  901 DQILLPNDTQLTRTII-KKYH--EEGKLIHPGIELLTNIILRRFTWKGIRKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPESSGYNALFVVVDRFSKMAILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLL 1096          
BLAST of SMED30026186 vs. UniProt/SwissProt
Match: sp|P0CT35|TF22_SCHPO (Transposon Tf2-2 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-2 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.192e-19
Identity = 56/199 (28.14%), Postives = 104/199 (52.26%), Query Frame = -2
Query:   75 NGIIVDTTTGLTRIVLPKKFHFKEFQRLCHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSN-LKELPERGK-FNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISE-ISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 662
            + I++   T LTR ++ KK+H  E  +L HPG+     +I  ++ W  ++ QI+ + + CH CQ NK   H     L+ +P   + +  + +D +  LP  +    +  ++DR +     +P ++ I++  T R F+   IA +  P+ II DN   F S T+K+   K+N   + +  Y PQ +G+ ER ++T++  +
Sbjct:  901 DQILLPNDTQLTRTII-KKYH--EEGKLIHPGIELLTNIILRRFTWKGIRKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPESSGYNALFVVVDRFSKMAILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLL 1096          
BLAST of SMED30026186 vs. UniProt/SwissProt
Match: sp|P0CT34|TF21_SCHPO (Transposon Tf2-1 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-1 PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 2.192e-19
Identity = 56/199 (28.14%), Postives = 104/199 (52.26%), Query Frame = -2
Query:   75 NGIIVDTTTGLTRIVLPKKFHFKEFQRLCHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSN-LKELPERGK-FNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISE-ISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 662
            + I++   T LTR ++ KK+H  E  +L HPG+     +I  ++ W  ++ QI+ + + CH CQ NK   H     L+ +P   + +  + +D +  LP  +    +  ++DR +     +P ++ I++  T R F+   IA +  P+ II DN   F S T+K+   K+N   + +  Y PQ +G+ ER ++T++  +
Sbjct:  901 DQILLPNDTQLTRTII-KKYH--EEGKLIHPGIELLTNIILRRFTWKGIRKQIQEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPWESLSMDFITALPESSGYNALFVVVDRFSKMAILVPCTKSITAEQTARMFDQRVIAYFGNPKEIIADNDHIFTSQTWKDFAHKYNFVMKFSLPYRPQTDGQTERTNQTVEKLL 1096          
BLAST of SMED30026186 vs. TrEMBL
Match: A0A4C1Z8A3 (Integrase catalytic domain-containing protein OS=Eumeta variegata OX=151549 GN=EVAR_48378_1 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.834e-53
Identity = 88/173 (50.87%), Postives = 111/173 (64.16%), Query Frame = -2
Query:   75 QRLCHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLK--ELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 587
            Q  CHPG NAT KL+S +YVWP ++   R W +TC  CQ++KITRH  + L   +LP   +F  IHID++GPLP     +Y LT IDR T WPEA PI++I++    +   N WI+R+  P  ++TD G QF S  FK L Q     HR TTAYHP CNG VERFHR LK+AI
Sbjct:   54 QTTCHPGTNATAKLVSDRYVWPGVRRDSREWVRTCLACQRSKITRHVTTPLGTFKLPA-ARFRFIHIDLIGPLPISQGYRYCLTAIDRFTRWPEAFPIADITAETVAKALINGWISRFGCPIDVVTDRGAQFESALFKSLAQIAGFQHRRTTAYHPSCNGLVERFHRQLKAAI 225          
BLAST of SMED30026186 vs. TrEMBL
Match: A0A4Y2FKM9 (Retrovirus-related Pol polyprotein from transposon opus OS=Araneus ventricosus OX=182803 GN=pol_4433 PE=4 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 9.523e-53
Identity = 93/203 (45.81%), Postives = 131/203 (64.53%), Query Frame = -2
Query:   75 NGNGIIVDTTTGLTRIVLPKKFHFKEFQRL---CHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKE--LPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 668
            +G  +  D +T   R  +P++F  + FQ++   CHPG+  TIK ++ K++W  MK Q+  W KTC  CQK K+ RHTKS   E  +P+  +F+V+HID++GPLP     +Y LT IDR +SW EA+P+ +I++ +  R F N W++R+ VP  IITD G+QF S  F+ L         HTT+YHPQCNGK+ER HRTLK AI
Sbjct:  244 SGKILWCDISTSNIRPYIPQQFRLQMFQQIHGFCHPGIKTTIKQMTEKFIWSDMKKQVGEWAKTCIRCQKCKVNRHTKSKFGEYQVPD-ARFSVVHIDLIGPLPPSEGMEYCLTCIDRFSSWMEAVPLPDITAEIVGRAFYNHWVSRFGVPAQIITDQGRQFESHLFRRLVSICGAKVSHTTSYHPQCNGKIERLHRTLKGAI 445          
BLAST of SMED30026186 vs. TrEMBL
Match: A0A4C1VD39 (Integrase catalytic domain-containing protein OS=Eumeta variegata OX=151549 GN=EVAR_17396_1 PE=4 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 1.233e-52
Identity = 95/196 (48.47%), Postives = 121/196 (61.73%), Query Frame = -2
Query:   75 DTTTGLTRIVLPKKFHFKEFQRL---CHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLK--ELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 647
            D T G+ R  +PK    K F+ L    HPG NAT KL+S +YVWP ++   R W +TC  CQ++KITRH  + L   +LP   +F  IHID++GPLP     +Y LT IDR T WPEA PI++I++    +   N WI+R+  P  ++TD G QF S  FK L Q     HR TTAYHP CNG VERFHR LK+AI
Sbjct:  111 DDTNGILRPFVPKALRRKAFESLHSLSHPGTNATAKLVSDRYVWPGVRRDSREWVRTCLACQRSKITRHVTTPLGTFKLPA-ARFRFIHIDLIGPLPISQGYRYCLTAIDRFTRWPEAFPIADITAETVAKALINGWISRFGCPIDVVTDRGAQFESALFKSLAQIAGFQHRRTTAYHPSCNGLVERFHRQLKAAI 305          
BLAST of SMED30026186 vs. TrEMBL
Match: A0A2G8KPA7 (Pol polyprotein OS=Stichopus japonicus OX=307972 GN=BSL78_13299 PE=4 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.633e-52
Identity = 91/199 (45.73%), Postives = 122/199 (61.31%), Query Frame = -2
Query:   72 IIVDTTTGLTRIVLPKKFH---FKEFQRLCHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELP-ERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAIS 656
            I  D +TG  R  +P++F    F     L HPG+NAT +LI+ +Y+W  +   + NWCK+C  CQ+ K+ RHTK+ +   P  + +F  IH+DIVGPLP      Y+LTI+DR T WPEAIPIS I++    ++F   W++ + VP +I TD G QF S  F+ L Q        TTAYHP  NG VERFHR LKSA+S
Sbjct:  168 ITCDVSTGTARPYIPQQFRRAVFDSLHSLSHPGINATKRLITQRYIWSNVHKDVSNWCKSCIKCQQVKVHRHTKTPIGSFPMTQTRFQHIHMDIVGPLPPSEGYSYLLTIVDRFTRWPEAIPISNITAETVAKSFVKRWVSTFGVPSVITTDRGSQFESSLFRHLNQLLGTHRIRTTAYHPAANGLVERFHRQLKSALS 366          
BLAST of SMED30026186 vs. TrEMBL
Match: A0A2V3ZUL4 (Integrase catalytic domain-containing protein (Fragment) OS=Marinifilum breve OX=2184082 GN=DF185_22945 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.737e-52
Identity = 89/205 (43.41%), Postives = 124/205 (60.49%), Query Frame = -2
Query:   57 IIVDTTTGLTRIVLPKKFH---FKEFQRLCHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKEL--PERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAISFSRAS 656
            ++ DT+TG    ++PK +    F    +L HPGV ATIKLI+ ++ WP M   +R W ++C  CQK+K+ RH K  L     P+  +F+ +H+D+VGPLP  N   Y+LT +DR T WPEA+PI +I++    R F   W+A +  P  I TD G+QF S  F+ L     I    TTAYHPQ NG VERFHR LK+++S +  S
Sbjct:   36 LLCDTSTGRDGPIVPKHYRRNVFNTLHKLSHPGVRATIKLIAERFCWPGMNKDVREWARSCVSCQKSKVIRHNKCPLGSFKTPD-ARFDHVHLDLVGPLPDSNGYSYLLTCVDRFTRWPEAVPIKDITAETVARAFVERWVANFGCPSPITTDRGRQFESDLFRRLTTLLGITRFRTTAYHPQANGLVERFHRQLKASLSAANVS 239          
BLAST of SMED30026186 vs. Ensembl Cavefish
Match: ENSAMXT00000037741.1 (pep primary_assembly:Astyanax_mexicanus-2.0:6:27788674:27792885:-1 gene:ENSAMXG00000029895.1 transcript:ENSAMXT00000037741.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.309 bits (277), Expect = 1.169e-26
Identity = 62/194 (31.96%), Postives = 98/194 (50.52%), Query Frame = -2
Query:   69 RIVLPKKFHFKEFQRL------CHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKIT-RHTKSNLKELPERGKFNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAISF 626
            R+V+P++   +  Q L       H G+      I +++ WP+  + + +WCK C +C   K +    ++ L+ +     F  + IDIVGPLP +    KYI+ I D  T W EA  +    +    RT   ++I R+  P  I TD GK F S  F+ +C+  +I    TT YHP  +G VER +RT+ + +S 
Sbjct:   78 RVVVPRELVPELLQLLHNSKTGGHLGIAKLKDKIRTRFYWPKWSSDVMDWCKKCELCAVFKTSGAEPRAPLRPIQAGYPFEKLGIDIVGPLPVTSQGNKYIIVIADYFTKWCEAFAMRAQDADTVARTVVEQFILRWGTPRSIHTDQGKNFDSALFRAICELLDIHKTRTTPYHPSSDGLVERLNRTITTMLSM 271          
BLAST of SMED30026186 vs. Ensembl Cavefish
Match: ENSAMXT00000044431.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000182.1:892613:897532:1 gene:ENSAMXG00000038169.1 transcript:ENSAMXT00000044431.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.464 bits (280), Expect = 2.868e-26
Identity = 61/169 (36.09%), Postives = 100/169 (59.17%), Query Frame = -2
Query:   84 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPERG-KFNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWI---ARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLK 575
            H G   T+K +  ++ WP M+A++RN+C+ C +CQ     +   + L  LP  G  F  + +D+VGPLP S    +Y+L ++D  T +PEA+ + + +    TR+   E +   +R  +P+ I++D G  F+S   KE+C+   I H HT+ YHPQ +G VER+++TLK
Sbjct:  370 HLGYENTLKKLKDRFHWPSMEAEVRNFCQRCAVCQSTSPRKPAPAPLIPLPIIGVPFERLGMDLVGPLPKSARGHEYLLVLVDYATRYPEAVALRKAN----TRSIAKELVLLFSRVGLPKEILSDQGTPFVSNLMKEVCRLLKIKHLHTSIYHPQTDGLVERYNQTLK 534          
BLAST of SMED30026186 vs. Ensembl Cavefish
Match: ENSAMXT00000030370.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000296.1:152829:155012:-1 gene:ENSAMXG00000036862.1 transcript:ENSAMXT00000030370.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 4.014e-26
Identity = 64/194 (32.99%), Postives = 106/194 (54.64%), Query Frame = -2
Query:   15 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQ----KNKITRHTKSNLKELPERGK-FNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI-SFSRASPSHI*RYWHITKPN 575
            H G+  T   I   + WP MK  +  +C++CH+CQ     N++     + L  +P  G+ F  + +D VGPLP S    +++LTI+   T +PEAIP+ +I++   T+    ++ + + +P II TD G  F+S  F ++ +  NI H  +++YHP+  G +ERFH++LKS + SF           W + KP 
Sbjct:  155 HLGITKTYSRILKHFFWPGMKTDVSKYCRSCHVCQITGKPNQMV--PPAPLCPVPAVGEPFEKVLVDCVGPLPKSKTGNQFLLTIMCTATRFPEAIPLRKITAQSVTQALL-KFFSTFGLPRIIQTDQGNNFLSKLFAQVLKTLNIQHVVSSSYHPESQGALERFHQSLKSMLRSF----------VWTVVKPG 335          
BLAST of SMED30026186 vs. Ensembl Cavefish
Match: ENSAMXT00000045638.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000061.1:953511:958244:1 gene:ENSAMXG00000040892.1 transcript:ENSAMXT00000045638.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 1.763e-25
Identity = 65/198 (32.83%), Postives = 108/198 (54.55%), Query Frame = -2
Query:   75 RIVLPKKFHFKEFQRLCHPG-------VNATIKLISSKYVWPRMKAQIRNWCKTCHMCQ-----KNKITRHTKSNLKELPERGK-FNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 626
            +IV+P  +  K   RL H G       V  T   +   + WP +K  +  +C+TCH CQ       KI     + L  +P  G+ F  + +D VGPLP S +  +++LTI+   T +PEAIP+ +I++ +  R    ++ + + +P  + TD G  F+S  F+++ +  NI H  ++ YHP+  G +ERFH++LKSA+
Sbjct:  694 QIVMPIAYR-KHVLRLAHDGPWSGHLGVTKTYSRVLKCFFWPSLKKDVAEYCRTCHTCQCVGKPNQKIP---PAPLCPVPVMGEPFERVLVDCVGPLPKSKSGNQFLLTIMCTATRFPEAIPLRKITAPVIVRALV-KFFSTFGLPREVQTDQGTNFMSKIFQQVMKMLNIKHVVSSPYHPESQGALERFHQSLKSAL 886          
BLAST of SMED30026186 vs. Ensembl Cavefish
Match: ENSAMXT00000036084.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:10187890:10192677:-1 gene:ENSAMXG00000031698.1 transcript:ENSAMXT00000036084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 107.071 bits (266), Expect = 4.489e-25
Identity = 59/195 (30.26%), Postives = 105/195 (53.85%), Query Frame = -2
Query:   75 RIVLPKKFHFKEFQRLCHP-------GVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHT--KSNLKELPERGK-FNVIHIDIVGPLPSVNN-KKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 626
            +IV+P  F  +   RL H        G+  T   I   + WP ++  +  +C++CH+CQ           + L  +P  G+ F  + +D VGPLP   +  +Y+LTI+   T +PEAIP+ +I++ +  R    ++   + +P+++ +D G  F+S  F ++    NI H+ ++ YHP+  G +ERFH++LKS +
Sbjct:  719 QIVVPDVFR-QHVLRLAHDHPWSGHLGITKTYARILKHFFWPGLRKDVVEFCRSCHVCQTTGKPNQVIPPAPLCPIPAIGEPFERVLVDCVGPLPKTKSGNQYLLTIMCAATRFPEAIPLRKITTPVVVRALI-KYFTTFGLPKVVQSDQGTNFLSKLFAQVMATLNITHQVSSPYHPESQGALERFHQSLKSML 911          

HSP 2 Score: 27.335 bits (59), Expect = 4.489e-25
Identity = 10/25 (40.00%), Postives = 14/25 (56.00%), Query Frame = -3
Query:    5 PLVFLGLHQVISEDTGISPSQTVFG 79
            PLV   + + + E  G SP+Q VF 
Sbjct:  927 PLVLFAVREAVQESLGFSPAQLVFA 951          
BLAST of SMED30026186 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004123.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004123.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 4.148e-14
Identity = 38/134 (28.36%), Postives = 67/134 (50.00%), Query Frame = -2
Query:  192 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNK-KYILTIIDRDTSWPEAIPISE-----ISSGLTTRTFENEWIARYRVPEIIITDNGKQFIS 575
            H G   TI  + + Y W  M + ++N   +C +C+     R    ++K L   G + V+ +D++GPLP  +   +Y+L +ID  + W EA+P+ E     ++S LT          RY  P  + +  GK+F++
Sbjct:   90 HFGQKKTILKLEADYYWLGMISDVKNLIASCGVCRNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASALTVV------FCRYGFPRKVFSSLGKEFVT 217          
BLAST of SMED30026186 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004121.1 (pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 gene:ENSPMAG00000003764.1 transcript:ENSPMAT00000004121.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 4.600e-14
Identity = 38/134 (28.36%), Postives = 67/134 (50.00%), Query Frame = -2
Query:  192 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNK-KYILTIIDRDTSWPEAIPISE-----ISSGLTTRTFENEWIARYRVPEIIITDNGKQFIS 575
            H G   TI  + + Y W  M + ++N   +C +C+     R    ++K L   G + V+ +D++GPLP  +   +Y+L +ID  + W EA+P+ E     ++S LT          RY  P  + +  GK+F++
Sbjct:   90 HFGQKKTILKLEADYYWLGMISDVKNLIASCGVCRNKGSRRVAMPSMKLLKASGPWEVLGLDVLGPLPVTSRANRYLLLLIDYFSKWAEAVPLIEKSQEHVASALTV------VFCRYGFPRKVFSSLGKEFVT 217          
BLAST of SMED30026186 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009777.1 (pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-1 gene:ENSPMAG00000008837.1 transcript:ENSPMAT00000009777.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.929 bits (154), Expect = 1.060e-11
Identity = 31/129 (24.03%), Postives = 65/129 (50.39%), Query Frame = -2
Query:  192 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNK-KYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFIS 575
            H G   T KL+   Y W  M   IR++   C +C++    R + S++K L     + V+ +D++GP P+ +   +++L I+D  T W E  P+++ S+          +  R+  P+ +  +  +++++
Sbjct:   82 HCGQTRTRKLLEEHYYWKGMVNDIRDYINACEICKQKSYKRSSISHVKLLKASYPWEVLGMDLLGPFPATSRAHRFVLLIVDYFTKWAELTPMTDQSAAHVVAALTTAF-HRFGFPKKLFCNVSEEYVA 209          
BLAST of SMED30026186 vs. Ensembl Medaka
Match: ENSORLT00000038086.1 (pep primary_assembly:ASM223467v1:8:23628267:23631428:1 gene:ENSORLG00000028632.1 transcript:ENSORLT00000038086.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 1.117e-27
Identity = 64/202 (31.68%), Postives = 112/202 (55.45%), Query Frame = -2
Query:   75 DTTTGLTRIVLPKKFHFKEFQRLCHP-------GVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHT--KSNLKELPERGK-FNVIHIDIVGPLPSV-NNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 647
            D+     ++V+P  F   E  RL H        GV  T+  ++  + WP +K+ +  +CKTCH+CQ       T  ++ L  +P  G+ F  + +D VGPLP   +  +Y+LT++   T +PEA+P+  I++   ++    ++   + +P +I TD G  F+S  F ++ Q+ +I H  ++AYHP+  G +ERFH+TLK+ +
Sbjct:  198 DSWGSFFQVVVPVIFR-TEVLRLAHDHGLAGHMGVRKTLDRVTRHFYWPGVKSDVTGYCKTCHVCQVVGKPNQTIPRAPLHPIPAIGEPFEHVLVDCVGPLPRTKSGNQYLLTMMCTATRFPEAVPLRTITATAVSKALV-KFFTLFGLPRVIQTDQGTNFMSRVFSQVLQQFSIKHCTSSAYHPESQGALERFHQTLKTML 397          
BLAST of SMED30026186 vs. Ensembl Medaka
Match: ENSORLT00000031051.1 (uncharacterized LOC111947296 [Source:NCBI gene;Acc:111947296])

HSP 1 Score: 114.005 bits (284), Expect = 1.009e-26
Identity = 59/173 (34.10%), Postives = 100/173 (57.80%), Query Frame = -2
Query:   75 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQ----KNKITRHTKSNLKELP-ERGKFNVIHIDIVGPLPSVNN-KKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 575
            H GV  T   +   + WP +K+ + ++C+TCH+CQ     N++     + L  +P     F  + +D VGPLP      ++ILTI+   T +PEA+P+  I++ + T+    ++ + + +P++I TD G  F S  FKE+ +  NI H  +++YHP+  G +ERFH+TLKS +
Sbjct:  723 HLGVTKTYDRVLKHFFWPGLKSDVIHYCRTCHICQLAGKPNQVV--PPAPLVPIPVHEEPFERVIVDCVGPLPKAKTGNQFILTIMCASTRFPEAVPLRRITANVITKALV-KFFSVFGLPKVIQTDQGTNFKSKVFKEVLKGLNIRHVTSSSYHPESQGALERFHQTLKSMV 892          
BLAST of SMED30026186 vs. Ensembl Medaka
Match: ENSORLT00000041405.1 (pep primary_assembly:ASM223467v1:5:14130243:14134904:1 gene:ENSORLG00000026873.1 transcript:ENSORLT00000041405.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 1.063e-26
Identity = 57/171 (33.33%), Postives = 100/171 (58.48%), Query Frame = -2
Query:   75 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHT--KSNLKELPERGK-FNVIHIDIVGPLPSVNN-KKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 575
            H GV  T + I   + WP +KA + N+C+ CH+CQ           + L+ +P  G+ F  + +D VGPLP   +  +Y+LTI+   T +PEA+P+  I++    ++   ++ + + +P +I +D G  F+S  F+++ +  NI H  ++AYHP+  G +ER+H+TLKS +
Sbjct:  703 HLGVRKTYRRILQHFFWPGIKADVANYCRHCHICQLTGKPNQKIPPAPLRPIPVVGEPFERVIVDCVGPLPRTKHGNQYLLTIMCAATRFPEAVPLRTITTRAIVKSL-TKFFSIFGMPRVIQSDQGTNFLSKIFQQVLRTLNIQHVVSSAYHPESQGALERWHQTLKSML 872          
BLAST of SMED30026186 vs. Ensembl Medaka
Match: ENSORLT00000031845.1 (pep primary_assembly:ASM223467v1:15:1912160:1915957:1 gene:ENSORLG00000023918.1 transcript:ENSORLT00000031845.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.62 bits (283), Expect = 1.383e-26
Identity = 57/171 (33.33%), Postives = 100/171 (58.48%), Query Frame = -2
Query:   75 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHT--KSNLKELPERGK-FNVIHIDIVGPLPSVNN-KKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 575
            H GV  T + I   + WP +KA + N+C+ CH+CQ           + L+ +P  G+ F  + +D VGPLP   +  +Y+LTI+   T +PEA+P+  I++    ++   ++ + + +P +I +D G  F+S  F+++ +  NI H  ++AYHP+  G +ER+H+TLKS +
Sbjct:  703 HLGVRKTYRRILQHFFWPGIKADVANYCRHCHICQLTGKPNQKIPPAPLRPIPVVGEPFERVIVDCVGPLPRTKHGNQYLLTIMCAATRFPEAVPLRTITTRAIVKSL-TKFFSIFGMPRVIQSDQGTNFLSKIFQQVLRTLNIQHVVSSAYHPESQGALERWHQTLKSML 872          
BLAST of SMED30026186 vs. Ensembl Medaka
Match: ENSORLT00000035259.1 (pep primary_assembly:ASM223467v1:7:7197276:7201937:-1 gene:ENSORLG00000026629.1 transcript:ENSORLT00000035259.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 113.235 bits (282), Expect = 1.847e-26
Identity = 57/171 (33.33%), Postives = 99/171 (57.89%), Query Frame = -2
Query:   75 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHT--KSNLKELPERGK-FNVIHIDIVGPLPSVNN-KKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 575
            H GV  T + I   + WP +KA + N+C+ CH+CQ           + L+ +P  G+ F  + +D VGPLP   +  +Y+LTI+   T +PEA+P+  I++    ++   ++   + +P +I +D G  F+S  F+++ +  NI H  ++AYHP+  G +ER+H+TLKS +
Sbjct:  703 HLGVRKTYRRILQHFFWPGIKADVANYCRHCHICQLTGKPNQKIPPAPLRPIPMVGEPFERVIVDCVGPLPRTKHGNQYLLTIMCAATRFPEAVPLRTITTRAIVKSL-TKFFPIFGMPRVIQSDQGTNFLSKIFQQVLRTLNIQHVVSSAYHPESKGALERWHQTLKSML 872          
BLAST of SMED30026186 vs. Planmine SMEST
Match: SMESG000027384.1 (SMESG000027384.1)

HSP 1 Score: 122.865 bits (307), Expect = 1.315e-32
Identity = 81/193 (41.97%), Postives = 101/193 (52.33%), Query Frame = -2
Query:  123 VTIIKT*HNGNGIIVDTTTGLTRIVLPKKFHFKEFQRL---CHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQ 692
             T  KT   G G+++D T  + RI+L + F ++E  RL   CHP  NATIKL           AQI    KT      NKI             R +   + I +V  L S              TSWPEAIPI +I S    +T E EWI+++  PEIIITDNGKQFIS +FK+LC K+NI+H HTT YHPQ
Sbjct:   72 ATSFKTQITGYGVLIDITKKVKRIILHEIFRYEELMRLHNICHPRSNATIKL-----------AQIEVNGKT------NKI-------------RNEKTFMSILLVHYLQS--------------TSWPEAIPIGDIRSETVYKTMEREWISKFESPEIIITDNGKQFISSSFKKLCNKYNIEHLHTTPYHPQ 220          
BLAST of SMED30026186 vs. Planmine SMEST
Match: SMESG000000071.1 (SMESG000000071.1)

HSP 1 Score: 116.701 bits (291), Expect = 1.005e-28
Identity = 66/187 (35.29%), Postives = 97/187 (51.87%), Query Frame = -2
Query:   75 RIVLPKKFH---FKEFQRLCHPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPSVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 626
            R++LP +F      +   + HP   AT K+I ++Y+WP M+ +I+ + KTC   Q NK T+   +     P R  F +IH++IVGPL   NN +                           R F   WI RY  P+ I+TD  +QF S  F+ LC+ +NI    TTA++PQ NGK+ER H+TLK ++
Sbjct:  163 RLLLPIEFRNTCISKVHHINHPRNKATYKIIYNRYIWPNMRKEIKQFVKTCKRYQINKTTKKLLTQKVNFPSRQPFELIHVNIVGPLAPNNNYR---------------------QENKLVRKFN--WIGRYGQPKTIMTDQVRQFESQLFEMLCKIYNIKRNRTTAFNPQANGKIERLHKTLKESL 326          
BLAST of SMED30026186 vs. Planmine SMEST
Match: SMESG000038549.1 (SMESG000038549.1)

HSP 1 Score: 108.612 bits (270), Expect = 4.658e-25
Identity = 61/171 (35.67%), Postives = 87/171 (50.88%), Query Frame = -2
Query:   72 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKITRHT-KSNLKELPERGK-FNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAIS 575
            H  V  T+  +  KY WP M   +++W K C  C   K T    K+ LK +P   +   +I +DI+GPLP ++N   YIL + D  T +PEA  + +  +    +    E   RY  P+ I+TD G  F+S   KE+     I    T+ YHPQCNG  ERF+ TL   +S
Sbjct: 2558 HMSVKKTLARMKQKYFWPNMSESVKDWIKNCLTCATRKNTGTKWKAPLKPMPVPAEPMTMISMDILGPLPETLNGNIYILVVTDYLTKFPEAFAMKDQKAKTIAQKLVEEICCRYGTPKQILTDQGTNFMSEIMKEVTNYFKIAKLRTSPYHPQCNGLTERFNGTLIQMLS 2728          
BLAST of SMED30026186 vs. Planmine SMEST
Match: SMESG000080881.1 (SMESG000080881.1)

HSP 1 Score: 103.605 bits (257), Expect = 2.364e-23
Identity = 59/170 (34.71%), Postives = 85/170 (50.00%), Query Frame = -2
Query:   75 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKIT-RHTKSNLKELPERGK-FNVIHIDIVGPLP-SVNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAI 575
            H     T+  +  KY W  +++ +R WC TC +C   + T +  K  LK +P  G    +  +DIVGPLP ++N  KYI+   D  T WPEA  +    +    + F    I RY  P+ ++TD G  F S  F  + +   I    T+  HPQ +G VERF RTL + I
Sbjct: 3851 HLSARKTLSRLKQKYYWDTIESDVRQWCHTCEVCLTRRNTGKKIKVPLKPMPVPGAPMEITAMDIVGPLPETINVNKYIIVFCDYLTKWPEAYAMQNQKAETVAKIFVENIIFRYGAPKKLLTDQGTNFQSELFISITELFGILKLSTSPCHPQTDGLVERFIRTLINMI 4020          
BLAST of SMED30026186 vs. Planmine SMEST
Match: SMESG000072336.1 (SMESG000072336.1)

HSP 1 Score: 101.293 bits (251), Expect = 1.543e-22
Identity = 60/171 (35.09%), Postives = 81/171 (47.37%), Query Frame = -2
Query:   72 HPGVNATIKLISSKYVWPRMKAQIRNWCKTCHMCQKNKIT-RHTKSNLKELP-ERGKFNVIHIDIVGPLPSVNNKK-YILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIIITDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAIS 575
            H     T   +  KY WP +   ++ W K C  C   K T    K+ LK +P       +I +D+VGPLP  NN   YIL I D  T +PEA  I +  +    R    E   RY  P+ I+TD G  F+S   +E+     I    T+ YHPQ NG+ ERF+  L   +S
Sbjct: 3981 HMSAKKTEARLRQKYYWPNIGEDVKEWIKNCLTCATRKSTGSKLKAPLKPMPIPPEPMTMIAMDVVGPLPETNNGNIYILVITDYLTKFPEAFAIPDQKARTVARILVEEICCRYGTPKQILTDQGTNFMSEIIEEVTNYFRIAKLRTSPYHPQTNGQTERFNGILIEMMS 4151          
The following BLAST results are available for this feature:
BLAST of SMED30026186 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GIN13.914e-925.32gypsy retrotransposon integrase 1 [Source:HGNC Sym... [more]
GIN12.416e-825.32gypsy retrotransposon integrase 1 [Source:HGNC Sym... [more]
NYNRIN3.498e-727.19NYN domain and retroviral integrase containing [So... [more]
back to top
BLAST of SMED30026186 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026186 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026186 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FO704673.12.268e-2333.53pep chromosome:GRCz11:12:14545475:14551077:-1 gene... [more]
CU929458.14.050e-2331.52pep chromosome:GRCz11:11:43363075:43368382:1 gene:... [more]
BX571665.14.555e-2331.52pep chromosome:GRCz11:17:35431724:35437222:1 gene:... [more]
CR533578.34.818e-2331.52pep chromosome:GRCz11:16:23466094:23471387:-1 gene... [more]
CR354395.25.707e-2330.91pep chromosome:GRCz11:12:13553730:13556536:-1 gene... [more]
back to top
BLAST of SMED30026186 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nmbr9.697e-2836.69neuromedin B receptor [Source:Xenbase;Acc:XB-GENE-... [more]
mybl21.200e-2736.69MYB proto-oncogene like 2 [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000023851.13.038e-2530.93pep primary_assembly:Xenopus_tropicalis_v9.1:KV461... [more]
ENSXETT00000023941.17.891e-2232.75pep primary_assembly:Xenopus_tropicalis_v9.1:KV463... [more]
ENSXETT00000025355.16.465e-1725.00pep primary_assembly:Xenopus_tropicalis_v9.1:1:227... [more]
back to top
BLAST of SMED30026186 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Gin11.565e-826.14gypsy retrotransposon integrase 1 [Source:MGI Symb... [more]
Nynrin2.571e-827.69NYN domain and retroviral integrase containing [So... [more]
Nynrin2.571e-827.69NYN domain and retroviral integrase containing [So... [more]
back to top
BLAST of SMED30026186 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q09575|YRD6_CAEEL1.208e-2233.51Uncharacterized protein K02A2.6 OS=Caenorhabditis ... [more]
sp|P0CT40|TF29_SCHPO2.192e-1928.14Transposon Tf2-9 polyprotein OS=Schizosaccharomyce... [more]
sp|P0CT37|TF24_SCHPO2.192e-1928.14Transposon Tf2-4 polyprotein OS=Schizosaccharomyce... [more]
sp|P0CT35|TF22_SCHPO2.192e-1928.14Transposon Tf2-2 polyprotein OS=Schizosaccharomyce... [more]
sp|P0CT34|TF21_SCHPO2.192e-1928.14Transposon Tf2-1 polyprotein OS=Schizosaccharomyce... [more]
back to top
BLAST of SMED30026186 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4C1Z8A35.834e-5350.87Integrase catalytic domain-containing protein OS=E... [more]
A0A4Y2FKM99.523e-5345.81Retrovirus-related Pol polyprotein from transposon... [more]
A0A4C1VD391.233e-5248.47Integrase catalytic domain-containing protein OS=E... [more]
A0A2G8KPA71.633e-5245.73Pol polyprotein OS=Stichopus japonicus OX=307972 G... [more]
A0A2V3ZUL41.737e-5243.41Integrase catalytic domain-containing protein (Fra... [more]
back to top
BLAST of SMED30026186 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037741.11.169e-2631.96pep primary_assembly:Astyanax_mexicanus-2.0:6:2778... [more]
ENSAMXT00000044431.12.868e-2636.09pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030370.14.014e-2632.99pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000045638.11.763e-2532.83pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000036084.14.489e-2530.26pep primary_assembly:Astyanax_mexicanus-2.0:22:101... [more]
back to top
BLAST of SMED30026186 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000004123.14.148e-1428.36pep scaffold:Pmarinus_7.0:GL477387:93825:107321:1 ... [more]
ENSPMAT00000004121.14.600e-1428.36pep scaffold:Pmarinus_7.0:GL477387:93825:107330:1 ... [more]
ENSPMAT00000009777.11.060e-1124.03pep scaffold:Pmarinus_7.0:GL476990:135790:139231:-... [more]
back to top
BLAST of SMED30026186 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026186 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026186 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038086.11.117e-2731.68pep primary_assembly:ASM223467v1:8:23628267:236314... [more]
ENSORLT00000031051.11.009e-2634.10uncharacterized LOC111947296 [Source:NCBI gene;Acc... [more]
ENSORLT00000041405.11.063e-2633.33pep primary_assembly:ASM223467v1:5:14130243:141349... [more]
ENSORLT00000031845.11.383e-2633.33pep primary_assembly:ASM223467v1:15:1912160:191595... [more]
ENSORLT00000035259.11.847e-2633.33pep primary_assembly:ASM223467v1:7:7197276:7201937... [more]
back to top
BLAST of SMED30026186 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000027384.11.315e-3241.97SMESG000027384.1[more]
SMESG000000071.11.005e-2835.29SMESG000000071.1[more]
SMESG000038549.14.658e-2535.67SMESG000038549.1[more]
SMESG000080881.12.364e-2334.71SMESG000080881.1[more]
SMESG000072336.11.543e-2235.09SMESG000072336.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026186 ID=SMED30026186|Name=SMED30026186|organism=Schmidtea mediterranea sexual|type=transcript|length=1257bp
CAGTTCCAAACACTGTTTGGCTTGGTGATATGCCAGTATCTTCAGATATG
ACTTGGTGAAGCCCTAGAAAAACTAATGGCTGATTTGAGCGTTCGGTGGA
ACCTTTCAACTTTACCGTTGCATTGAGGATGATATGCAGTGGTGTGTCTA
TGATCGATATTGTGCTTTTGACATAGTTCCTTGAAAGTGAATGAAATAAA
TTGTTTACCGTTGTCCGTTATGATGATTTCAGGAACTCTGTAGCGTGCTA
TCCATTCATTTTCAAAGGTTCTTGTTGTTAAACCACTTGATATTTCAGAA
ATTGGGATAGCTTCTGGCCAAGATGTATCTCTGTCAATAATGGTAAGAAT
ATACTTTTTATTATTGACTGAAGGCAATGGTCCTACGATGTCTATATGTA
TCACGTTGAACTTGCCGCGTTCTGGAAGTTCTTTGAGATTCGACTTTGTA
TGTCTTGTTATTTTATTTTTCTGACACATGTGGCAGGTTTTGCACCAATT
TCTGATTTGTGCTTTCATGCGGGGCCACACGTATTTTGAAGATATTAATT
TTATTGTTGCATTTACGCCTGGATGACAGAGTCTTTGGAATTCTTTAAAA
TGAAATTTTTTTGGAAGGACTATTCGTGTCAGCCCTGTTGTAGTATCTAC
GATTATTCCATTTCCGTTGTGTCAAGTTTTAATGATGGTGACTGCTCGAT
TAGTTGATTGAATGTAGAATCCTTTTGATGTAAGTAAATGACAAGAAAGT
GCATGCTGCTCTAATGATTCGTATGCATGAACGCCAAACTGATTTAAGTG
TACTTCTGCAATACCTTCGCAATGGTCGAAGCAACGTTCAAGTTGAGGGA
GAAATAATTACGGTGCCTTCATTTAAATGTTTAAAAGTTTTAGCAGAGTT
ACTGGAAAGGCTAAATGCTTCAAATCCTGCTATGGTACGAGAATCACTTG
TTTCTGATGCACTCGATTTATTGACCAAGGAACCTGAGTCCGTCAGTAAT
CCTATGAGTATTGAAGATGAACTGAATCGTGTTATTAAAGAAGGACAAAC
ACTGATTCAGCCAGTCAGACATGAGTCGTTGTTGCCAAAAATACAAAAAG
AAGTGACACTATTTAAAAATTTGGGTGCATGTGGTGATTATCTAAAAAGA
GCTCATTCATTTTTAATGACTGTAAAACCGACAAGTGTCGAGTCTGAGCG
GGCATTTTCTTCGGCTGGACAATAACAGCACAAAAATCCAGAACTGTTTA
GGCGAAG
back to top

protein sequence of SMED30026186-orf-1

>SMED30026186-orf-1 ID=SMED30026186-orf-1|Name=SMED30026186-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MIRMHERQTDLSVLLQYLRNGRSNVQVEGEIITVPSFKCLKVLAELLERL
NASNPAMVRESLVSDALDLLTKEPESVSNPMSIEDELNRVIKEGQTLIQP
VRHESLLPKIQKEVTLFKNLGACGDYLKRAHSFLMTVKPTSVESERAFSS
AGQ*
back to top

protein sequence of SMED30026186-orf-2

>SMED30026186-orf-2 ID=SMED30026186-orf-2|Name=SMED30026186-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=159bp
MKAQIRNWCKTCHMCQKNKITRHTKSNLKELPERGKFNVIHIDIVGPLPS
VNNKKYILTIIDRDTSWPEAIPISEISSGLTTRTFENEWIARYRVPEIII
TDNGKQFISFTFKELCQKHNIDHRHTTAYHPQCNGKVERFHRTLKSAISF
SRASPSHI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
IPR001584Integrase_cat-core
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration