Si:ch211-210c8.6

Overview
NameSi:ch211-210c8.6
Smed IDSMED30026185
Length (bp)972
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:ch211-210c8.6 (SMED30026185) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:ch211-210c8.6 (SMED30026185) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:ch211-210c8.6 (SMED30026185) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:ch211-210c8.6 (SMED30026185) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026185

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30026185SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026185SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30026185SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026185SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30026185SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026185SMESG000081276.1 SMESG000081275.1 Contig38862newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026185SMESG000081276.1 SMESG000081275.1 Contig38862uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30026185SMESG000081276.1 SMESG000081275.1 dd_Smed_v4_5465_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:ch211-210c8.6 vs. Ensembl Fly
Match: CG6282 (gene:FBgn0035914 transcript:FBtr0076637)

HSP 1 Score: 145.976 bits (367), Expect = 5.639e-41
Identity = 80/253 (31.62%), Postives = 141/253 (55.73%), Query Frame = 1
Query:  127 GIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKI----QIGLT---AIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVP-----IKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
             +Q V F I+ +   +   D  G +++I +++L T +   + +  K     Q+ +T    +W  RL  YL  RI+K G DK+F   +++I R  + W  Q +WV +   P + +       P     +  ++  G  +F++GL  E  AD QK++F+ +  N+G++ + GLW   RHPNYFGE+++W G++  S + I+      +A+ SP+F  ++++  SGIPL ER+AD ++  +L+Y+ YK +T  LIP
Sbjct:   20 SLQLVFFLINSVLQMDKLTDFAGGVNFI-IISLLTFFLGQIDRPSKAYDSRQLMVTLFVCLWGARLSGYLLYRIVKLGRDKQFEDTRRNIIRYAVFWTFQAVWVYIVSLPVIIINSPRHSQPRAPKTMTTLDSTGTGMFIVGLLAETYADLQKFSFRQDPANQGKFCNDGLWSVSRHPNYFGEVVIWWGIFAISLNVISG--HEWVAIASPIFTTMIILFLSGIPLRERSADEKYKDQLEYRKYKASTSPLIP 269          
BLAST of Si:ch211-210c8.6 vs. Ensembl Fly
Match: CG6282 (gene:FBgn0035914 transcript:FBtr0076636)

HSP 1 Score: 145.976 bits (367), Expect = 5.639e-41
Identity = 80/253 (31.62%), Postives = 141/253 (55.73%), Query Frame = 1
Query:  127 GIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKI----QIGLT---AIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVP-----IKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
             +Q V F I+ +   +   D  G +++I +++L T +   + +  K     Q+ +T    +W  RL  YL  RI+K G DK+F   +++I R  + W  Q +WV +   P + +       P     +  ++  G  +F++GL  E  AD QK++F+ +  N+G++ + GLW   RHPNYFGE+++W G++  S + I+      +A+ SP+F  ++++  SGIPL ER+AD ++  +L+Y+ YK +T  LIP
Sbjct:   20 SLQLVFFLINSVLQMDKLTDFAGGVNFI-IISLLTFFLGQIDRPSKAYDSRQLMVTLFVCLWGARLSGYLLYRIVKLGRDKQFEDTRRNIIRYAVFWTFQAVWVYIVSLPVIIINSPRHSQPRAPKTMTTLDSTGTGMFIVGLLAETYADLQKFSFRQDPANQGKFCNDGLWSVSRHPNYFGEVVIWWGIFAISLNVISG--HEWVAIASPIFTTMIILFLSGIPLRERSADEKYKDQLEYRKYKASTSPLIP 269          
BLAST of Si:ch211-210c8.6 vs. Ensembl Fly
Match: CG6282 (gene:FBgn0035914 transcript:FBtr0300194)

HSP 1 Score: 145.976 bits (367), Expect = 5.639e-41
Identity = 80/253 (31.62%), Postives = 141/253 (55.73%), Query Frame = 1
Query:  127 GIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKI----QIGLT---AIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVP-----IKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
             +Q V F I+ +   +   D  G +++I +++L T +   + +  K     Q+ +T    +W  RL  YL  RI+K G DK+F   +++I R  + W  Q +WV +   P + +       P     +  ++  G  +F++GL  E  AD QK++F+ +  N+G++ + GLW   RHPNYFGE+++W G++  S + I+      +A+ SP+F  ++++  SGIPL ER+AD ++  +L+Y+ YK +T  LIP
Sbjct:   20 SLQLVFFLINSVLQMDKLTDFAGGVNFI-IISLLTFFLGQIDRPSKAYDSRQLMVTLFVCLWGARLSGYLLYRIVKLGRDKQFEDTRRNIIRYAVFWTFQAVWVYIVSLPVIIINSPRHSQPRAPKTMTTLDSTGTGMFIVGLLAETYADLQKFSFRQDPANQGKFCNDGLWSVSRHPNYFGEVVIWWGIFAISLNVISG--HEWVAIASPIFTTMIILFLSGIPLRERSADEKYKDQLEYRKYKASTSPLIP 269          
BLAST of Si:ch211-210c8.6 vs. Ensembl Fly
Match: CG6282 (gene:FBgn0035914 transcript:FBtr0330165)

HSP 1 Score: 144.821 bits (364), Expect = 3.176e-39
Identity = 80/252 (31.75%), Postives = 141/252 (55.95%), Query Frame = 1
Query:  130 IQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKI----QIGLT---AIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVP-----IKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
            +Q V F I+ +   +   D  G +++I +++L T +   + +  K     Q+ +T    +W  RL  YL  RI+K G DK+F   +++I R  + W  Q +WV +   P + +       P     +  ++  G  +F++GL  E  AD QK++F+ +  N+G++ + GLW   RHPNYFGE+++W G++  S + I+      +A+ SP+F  ++++  SGIPL ER+AD ++  +L+Y+ YK +T  LIP
Sbjct:   21 LQLVFFLINSVLQMDKLTDFAGGVNFI-IISLLTFFLGQIDRPSKAYDSRQLMVTLFVCLWGARLSGYLLYRIVKLGRDKQFEDTRRNIIRYAVFWTFQAVWVYIVSLPVIIINSPRHSQPRAPKTMTTLDSTGTGMFIVGLLAETYADLQKFSFRQDPANQGKFCNDGLWSVSRHPNYFGEVVIWWGIFAISLNVISG--HEWVAIASPIFTTMIILFLSGIPLRERSADEKYKDQLEYRKYKASTSPLIP 269          
BLAST of Si:ch211-210c8.6 vs. Ensembl Zebrafish
Match: si:ch211-210c8.6 (si:ch211-210c8.6 [Source:ZFIN;Acc:ZDB-GENE-030131-3630])

HSP 1 Score: 226.483 bits (576), Expect = 1.369e-72
Identity = 114/255 (44.71%), Postives = 159/255 (62.35%), Query Frame = 1
Query:   88 MSSIWNTLAMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPF 852
            M S     A  D  IQWVG+ ++  F TE FYDL GS ++I +  L+  +  S    Q +Q GL   W +RLG +LF+RILK G+D+RF +++ S    F+ W +Q +WV VTL PTL +  +    P+   + IGW I+ +G + E IAD+QKWNFK +  N G++IH GLW + RHPNY GEIL W G++LS+ S +   Q   ++ +SP+F+  LL   SGIP+LE+ A  +WGS   +QNY KNTP L PF
Sbjct:   19 MGSTLAKCAATDLAIQWVGWALACSFKTEKFYDLAGSGTFILLAHLSRVWGGSGHLRQNVQTGLVTAWGLRLGTFLFLRILKEGQDRRFNNVRDSPGTFFVYWTMQALWVFVTLLPTLILNSERRDEPLGPRDYIGWGIWGLGFATEAIADQQKWNFKNDPDNVGKFIHHGLWAYSRHPNYLGEILQWSGLFLSASSIMQGPQ--YLSALSPLFVWFLLRHVSGIPILEKQAMKKWGSDPAFQNYVKNTPLLWPF 271          
BLAST of Si:ch211-210c8.6 vs. Ensembl Xenopus
Match: ENSXETT00000007073.1 (uncharacterized loc100145110 [Source:NCBI gene;Acc:100145110])

HSP 1 Score: 214.927 bits (546), Expect = 4.047e-68
Identity = 105/242 (43.39%), Postives = 154/242 (63.64%), Query Frame = 1
Query:  127 GIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPF 852
            GIQWV + ++ L  TE FYDL GS ++I +  L+  +  +    Q+IQ GL  IW +RLG +LF+RIL+ G D+RF  ++ +     I W +QGIW+ VTL P+L + L+    P+   + +GW ++ +G   +  AD+QKW+F+++  N G +I +GLW + RHPNY GEIL W G++LS+ + ++  Q  SI  ISPVF+  LL   SGIP+LER A  +WGS   YQ+Y + TP L PF
Sbjct:   14 GIQWVLWVVAALLHTEKFYDLAGSGTFILLAHLSLQWTGARYLRQQIQTGLITIWGVRLGTFLFLRILRDGHDRRFNGVRDNPRTFLIYWTMQGIWIFVTLLPSLMLNLEKRDKPLGLRDFLGWSLWTVGFITQATADQQKWSFRSDPDNMGTFIQSGLWAYSRHPNYLGEILQWSGLFLSASTVLSGFQLVSI--ISPVFVWFLLSYVSGIPILERQALKRWGSEAAYQSYVQRTPVLWPF 253          
BLAST of Si:ch211-210c8.6 vs. Ensembl Mouse
Match: Srd5a1 (steroid 5 alpha-reductase 1 [Source:MGI Symbol;Acc:MGI:98400])

HSP 1 Score: 48.9062 bits (115), Expect = 3.027e-6
Identity = 34/123 (27.64%), Postives = 55/123 (44.72%), Query Frame = 1
Query:  487 MIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFI 855
            + G+ ++L+G+ I + +D    N +       +    GL+++    NYFGE++ WCG  L+SW    SLQ    AL +               L  RA  H       +++Y K    LIPF+
Sbjct:  148 LTGFALWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVSSANYFGELVEWCGFALASW----SLQGVVFALFTLC------------ALFTRARQHHQWYLEKFEDYPKTRKILIPFL 254          
BLAST of Si:ch211-210c8.6 vs. UniProt/SwissProt
Match: sp|P24008|S5A1_RAT (3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Rattus norvegicus OX=10116 GN=Srd5a1 PE=1 SV=2)

HSP 1 Score: 51.6026 bits (122), Expect = 2.696e-6
Identity = 35/123 (28.46%), Postives = 60/123 (48.78%), Query Frame = 1
Query:  487 MIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFI 855
            + G+ ++L+G+ I + +D    N +       +    GL+++    NYFGE++ WCG  L+SW    SLQ    AL +   ++ LL +            HQW     +++Y K+   LIPF+
Sbjct:  152 LTGFALWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVSAANYFGELVEWCGFALASW----SLQGVVFALFT---LSTLLTRAK--------QHHQWYHE-KFEDYPKSRKILIPFV 258          
BLAST of Si:ch211-210c8.6 vs. TrEMBL
Match: A0A3B4F544 (Si:ch211-210c8.6 OS=Pundamilia nyererei OX=303518 PE=4 SV=1)

HSP 1 Score: 232.646 bits (592), Expect = 1.172e-71
Identity = 113/254 (44.49%), Postives = 162/254 (63.78%), Query Frame = 1
Query:   88 MSSIWNTLAMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
            M S+    A+ D GIQW G+ ++  F TE FYDL GS ++I +  L+  +  +    QK+Q GL   W +RLG +LF+RILK G D+RF +++ S    F+ W +Q +WV +TL PTL +  +  +VP+   + IGW I+ +G + E IAD+QKW FK +  N G++I +GLW + RHPNYFGEIL W G++LS+ S +   Q  S+  +SP+F+  LL   SGIP+LE+ A  +WGS   +QNY KNTP L P
Sbjct:   18 MGSVLAKCAITDLGIQWAGWALAAAFKTEKFYDLAGSGTFILLAHLSRIWGGASHTRQKVQTGLVTAWGLRLGTFLFMRILKDGHDRRFNNVRDSPGTFFVYWTVQAVWVFMTLLPTLMLNSEKRNVPLGTRDYIGWTIWGLGFATEAIADQQKWVFKRDPDNAGKFIQSGLWAYSRHPNYFGEILQWSGLWLSASSAMQGSQYLSV--VSPLFVWFLLRYVSGIPILEKQATRKWGSDPAFQNYVKNTPLLWP 269          
BLAST of Si:ch211-210c8.6 vs. TrEMBL
Match: A0A3Q4GKF3 (Si:ch211-210c8.6 OS=Neolamprologus brichardi OX=32507 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.082e-71
Identity = 114/254 (44.88%), Postives = 162/254 (63.78%), Query Frame = 1
Query:   88 MSSIWNTLAMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
            M SI    A+ D GIQW G+ ++  F TE FYDL GS ++I +  L+  +  +    QK+Q GL   W +RLG +LF+RILK G D+RF +++ S    F+ W +Q +WV +TL PTL +  +  +VP+   + IGW I+ +G + E IAD+QKW FK +  N G++I +GLW + RHPNYFGEIL W G++LS+ S +   Q  S+  +SP+F+  LL   SGIP+LE+ A  +WGS   +QNY KNTP L P
Sbjct:   18 MGSILAKCAITDLGIQWAGWALAAAFKTEKFYDLAGSGTFILLAHLSRIWGGASHTRQKVQTGLVTAWGLRLGTFLFMRILKDGHDRRFNNVRDSPGTFFVYWTVQAVWVFMTLLPTLMLNSEKQNVPLGTRDYIGWTIWGLGFATEAIADQQKWVFKRDPDNAGKFIQSGLWAYSRHPNYFGEILQWSGLWLSASSAMQGSQYLSV--VSPLFVWFLLRYVSGIPILEKQAMKKWGSDPAFQNYVKNTPLLWP 269          
BLAST of Si:ch211-210c8.6 vs. TrEMBL
Match: A0A3P8QYH4 (Si:ch211-210c8.6 OS=Astatotilapia calliptera OX=8154 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.531e-71
Identity = 113/254 (44.49%), Postives = 162/254 (63.78%), Query Frame = 1
Query:   88 MSSIWNTLAMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
            M S+    A+ D GIQW G+ ++  F TE FYDL GS ++I +  L+  +  +    QK+Q GL   W +RLG +LF+RILK G D+RF +++ S    F+ W +Q +WV +TL PTL +  +  +VP+   + IGW I+ +G + E IAD+QKW FK +  N G++I +GLW + RHPNYFGEIL W G++LS+ S +   Q  S+  +SP+F+  LL   SGIP+LE+ A  +WGS   +QNY KNTP L P
Sbjct:   18 MGSVLAKCAITDLGIQWAGWALAAAFKTEKFYDLAGSGTFILLAHLSRIWGGASHTRQKVQTGLVTAWGLRLGTFLFMRILKDGHDRRFNNVRDSPGTFFVYWTVQAVWVFMTLLPTLMLNSEKRNVPLGTRDYIGWTIWGLGFATEAIADQQKWVFKRDPDNAGKFIQSGLWAYSRHPNYFGEILQWSGLWLSASSAMQGSQYLSV--VSPLFVWFLLRYVSGIPILEKQAMRKWGSDPAFQNYVKNTPLLWP 269          
BLAST of Si:ch211-210c8.6 vs. TrEMBL
Match: A0A3P9DL40 (Si:ch211-210c8.6 OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.531e-71
Identity = 113/254 (44.49%), Postives = 162/254 (63.78%), Query Frame = 1
Query:   88 MSSIWNTLAMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
            M S+    A+ D GIQW G+ ++  F TE FYDL GS ++I +  L+  +  +    QK+Q GL   W +RLG +LF+RILK G D+RF +++ S    F+ W +Q +WV +TL PTL +  +  +VP+   + IGW I+ +G + E IAD+QKW FK +  N G++I +GLW + RHPNYFGEIL W G++LS+ S +   Q  S+  +SP+F+  LL   SGIP+LE+ A  +WGS   +QNY KNTP L P
Sbjct:   18 MGSVLAKCAITDLGIQWAGWALAAAFKTEKFYDLAGSGTFILLAHLSRIWGGASHTRQKVQTGLVTAWGLRLGTFLFMRILKDGHDRRFNNVRDSPGTFFVYWTVQAVWVFMTLLPTLMLNSEKRNVPLGTRDYIGWTIWGLGFATEAIADQQKWVFKRDPDNAGKFIQSGLWAYSRHPNYFGEILQWSGLWLSASSAMQGSQYLSV--VSPLFVWFLLRYVSGIPILEKQAMRKWGSDPAFQNYVKNTPLLWP 269          
BLAST of Si:ch211-210c8.6 vs. TrEMBL
Match: A0A3Q2WGM8 (Si:ch211-210c8.6 OS=Haplochromis burtoni OX=8153 PE=4 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 2.531e-71
Identity = 113/254 (44.49%), Postives = 162/254 (63.78%), Query Frame = 1
Query:   88 MSSIWNTLAMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
            M S+    A+ D GIQW G+ ++  F TE FYDL GS ++I +  L+  +  +    QK+Q GL   W +RLG +LF+RILK G D+RF +++ S    F+ W +Q +WV +TL PTL +  +  +VP+   + IGW I+ +G + E IAD+QKW FK +  N G++I +GLW + RHPNYFGEIL W G++LS+ S +   Q  S+  +SP+F+  LL   SGIP+LE+ A  +WGS   +QNY KNTP L P
Sbjct:   18 MGSVLAKCAITDLGIQWAGWALAAAFKTEKFYDLAGSGTFILLAHLSRIWGGASHTRQKVQTGLVTAWGLRLGTFLFMRILKDGHDRRFNNVRDSPGTFFVYWTVQAVWVFMTLLPTLMLNSEKRNVPLGTRDYIGWTIWGLGFATEAIADQQKWVFKRDPDNAGKFIQSGLWAYSRHPNYFGEILQWSGLWLSASSAMQGSQYLSV--VSPLFVWFLLRYVSGIPILEKQAMRKWGSDPAFQNYVKNTPLLWP 269          
BLAST of Si:ch211-210c8.6 vs. Ensembl Cavefish
Match: si:ch211-210c8.6 (uncharacterized LOC103047606 [Source:NCBI gene;Acc:103047606])

HSP 1 Score: 223.402 bits (568), Expect = 1.006e-71
Identity = 108/255 (42.35%), Postives = 158/255 (61.96%), Query Frame = 1
Query:   88 MSSIWNTLAMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPF 852
            M ++    A  D G+QWVG+ ++    TE FYDL GS ++I +  L+  +  +    Q +Q GL   W +RLG +LF+RILK G+D+RF +++ S    F+ W +Q +WV VTL PTL +  +    P+   +  GW I+ +G + E IAD+QKWNFK +  N G++I  GLW + RHPNY GEIL W G++LS+ S +   Q   ++ +SP+F+  LL   SGIP+LE+ A  +WG+   +QNY KNTP L PF
Sbjct:    1 MGAVLLKCAAADLGVQWVGWALAAALKTERFYDLAGSGTFILLAHLSRTWGRTRYLRQNVQTGLVTAWGLRLGTFLFLRILKEGQDRRFNNVRNSPGVFFVYWTVQAVWVFVTLLPTLILNTEQRDKPLGPRDYAGWAIWGLGFATEAIADQQKWNFKNDPDNAGKFIQNGLWAYSRHPNYLGEILQWSGLFLSASSVMQGPQ--YLSALSPLFVWFLLRHVSGIPILEKQAMRKWGADPAFQNYVKNTPQLWPF 253          
BLAST of Si:ch211-210c8.6 vs. Ensembl Cavefish
Match: srd5a2b (3-oxo-5-alpha-steroid 4-dehydrogenase 2-like [Source:NCBI gene;Acc:103043083])

HSP 1 Score: 51.9878 bits (123), Expect = 2.352e-7
Identity = 34/125 (27.20%), Postives = 58/125 (46.40%), Query Frame = 1
Query:  484 NMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFIW 858
             +IG LIF  G++I + +D    N +       +    GL+++    N+FGEI+ W G  +++W    SL   S A  +  FI              RA  H    +  ++++ ++  CLIPFI+
Sbjct:  144 TLIGLLIFFTGMAINIHSDHILRNLRKPGEISYKIPRGGLFEYVSGANFFGEIVEWSGYAIATW----SLPTFSFAFFTMSFIG------------PRAYHHHRFYKETFKDFPRSQKCLIPFIF 252          
BLAST of Si:ch211-210c8.6 vs. Ensembl Sea Lamprey
Match: si:ch211-210c8.6 (si:ch211-210c8.6 [Source:ZFIN;Acc:ZDB-GENE-030131-3630])

HSP 1 Score: 177.948 bits (450), Expect = 5.912e-55
Identity = 86/224 (38.39%), Postives = 142/224 (63.39%), Query Frame = 1
Query:  112 AMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAA 783
            A  D G+QW    ++    TE+F+D  GS +++ +  L+  + ++    Q+IQ GL ++W +RLG YLF+RIL+ G+D RF  ++      F+ W LQ +WV VTL PTL + +K    P+   + +GW ++++G ++E++AD QK  F+++  N G++I +GLW + RHPNY GEIL W G+++S+ S ++  +  S A  SP+ + +LL   SG+P+LER A
Sbjct:    8 AGVDLGVQWALGLVAIALRTEVFFDAAGSGTFLLLTYLSRKWSSTKFLRQQIQSGLVSVWGLRLGMYLFLRILREGKDSRFDKVRDKPSIFFMFWTLQAVWVFVTLLPTLIVNMKKQDSPLTLRDYLGWAVWVLGFTVEMLADHQKSIFRSDPNNVGKFIQSGLWAYSRHPNYVGEILQWLGLFVSASSVLSGWEWLSAA--SPLLVWLLLSHVSGVPILERQA 229          
BLAST of Si:ch211-210c8.6 vs. Ensembl Nematostella
Match: EDO44484 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVP1])

HSP 1 Score: 205.682 bits (522), Expect = 3.074e-65
Identity = 107/251 (42.63%), Postives = 155/251 (61.75%), Query Frame = 1
Query:  106 TLAMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFIW 858
            T A FDFGIQWV +  +  F TE FYDL GS +YI +   T       +  Q +Q G    W +RLG++LF R+L+ G D RF  ++ +    FI W++QG+WV +TL PTL +  K     +   + +GW ++  G  +E +AD QK  FKAN ++KG++I TG+W  CRHPNY GEI+LW G+++S+ S +  ++  S+  ISP+F+  LL K SGIP+ +R A  +WG    YQ Y++ T  LIP+IW
Sbjct:    6 TAAGFDFGIQWVLWAFASAFRTEKFYDLAGSATYIFLAWQTLLSSGKFNFRQLVQTGCVTAWGLRLGSFLFARVLRDGRDSRFDKVRDNPKVFFIYWSIQGVWVFITLLPTLLLNTKREDPELGWKDYLGWGLWSAGFLLEALADHQKSVFKANPSSKGKWISTGVWSLCRHPNYLGEIVLWTGLFMSASSVMKGVEYGSV--ISPIFVTFLLTKVSGIPIQDRQALKRWGDVAAYQEYRRKTAMLIPYIW 254          
BLAST of Si:ch211-210c8.6 vs. Ensembl Nematostella
Match: EDO46489 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ30])

HSP 1 Score: 138.658 bits (348), Expect = 1.055e-38
Identity = 74/219 (33.79%), Postives = 116/219 (52.97%), Query Frame = 1
Query:  184 DLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTL--KMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNT 834
            D  G  +++ +  LT     + +  Q +      IW +RL  YL  RI+K GEDKRF   +++       W  Q +WV     P +     L    V +   + +G  IF IGL +E +AD+ K+NF+ N  NKG++   G W   RHPNYFGE+  W G+++ S S +  +     A++ P+F+  +L+  SGIPLLE+ AD ++G+   Y+ Y+  T
Sbjct:   41 DFAGGTNFVVLAILTFCLAQTYADRQIMVTVCVTIWGLRLSGYLLYRIIKIGEDKRFDDKRENCLAFAGFWVFQAVWVFTVSLPVMMVNAPLSKNLVTLGAADYVGVAIFAIGLLLEAVADQLKFNFRNNPANKGKWCTVGPWSWSRHPNYFGEMCCWWGIFIISCSIL--IGGEWAAVLGPIFLMAILLFLSGIPLLEKKADERYGNLDTYREYRIRT 257          
BLAST of Si:ch211-210c8.6 vs. Ensembl Medaka
Match: si:ch211-210c8.6 (uncharacterized LOC101156655 [Source:NCBI gene;Acc:101156655])

HSP 1 Score: 226.483 bits (576), Expect = 1.087e-72
Identity = 110/244 (45.08%), Postives = 157/244 (64.34%), Query Frame = 1
Query:  112 AMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCL 843
            A+ D GIQW G+ +S  F TE FYDL GS ++I +  L+  +  +    QK+Q GL   W +RLG +LF+RILK G D+RF +++ S    F+ W +Q +WV +TL PTL +  +  +VP+   + IGW ++ +G + E IAD+QKW FK +  N G++I +GLW + RHPNYFGEIL W G++LS+ S +   Q  S+  +SP+F+  LL   SGIPLLE+ A  +WGS   +Q Y KNTP L
Sbjct:   26 AVTDLGIQWAGWALSAAFRTEKFYDLAGSGTFILLAHLSRIWGGATQTRQKVQTGLVTAWGLRLGTFLFLRILKDGHDRRFNNVRDSPGTFFVYWTVQAMWVFMTLLPTLMLNSEKRNVPLGTRDYIGWTVWGLGFATEAIADQQKWFFKRDPDNAGKFIQSGLWAYSRHPNYFGEILQWSGLWLSASSVMKGPQYLSV--VSPLFVWFLLNHVSGIPLLEKQAMKKWGSDPAFQEYVKNTPVL 267          
BLAST of Si:ch211-210c8.6 vs. Planmine SMEST
Match: SMESG000081275.1 (SMESG000081275.1)

HSP 1 Score: 501.516 bits (1290), Expect = 0.000e+0
Identity = 246/248 (99.19%), Postives = 247/248 (99.60%), Query Frame = 1
Query:  115 MFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFIW 858
            MFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNY GEILLWCGMYLSSWSHITSLQERSIALISPVF+AILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFIW
Sbjct:    1 MFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYLGEILLWCGMYLSSWSHITSLQERSIALISPVFVAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFIW 248          
BLAST of Si:ch211-210c8.6 vs. Planmine SMEST
Match: SMESG000004302.1 (SMESG000004302.1)

HSP 1 Score: 136.346 bits (342), Expect = 2.561e-37
Identity = 74/230 (32.17%), Postives = 122/230 (53.04%), Query Frame = 1
Query:  184 DLTGSLSYITVLALTTAYKNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLFIVWNLQGIWVLVTLYPTL--------KMVLKSTHVPIKCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIP 849
            D++G  S+I++  L+     +    Q I      +WA RL  YL  R++K GE  RF   +K++    I W  Q IW+ + + P            ++      I   +++G+++F++GL +E IAD QK+ +  +  N+G++ + GLW   RHPNYFGEIL+W G+Y    S       R I ++ P+F+  +L+  SG+P++E  +D ++G    Y  YK NT  L P
Sbjct:   49 DISGGFSFISLAILSFVLSQAFLIRQLIVTVFVCMWAARLSTYLLYRMMKIGEYDRFVEKRKNLLYFVIFWIFQFIWIQMVILPVACINSPAASNSIVDDLTKTITNWDILGFVLFIVGLLLETIADAQKFVYLDDSNNRGKWCNYGLWNLSRHPNYFGEILVWWGIYFIGVS--IDYNARWITILGPLFLTGILLFLSGLPIMEHKSDRKYGGNPQYVEYKTNTSPLFP 276          
BLAST of Si:ch211-210c8.6 vs. Planmine SMEST
Match: SMESG000078577.1 (SMESG000078577.1)

HSP 1 Score: 47.3654 bits (111), Expect = 3.422e-6
Identity = 39/129 (30.23%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  475 KCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEY-IHTG-LWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFI 855
            + +N+IG L F IG+ I + +D Q  N +   T+   Y I  G L+++    NYFGEI+ W    L+    + SL   + A+ + VF            LL R+  H     + ++ Y +N   +IPFI
Sbjct:   92 EFLNIIGILGFFIGMFINITSDYQLRNLRKCSTDSQRYKIPKGFLFEYVSCANYFGEIVEWLSYALA----MQSLASIAFAMFT-VF-----------NLLPRSISHHRWYVVKFEKYPRNRKAIIPFI 204          
BLAST of Si:ch211-210c8.6 vs. Planmine SMEST
Match: SMESG000078577.1 (SMESG000078577.1)

HSP 1 Score: 47.3654 bits (111), Expect = 5.478e-6
Identity = 39/127 (30.71%), Postives = 61/127 (48.03%), Query Frame = 1
Query:  481 INMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEY-IHTG-LWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFI 855
            +N+IG L F IG+ I + +D Q  N +   T+   Y I  G L+++    NYFGEI+ W    L+    + SL   + A+ + VF            LL R+  H     + ++ Y +N   +IPFI
Sbjct:  124 LNIIGILGFFIGMFINITSDYQLRNLRKCSTDSQRYKIPKGFLFEYVSCANYFGEIVEWLSYALA----MQSLASIAFAMFT-VF-----------NLLPRSISHHRWYVVKFEKYPRNRKAIIPFI 234          
BLAST of Si:ch211-210c8.6 vs. Planmine SMEST
Match: SMESG000078577.1 (SMESG000078577.1)

HSP 1 Score: 46.9802 bits (110), Expect = 5.847e-6
Identity = 39/129 (30.23%), Postives = 62/129 (48.06%), Query Frame = 1
Query:  475 KCINMIGWLIFLIGLSIEVIADKQKWNFKANITNKGEY-IHTG-LWKHCRHPNYFGEILLWCGMYLSSWSHITSLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTPCLIPFI 855
            + +N+IG L F IG+ I + +D Q  N +   T+   Y I  G L+++    NYFGEI+ W    L+    + SL   + A+ + VF            LL R+  H     + ++ Y +N   +IPFI
Sbjct:  126 EFLNIIGILGFFIGMFINITSDYQLRNLRKCSTDSQRYKIPKGFLFEYVSCANYFGEIVEWLSYALA----MQSLASIAFAMFT-VF-----------NLLPRSISHHRWYVVKFEKYPRNRKAIIPFI 238          
The following BLAST results are available for this feature:
BLAST of Si:ch211-210c8.6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG62825.639e-4131.62gene:FBgn0035914 transcript:FBtr0076637[more]
CG62825.639e-4131.62gene:FBgn0035914 transcript:FBtr0076636[more]
CG62825.639e-4131.62gene:FBgn0035914 transcript:FBtr0300194[more]
CG62823.176e-3931.75gene:FBgn0035914 transcript:FBtr0330165[more]
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-210c8.61.369e-7244.71si:ch211-210c8.6 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000007073.14.047e-6843.39uncharacterized loc100145110 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Srd5a13.027e-627.64steroid 5 alpha-reductase 1 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Si:ch211-210c8.6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|P24008|S5A1_RAT2.696e-628.463-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Rattus ... [more]
back to top
BLAST of Si:ch211-210c8.6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4F5441.172e-7144.49Si:ch211-210c8.6 OS=Pundamilia nyererei OX=303518 ... [more]
A0A3Q4GKF32.082e-7144.88Si:ch211-210c8.6 OS=Neolamprologus brichardi OX=32... [more]
A0A3P8QYH42.531e-7144.49Si:ch211-210c8.6 OS=Astatotilapia calliptera OX=81... [more]
A0A3P9DL402.531e-7144.49Si:ch211-210c8.6 OS=Maylandia zebra OX=106582 PE=4... [more]
A0A3Q2WGM82.531e-7144.49Si:ch211-210c8.6 OS=Haplochromis burtoni OX=8153 P... [more]
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-210c8.61.006e-7142.35uncharacterized LOC103047606 [Source:NCBI gene;Acc... [more]
srd5a2b2.352e-727.203-oxo-5-alpha-steroid 4-dehydrogenase 2-like [Sour... [more]
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-210c8.65.912e-5538.39si:ch211-210c8.6 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO444843.074e-6542.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464891.055e-3833.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:ch211-210c8.6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-210c8.61.087e-7245.08uncharacterized LOC101156655 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Si:ch211-210c8.6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081275.10.000e+099.19SMESG000081275.1[more]
SMESG000004302.12.561e-3732.17SMESG000004302.1[more]
SMESG000078577.13.422e-630.23SMESG000078577.1[more]
SMESG000078577.15.478e-630.71SMESG000078577.1[more]
SMESG000078577.15.847e-630.23SMESG000078577.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026185 ID=SMED30026185|Name=Si:ch211-210c8.6|organism=Schmidtea mediterranea sexual|type=transcript|length=972bp
TAAAATTGAATTTTTAAAATTTATTATAATTTAAAAAATCATTTATTTGA
AAACCATTATTAATAATTACTAATATTATATTTTAAAATGTCTTCGATTT
GGAATACATTAGCGATGTTTGATTTTGGAATTCAGTGGGTTGGATTTGGG
ATTTCTTATTTATTTGGAACTGAATTATTTTACGATCTTACTGGATCTTT
AAGCTATATTACTGTCTTAGCATTAACGACAGCTTATAAAAATTCATTAT
CTCAAAGTCAAAAAATTCAAATAGGTCTTACTGCAATTTGGGCAATTAGG
TTGGGAGCTTATCTATTTATTCGGATTTTAAAAACCGGCGAAGACAAAAG
ATTTCGATCTATAAAAAAAAGCATCTGGAGATTATTTATTGTTTGGAATT
TACAAGGAATATGGGTTTTAGTGACTTTATATCCTACTTTGAAAATGGTT
CTTAAATCAACGCATGTCCCGATTAAATGTATTAACATGATTGGTTGGTT
GATATTTCTAATTGGATTGTCTATTGAAGTTATTGCTGACAAACAGAAAT
GGAATTTCAAAGCAAATATTACAAATAAAGGAGAATATATACACACAGGA
TTATGGAAACATTGTCGCCATCCAAATTATTTTGGAGAAATATTATTATG
GTGTGGAATGTATTTAAGTTCTTGGTCCCACATAACATCATTGCAAGAGA
GATCAATTGCTTTAATTAGTCCAGTTTTTATTGCTATTCTACTAATTAAA
GGAAGTGGAATTCCTCTATTGGAAAGAGCTGCTGATCACCAATGGGGATC
AAGATTAGATTATCAAAATTATAAAAAAAATACTCCCTGTCTGATTCCTT
TTATATGGTGATTTCAAATTTGAACTTTTTAGTAGTTTAAATCAAATACA
CAAAATCGAAAAGTTTTGTAAAATTATATTTCGTTTATACATGCTAAAAA
TAGACTAAACATTTACCATATT
back to top

protein sequence of SMED30026185-orf-1

>SMED30026185-orf-1 ID=SMED30026185-orf-1|Name=SMED30026185-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=258bp
MSSIWNTLAMFDFGIQWVGFGISYLFGTELFYDLTGSLSYITVLALTTAY
KNSLSQSQKIQIGLTAIWAIRLGAYLFIRILKTGEDKRFRSIKKSIWRLF
IVWNLQGIWVLVTLYPTLKMVLKSTHVPIKCINMIGWLIFLIGLSIEVIA
DKQKWNFKANITNKGEYIHTGLWKHCRHPNYFGEILLWCGMYLSSWSHIT
SLQERSIALISPVFIAILLIKGSGIPLLERAADHQWGSRLDYQNYKKNTP
CLIPFIW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR010721DUF1295
IPR0011043-oxo-5_a-steroid_4-DH_C
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016021integral component of membrane
GO:0031090organelle membrane
GO:0043025neuronal cell body
GO:0043209myelin sheath
GO:0043231intracellular membrane-bounded organelle
GO:0048471perinuclear region of cytoplasm
GO:0070852cell body fiber
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0021987cerebral cortex development
GO:0030154cell differentiation
GO:0030539male genitalia development
GO:0030540female genitalia development
GO:0032354response to follicle-stimulating hormone
GO:0032355response to estradiol
GO:0032869cellular response to insulin stimulus
GO:0033574response to testosterone
GO:0042428serotonin metabolic process
GO:0042448progesterone metabolic process
GO:0042493response to drug
GO:0042747circadian sleep/wake cycle, REM sleep
GO:0043627response to estrogen
GO:0046661male sex differentiation
GO:0055114oxidation-reduction process
GO:0060348bone development
GO:0060416response to growth hormone
GO:0060992response to fungicide
GO:0071320cellular response to cAMP
GO:0071363cellular response to growth factor stimulus
GO:0071392cellular response to estradiol stimulus
GO:0071394cellular response to testosterone stimulus
GO:0071407cellular response to organic cyclic compound
GO:0071549cellular response to dexamethasone stimulus
GO:0071872cellular response to epinephrine stimulus
GO:0001655urogenital system development
GO:0001889liver development
GO:0006694steroid biosynthetic process
GO:0006702androgen biosynthetic process
GO:0007548sex differentiation
GO:0008202steroid metabolic process
GO:0008209androgen metabolic process
GO:0008584male gonad development
GO:0009267cellular response to starvation
GO:0014070response to organic cyclic compound
GO:0014850response to muscle activity
GO:0016101diterpenoid metabolic process
GO:0021510spinal cord development
GO:0021766hippocampus development
GO:0021794thalamus development
GO:0021854hypothalamus development
GO:0021983pituitary gland development
Vocabulary: molecular function
TermDefinition
GO:0016627oxidoreductase activity, acting on the CH-CH group of donors
GO:0033218amide binding
GO:0047751cholestenone 5-alpha-reductase activity
GO:0070402NADPH binding
GO:00038653-oxo-5-alpha-steroid 4-dehydrogenase activity
GO:0016491oxidoreductase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010721Protein of unknown function DUF1295PFAMPF06966DUF1295coord: 20..249
e-value: 7.2E-58
score: 195.9
IPR010721Protein of unknown function DUF1295PANTHERPTHR32251FAMILY NOT NAMEDcoord: 6..256
NoneNo IPR availableGENE3DG3DSA:1.20.120.1630coord: 63..256
e-value: 2.3E-13
score: 52.5
NoneNo IPR availablePANTHERPTHR32251:SF17SI:CH211-210C8.6coord: 6..256
NoneNo IPR availableTMHMMTMhelixcoord: 133..150
NoneNo IPR availableTMHMMTMhelixcoord: 206..228
NoneNo IPR availableTMHMMTMhelixcoord: 60..78
NoneNo IPR availableTMHMMTMhelixcoord: 99..118
NoneNo IPR availableTMHMMTMhelixcoord: 13..32
IPR0011043-oxo-5-alpha-steroid 4-dehydrogenase, C-terminalPROSITEPS50244S5A_REDUCTASEcoord: 136..197
score: 10.853