Sodium/potassium-transporting ATPase subunit beta-2

Overview
NameSodium/potassium-transporting ATPase subunit beta-2
Smed IDSMED30026182
Length (bp)1930
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium/potassium-transporting ATPase subunit beta-2 (SMED30026182) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit beta-2 (SMED30026182) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium/potassium-transporting ATPase subunit beta-2 (SMED30026182) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium/potassium-transporting ATPase subunit beta-2 (SMED30026182) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026182

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026182SMESG000071416.1 SmedASXL_008396SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30026182SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026182SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30026182SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30026182SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026182SMESG000071416.1 dd_Smed_v6_7917_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30026182SMESG000071416.1 SMED30026182smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30026182SMESG000071416.1 OX_Smed_1.0.01702ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 138.658 bits (348), Expect = 5.900e-36
Identity = 94/272 (34.56%), Postives = 138/272 (50.74%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN---------VDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSS----PTIK---------CFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            +NS  K FLGRT  SW KI +FY I+Y  L   F+  + V L  L  ++  + T Q  +    PGL    +P    T I F  N+P+SY++Y +++  FL  Y+D   +DD  F  C      P             K+CRF L  L +C+  N+  +GY +G PC++IK+N++ G+ P    N S    P +K         C G+   DKD +G ++YF   GNS     F   +YPY G   QP YL P++AVQF  L  +T + ++C+
Sbjct:   17 WNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVML--LTISEF-KPTYQDRVAP--PGLTQ--IPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYF-GLGNSPG---FPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECK 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 138.658 bits (348), Expect = 5.900e-36
Identity = 94/272 (34.56%), Postives = 138/272 (50.74%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN---------VDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSS----PTIK---------CFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            +NS  K FLGRT  SW KI +FY I+Y  L   F+  + V L  L  ++  + T Q  +    PGL    +P    T I F  N+P+SY++Y +++  FL  Y+D   +DD  F  C      P             K+CRF L  L +C+  N+  +GY +G PC++IK+N++ G+ P    N S    P +K         C G+   DKD +G ++YF   GNS     F   +YPY G   QP YL P++AVQF  L  +T + ++C+
Sbjct:   17 WNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVML--LTISEF-KPTYQDRVAP--PGLTQ--IPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYF-GLGNSPG---FPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECK 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B3 (ATPase Na+/K+ transporting subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:806])

HSP 1 Score: 131.339 bits (329), Expect = 1.295e-33
Identity = 100/287 (34.84%), Postives = 144/287 (50.17%), Query Frame = 3
Query:   99 KPSRCQSFIEG---FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN----MTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNT--LVMVKCQF---MNMKFESDLLKF 908
            K S  QS  E     YN  +  FLGRT  SW  I +FY ++Y  L A F   M V L+ L  +++P+   Q       PGL + P P  T     F+ ++P SY  Y  D++ FL PY    L++ KN  +C        K P  V   C+F +++L+ C+  N+  FGYS+GNPC+L+KMN+I G  P+      P I C  +N    ++I  +  +P+N      G  D  ++PY G+    GYL P+VAVQ      NT   V V+C+     N+K + D  KF
Sbjct:    6 KKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTL-NDEVPKYRDQIP----SPGLMVFPKP-VTALEYTFSRSDPTSYAGYIEDLKKFLKPYT---LEEQKNLTVCPDGALFEQKGPVYV--ACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGV----PRIDCVSKN----EDIPNVAVYPHN------GMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKF 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B2 (ATPase Na+/K+ transporting subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:805])

HSP 1 Score: 124.02 bits (310), Expect = 6.940e-31
Identity = 83/282 (29.43%), Postives = 134/282 (47.52%), Query Frame = 3
Query:   84 EKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN-----VDKICRFNLTMLEDCN---KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD 896
            EK  C     + + E  +N R+  F+GRT +SW  I +FY ++Y  LTA F   M V L+  V +  P+   + +     PGL +RP  ++   ++   +++ +S+  +   +  FL PY D       +        + PDN       + C+FN T L +C+      ++GYS G PCV IKMN++  +      N S  + C G+   D +N+G    FP NGN       D  ++PY G+     Y  P+VAV+F+ +  N  V V+C+       +D
Sbjct:    6 EKKSCG-QVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQ-TVSDHTPKYQDRLAT----PGLMIRPKTENLDVIVN--VSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGA--NQSMNVTCAGKRDEDAENLGNFVMFPANGN------IDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATD 271          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 108.997 bits (271), Expect = 3.276e-25
Identity = 83/276 (30.07%), Postives = 134/276 (48.55%), Query Frame = 3
Query:  105 SRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFF-MSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN----MTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLL 902
             + Q   E  ++   + FL RT  SW  I + YF +Y SL A   + M  +FL   +   IP  T +       PG+ +RP   H+     F ++EP +++ Y + +  FL  Y D  L+++ N         +     D   K C+F  + L++C+  +   FGYS G PC+L+KMN+I G+ P+  D     + C  Q   D+++I  I Y+P + +      FD  +YPY G+     Y SP+VA+ F  + KN  V V+CQ       +D++
Sbjct:   84 QKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFYASLAAVITLCMYTLFLT--ISPYIPTFTERVK----PPGVMIRPFA-HSLNF-NFNVSEPDTWQHYVISLNGFLQGYND-SLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVK--VSCKVQRG-DENDIRSISYYPESAS------FDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVI 341          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 172.94 bits (437), Expect = 1.506e-48
Identity = 97/295 (32.88%), Postives = 168/295 (56.95%), Query Frame = 3
Query:  114 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 923
            ++F E  YN ++ T +GRT  SW +I +FY I+Y  L AF+++ + +F++ L    +PR  G+ +++ + PG+G +P     PD  +TLI++ + + +SYK+Y   M+T+LT Y D    + +     +    +  N D + CRF+L++ +  C++K++FGY  G PCV+I +N++ GW P D  +NS P             I C G   +D+++IG++ Y P+NG        D  +YPY+   GY  PI  V+F T+ +N LV+V+C+   +  E D      ++ FE++V+
Sbjct:   27 ETFREFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKERPD--STLIKYNLRDQKSYKAYLEQMKTYLTKY-DSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNG-------IDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 172.94 bits (437), Expect = 1.506e-48
Identity = 97/295 (32.88%), Postives = 168/295 (56.95%), Query Frame = 3
Query:  114 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 923
            ++F E  YN ++ T +GRT  SW +I +FY I+Y  L AF+++ + +F++ L    +PR  G+ +++ + PG+G +P     PD  +TLI++ + + +SYK+Y   M+T+LT Y D    + +     +    +  N D + CRF+L++ +  C++K++FGY  G PCV+I +N++ GW P D  +NS P             I C G   +D+++IG++ Y P+NG        D  +YPY+   GY  PI  V+F T+ +N LV+V+C+   +  E D      ++ FE++V+
Sbjct:   27 ETFREFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKERPD--STLIKYNLRDQKSYKAYLEQMKTYLTKY-DSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNG-------IDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 172.94 bits (437), Expect = 1.506e-48
Identity = 97/295 (32.88%), Postives = 168/295 (56.95%), Query Frame = 3
Query:  114 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 923
            ++F E  YN ++ T +GRT  SW +I +FY I+Y  L AF+++ + +F++ L    +PR  G+ +++ + PG+G +P     PD  +TLI++ + + +SYK+Y   M+T+LT Y D    + +     +    +  N D + CRF+L++ +  C++K++FGY  G PCV+I +N++ GW P D  +NS P             I C G   +D+++IG++ Y P+NG        D  +YPY+   GY  PI  V+F T+ +N LV+V+C+   +  E D      ++ FE++V+
Sbjct:   27 ETFREFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKERPD--STLIKYNLRDQKSYKAYLEQMKTYLTKY-DSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNG-------IDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 160.614 bits (405), Expect = 3.412e-44
Identity = 95/300 (31.67%), Postives = 155/300 (51.67%), Query Frame = 3
Query:  114 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYL-----KDDKNFAICNMTSKVPDNVDKICRFNLTMLE--DCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP-------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 923
            ++F +  YN    T LGRT +SWC+I +FY I+Y  L+AFF+  + +FL  L    +PR  G+ +++ + PG+G +P     PD  +TLI+F + + +S++ Y   +  +L+ Y++          D N A+   T   P      CRF+L + E  +C  K+ +GY  G PCV + +N++ GW P   D+ S              TI C G    DK+++G+++Y P  G        D  +YPY+  P Y  PI  V+F T+ +N LV+V+C+      E D      ++ FE+ V+
Sbjct:   10 ETFAQFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLRTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKENPD--STLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFP------CRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG-------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMVYFELFVE 293          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 160.999 bits (406), Expect = 3.605e-44
Identity = 95/300 (31.67%), Postives = 155/300 (51.67%), Query Frame = 3
Query:  114 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYL-----KDDKNFAICNMTSKVPDNVDKICRFNLTMLE--DCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP-------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 923
            ++F +  YN    T LGRT +SWC+I +FY I+Y  L+AFF+  + +FL  L    +PR  G+ +++ + PG+G +P     PD  +TLI+F + + +S++ Y   +  +L+ Y++          D N A+   T   P      CRF+L + E  +C  K+ +GY  G PCV + +N++ GW P   D+ S              TI C G    DK+++G+++Y P  G        D  +YPY+  P Y  PI  V+F T+ +N LV+V+C+      E D      ++ FE+ V+
Sbjct:   24 ETFAQFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLRTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKENPD--STLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFP------CRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG-------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMVYFELFVE 307          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079382)

HSP 1 Score: 154.836 bits (390), Expect = 8.887e-42
Identity = 100/321 (31.15%), Postives = 149/321 (46.42%), Query Frame = 3
Query:   72 DEDIEKY-ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLP---DHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPD---------------------TTDNSSPT------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDL------LKFEILVD 923
            DED+    + KP +   F+   YN+   T +GR +SSW KIGIFY  +Y  L A     M  F + L    IP+ T   SL+   PGLG RPLP   +  +TLI +   + ++YK +   +  FL  Y+   L   +   I N     P    ++C  ++     C K+NN+ Y K  PC+ +K+NKI+GWIP+                       + + P       + C G+N  D++NIG + Y P  G       F   FYPY    GYLSP+VAV F   K+  ++ V+C+        D       + +E+L+D
Sbjct:   13 DEDLHNLRKPKPFKLGQFL---YNTEDGTVMGRDRSSWAKIGIFYVAFYGVLAALVAICMWAFFQTL-DPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRG-------FPGYFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 322          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079383)

HSP 1 Score: 154.836 bits (390), Expect = 8.887e-42
Identity = 100/321 (31.15%), Postives = 149/321 (46.42%), Query Frame = 3
Query:   72 DEDIEKY-ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLP---DHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPD---------------------TTDNSSPT------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDL------LKFEILVD 923
            DED+    + KP +   F+   YN+   T +GR +SSW KIGIFY  +Y  L A     M  F + L    IP+ T   SL+   PGLG RPLP   +  +TLI +   + ++YK +   +  FL  Y+   L   +   I N     P    ++C  ++     C K+NN+ Y K  PC+ +K+NKI+GWIP+                       + + P       + C G+N  D++NIG + Y P  G       F   FYPY    GYLSP+VAV F   K+  ++ V+C+        D       + +E+L+D
Sbjct:   13 DEDLHNLRKPKPFKLGQFL---YNTEDGTVMGRDRSSWAKIGIFYVAFYGVLAALVAICMWAFFQTL-DPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRG-------FPGYFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 322          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0100381)

HSP 1 Score: 154.836 bits (390), Expect = 8.887e-42
Identity = 100/321 (31.15%), Postives = 149/321 (46.42%), Query Frame = 3
Query:   72 DEDIEKY-ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLP---DHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPD---------------------TTDNSSPT------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDL------LKFEILVD 923
            DED+    + KP +   F+   YN+   T +GR +SSW KIGIFY  +Y  L A     M  F + L    IP+ T   SL+   PGLG RPLP   +  +TLI +   + ++YK +   +  FL  Y+   L   +   I N     P    ++C  ++     C K+NN+ Y K  PC+ +K+NKI+GWIP+                       + + P       + C G+N  D++NIG + Y P  G       F   FYPY    GYLSP+VAV F   K+  ++ V+C+        D       + +E+L+D
Sbjct:   13 DEDLHNLRKPKPFKLGQFL---YNTEDGTVMGRDRSSWAKIGIFYVAFYGVLAALVAICMWAFFQTL-DPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRG-------FPGYFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 322          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv1 (gene:FBgn0015776 transcript:FBtr0332370)

HSP 1 Score: 150.984 bits (380), Expect = 1.206e-40
Identity = 99/306 (32.35%), Postives = 151/306 (49.35%), Query Frame = 3
Query:   99 KPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTT--TLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD--------------NSSPT-------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFM--NMKFESDL------LKFEILVD 923
            +P++ Q+F E  YN +  TF GRT  SW ++ +FY I+Y  L A F   M   L   + +  P+   Q SL+   PGLG RPL + T   ++I F   +P     +   +  FL  Y     +D K+        +V +  D +C  N  +   C+K NN+GY    PC+ +K+NKIFGWIP+  D              N + T       + C G    DK+N   I+YFP+ G       F   +YP++ QPGYLSP+VAVQF +  K  ++ V+C+    N+++   +      + F+IL+D
Sbjct:   17 QPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLS-TISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGF----GQVLEPTD-VCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG-------FPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILLD 309          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv1 (gene:FBgn0015776 transcript:FBtr0079384)

HSP 1 Score: 150.984 bits (380), Expect = 1.206e-40
Identity = 99/306 (32.35%), Postives = 151/306 (49.35%), Query Frame = 3
Query:   99 KPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTT--TLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD--------------NSSPT-------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFM--NMKFESDL------LKFEILVD 923
            +P++ Q+F E  YN +  TF GRT  SW ++ +FY I+Y  L A F   M   L   + +  P+   Q SL+   PGLG RPL + T   ++I F   +P     +   +  FL  Y     +D K+        +V +  D +C  N  +   C+K NN+GY    PC+ +K+NKIFGWIP+  D              N + T       + C G    DK+N   I+YFP+ G       F   +YP++ QPGYLSP+VAVQF +  K  ++ V+C+    N+++   +      + F+IL+D
Sbjct:   17 QPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLS-TISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGF----GQVLEPTD-VCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG-------FPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILLD 309          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b2a (ATPase Na+/K+ transporting subunit beta 2a [Source:ZFIN;Acc:ZDB-GENE-001127-2])

HSP 1 Score: 133.65 bits (335), Expect = 1.628e-34
Identity = 96/270 (35.56%), Postives = 136/270 (50.37%), Query Frame = 3
Query:   93 ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPY---EDIYLKDD---KNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            E +     S+ + F+N R+   LGRT SSW  I +FY ++Y  L   F   M V L  L   D  + T Q  L    PG+ +RP  +     I ++    +S++ Y   + +FL PY   +     DD     F I   +  V +N  + CRFN T LEDC+   +  +GY  G PC+LIK+N++ G  P   D  SP + C G    D ++IGEI YFP NG       F+  +YPY G   Q  Y  P+VAV+FM +  NT V V+C+
Sbjct:    4 EDEKKESGSWKDFFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGVFCLTMYVMLLTL---DDYQPTWQDRLAT--PGMMIRPKGEALE--IVYSRENTESWELYVQALDSFLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKPCILIKLNRVIGMKPG-KDGQSPYVTC-GAKKEDAESIGEIAYFPPNGT------FNLMYYPYYGMKAQVNYSQPLVAVKFMNISFNTDVNVECK 258          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 120.939 bits (302), Expect = 5.079e-30
Identity = 83/268 (30.97%), Postives = 132/268 (49.25%), Query Frame = 3
Query:  126 EGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKN-------FAICNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLI--------DKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            E F+N R++ F GRT SSW  I +FY  +Y  L   F   M V L+ L   D  R T Q  L    PG+ +RP  +     I +     ++++ Y   +  FL+PY D  ++  KN       F I   +  + +   + C+F  ++LE C+   +  +GY +G PC++IK+N++ G +P   D   P + C  +           D D +GE+ Y+P NG       F+  +YPY G   Q  Y  P+VAV+F+ + +N  V V+C+
Sbjct:   11 EFFWNPRTREFCGRTASSWGLILLFYLAFYIFLAGLFTLTMYVMLQTL---DDHRPTYQDRLST--PGMMIRPKGEQLE--IAYTTEYTETWERYVQALNNFLSPYNDT-VQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLP-AKDGQPPYVTCGAKKYKVGKDEWTDDSDKLGELAYYPPNGT------FNLMYYPYYGKKAQVNYSQPLVAVKFLNITRNEDVNVECK 263          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 120.939 bits (302), Expect = 5.079e-30
Identity = 83/268 (30.97%), Postives = 132/268 (49.25%), Query Frame = 3
Query:  126 EGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKN-------FAICNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLI--------DKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            E F+N R++ F GRT SSW  I +FY  +Y  L   F   M V L+ L   D  R T Q  L    PG+ +RP  +     I +     ++++ Y   +  FL+PY D  ++  KN       F I   +  + +   + C+F  ++LE C+   +  +GY +G PC++IK+N++ G +P   D   P + C  +           D D +GE+ Y+P NG       F+  +YPY G   Q  Y  P+VAV+F+ + +N  V V+C+
Sbjct:   11 EFFWNPRTREFCGRTASSWGLILLFYLAFYIFLAGLFTLTMYVMLQTL---DDHRPTYQDRLST--PGMMIRPKGEQLE--IAYTTEYTETWERYVQALNNFLSPYNDT-VQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLP-AKDGQPPYVTCGAKKYKVGKDEWTDDSDKLGELAYYPPNGT------FNLMYYPYYGKKAQVNYSQPLVAVKFLNITRNEDVNVECK 263          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b3a (ATPase Na+/K+ transporting subunit beta 3a [Source:ZFIN;Acc:ZDB-GENE-990415-167])

HSP 1 Score: 115.546 bits (288), Expect = 3.435e-28
Identity = 75/258 (29.07%), Postives = 131/258 (50.78%), Query Frame = 3
Query:  117 SFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKK--NTLVMVKCQ 869
            S+ +  YN R+    GRT  +W  I +FY ++Y  L A F+  + V L+ L  +D P+   + +     PGL +RP     +  I F  ++P  Y  Y   + +FL  Y D     +        + +  +++ K+C+F  ++L  C+  +   FGY+KG PCV++KMN+I G  P    +  P I C  +++       ++QYFP+ G        D  ++PY G+    GY+ P+VAV+ +  K+  N+ ++V+C+
Sbjct:   17 SWKDAIYNPRTGELFGRTARNWGLILLFYLVFYGFLAAMFVFTLWVMLQTL-NDDTPKYRDRVA----SPGLVIRP----NSLNIEFNRSDPLEYGQYVQHLESFLHQYNDSEQAKNDLCMAGQYSEQDGESLKKVCQFKRSLLYSCSGMEDTTFGYAKGQPCVIVKMNRIIGLKP----SGDPYINCTSKSV----KPLQMQYFPHEGT------IDRMYFPYYGKKTHKGYVQPLVAVKLLLKKEDYNSELIVECK 251          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b4 (ATPase Na+/K+ transporting subunit beta 4 [Source:ZFIN;Acc:ZDB-GENE-070412-1])

HSP 1 Score: 114.39 bits (285), Expect = 2.533e-27
Identity = 77/258 (29.84%), Postives = 127/258 (49.22%), Query Frame = 3
Query:  132 FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTL-IRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN----MTSKVPDNVD-KICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQF 872
             +N+ +K F+GR+  SW  I +FY   Y  L A F   M   +       I      ++   + PG+ M P  D      I F  ++  S++ Y   +   L PY+D  L+  +N A       M   + ++ + K C+FN + L  C+  +  +FGYSKG PC+L+KMN+I G++P      +P     G      + +GE+++FPN         FD  +YPY G+     Y SP+VAVQF+ ++ +T + ++C+ 
Sbjct:   80 LWNAETKEFMGRSGKSWSLILLFYAALYIFLAAMFAGCMCCLMW-----SISPYAPTYNDRVMPPGMTMFPHVDTAHGFDIAFNASDRSSWRRYAKTLEAHLKPYDD-GLQSRRNIACKGNAYFMQEDLEESAERKACQFNRSSLGACSGLQDKDFGYSKGRPCILVKMNRILGYLP---GQGTPVNVTCGLKKGSTEVLGEVKFFPNPN-------FDLRYYPYYGKLRHVNYSSPLVAVQFLNVQHDTPLHIQCKL 321          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: atp1b3 (ATPase Na+/K+ transporting subunit beta 3 [Source:NCBI gene;Acc:394687])

HSP 1 Score: 117.857 bits (294), Expect = 6.685e-29
Identity = 87/270 (32.22%), Postives = 131/270 (48.52%), Query Frame = 3
Query:  132 FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNT---LVMVKCQF---MNMKFESDLLKF 908
             YN +S  F+GRT SSW  I +FY ++Y  L   F   M V L+ L  + +P+   + S     PGL +   P      I+F  N+ QSY+ Y   + TFLTPY D     +   A      +   +  K C+FN + L  C+  + N FGY++G PCV++KMN+I G  P+     +P I C       K     +QYFP NG        D  ++PY G+     Y+ P+VAV+ +    N+    + ++C+     N+K E +  KF
Sbjct:   20 IYNPQSGEFMGRTASSWALILLFYLVFYGFLAGLFTLTMWVMLQTL-DDSVPKYRDRVS----SPGLMIS--PKSAGLEIKFTRNKTQSYQEYIQTLHTFLTPYNDAIQAKNDLCAPGLYFDQDEKDEKKACQFNRSSLGLCSGIEDNTFGYNEGKPCVIVKMNRIIGLKPE----GNPKINC-----TSKTEDVNLQYFPENGK------IDLMYFPYYGKKTHVNYVQPLVAVKIIPPPYNSSLDEISLECKIHGSRNLKNEDERDKF 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: fam151a (family with sequence similarity 151 member A [Source:Xenbase;Acc:XB-GENE-980030])

HSP 1 Score: 118.627 bits (296), Expect = 7.708e-29
Identity = 90/271 (33.21%), Postives = 130/271 (47.97%), Query Frame = 3
Query:  120 FIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVD------KICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPD---TTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNG-------GYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            F E  +N R++ F+GRT SSW  I  FY ++Y  LT  F   M V L+      I   T ++      PGL +RP  D  T  I ++I+   S+  Y   + + L PY D       +     + +K  D  D      K C+F  + L DC+   +  +GYS G+PC+LIKMNKI  + P    +  N+S TI C G        +G   Y+P++ N SNG       G  D  ++PY G   Q  Y  P+VAV+F  L  N  + V+C+
Sbjct:   17 FKEFMWNPRTREFMGRTASSWGLIVSFYLVFYAFLTGMFALSMYVMLQ-----TIDEYTPKYWDRLTSPGLMIRPKTD--TLEIVYSISGNSSWAPYVSQLNSMLDPYNDTVQMQQGSVCPSGVFNKQDDTGDVRNYPKKACQFLRSSLGDCSGLTDPTYGYSTGSPCLLIKMNKIINFYPGVIPSLSNTSITINCTGTTANMDQMLGSRTYYPSS-NPSNGTSNGTSLGTMDLMYFPYYGNRAQKNYSQPLVAVKFYNLTLNQDLYVQCR 279          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: tpst2 (tyrosylprotein sulfotransferase 2 [Source:Xenbase;Acc:XB-GENE-962493])

HSP 1 Score: 115.161 bits (287), Expect = 9.030e-28
Identity = 86/271 (31.73%), Postives = 126/271 (46.49%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPD----NVD----KICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWI----------PDTTDNSSP---TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            +N   K FLGRT  SW KI +FY I+Y  L   F+  + V L       I     ++      PGL    +P    T I F+ N+P SY  Y   M  F++ Y +     DK      M  +  +    N D    K C F    L++C+      FG+++G PCV++K+N+I  +           P+ T N +P    I C G+   D  NI E++Y+   G +     F  N+YPY G   QP YL P++AVQF  L  NT + ++C+
Sbjct:   18 WNPDKKEFLGRTGGSWFKILLFYLIFYGCLAGIFIGTIQVLLL-----TISEYEPKYQDRVAPPGLTQ--VPKAVKTEINFSPNDPDSYNDYVQSMEKFISKYSNENQVSDKFEDCGTMPGQYRERGGLNKDGGQKKSCVFRRQWLQNCSGIDDQTFGFAEGKPCVIVKLNRIVAFKPVPPQNNSLPPEMTANYNPYVIPIHCQGKRDEDIPNIREVKYYGMGGFAG----FPLNYYPYYGKLLQPEYLQPLIAVQFTNLTFNTEIRIECK 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: atp1b3 (ATPase Na+/K+ transporting subunit beta 3 [Source:NCBI gene;Acc:394687])

HSP 1 Score: 104.76 bits (260), Expect = 2.020e-24
Identity = 81/267 (30.34%), Postives = 126/267 (47.19%), Query Frame = 3
Query:  132 FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNT---LVMVKCQF---MNMKFESDLLKF 908
             YN +S  F+GRT SSW  I +FY ++Y  L   F   M V L+ L  + +P+   + S     PGL +   P      I+F  N+ QSY+ Y   + TFLTPY D     +   A      +   +  K C+FN + L  C+  + N FGY++G PCV++KMN+I G  P+     +P I C            ++ Y       S+  Y DH ++       Y+ P+VAV+ +    N+    + ++C+     N+K E +  KF
Sbjct:   20 IYNPQSGEFMGRTASSWALILLFYLVFYGFLAGLFTLTMWVMLQTL-DDSVPKYRDRVS----SPGLMIS--PKSAGLEIKFTRNKTQSYQEYIQTLHTFLTPYNDAIQAKNDLCAPGLYFDQDEKDEKKACQFNRSSLGLCSGIEDNTFGYNEGKPCVIVKMNRIIGLKPE----GNPKINC----------TSKVSY-------SSPSYIDHWWF-----VNYVQPLVAVKIIPPPYNSSLDEISLECKIHGSRNLKNEDERDKF 253          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 100.138 bits (248), Expect = 1.696e-22
Identity = 81/273 (29.67%), Postives = 125/273 (45.79%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAIN--EPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN-----MTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEIL 917
            +N   K  LGR K SW  I +FY + YC    F   M  + + GL+    P        +   PGL +RP        + FA N  E  ++ SY   + TFL  Y D   K +KN  +C      +         K C+F+ ++L +C+  +  +FG+++G PC+LIKMN+I G+      +  P          D   +G I ++P++        FD  +YPY G+     Y SP++A+QF  +K+N  V V+C+       SD  K   L
Sbjct:   55 WNPEKKEVLGRDKRSWALILLFYSVLYC----FLAGMFALCMYGLLATISPYVPTYRERV-FPPGLTIRP----QANALYFAFNSSERSTWSSYAESLNTFLEDYNDETQK-EKNL-VCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILGY---QAGSGIPIYVTCEVLKADMSYLGPISFYPSDK-------FDLMYYPYYGKLTHVNYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHEKDRFL 306          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp1b1 (ATPase, Na+/K+ transporting, beta 1 polypeptide [Source:MGI Symbol;Acc:MGI:88108])

HSP 1 Score: 140.969 bits (354), Expect = 6.969e-37
Identity = 97/275 (35.27%), Postives = 143/275 (52.00%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAIC-NMTSKVPDNVD--------KICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPT--------------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGY--FDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            +NS  K FLGRT  SW KI +FY I+Y  L   F+  + V L  L  +++ + T Q  +    PGL    +P    T I F  N+P+SY++Y +++  FL  Y+D   KDD  F  C N+ S+  +  D        K+CRF L  L +C+  N+  +GY +G PC++IK+N++ G+ P    N S                ++C G+   DKD +G I+YF        GGY  F   +YPY G   QP YL P++AVQF  L  +T + V+C+
Sbjct:   17 WNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVML--LTISEL-KPTYQDRVAP--PGLTQ--IPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYF------GMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECK 278          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp1b2 (ATPase, Na+/K+ transporting, beta 2 polypeptide [Source:MGI Symbol;Acc:MGI:88109])

HSP 1 Score: 124.405 bits (311), Expect = 3.925e-31
Identity = 84/282 (29.79%), Postives = 134/282 (47.52%), Query Frame = 3
Query:   84 EKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN-----VDKICRFNLTMLEDCN---KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD 896
            EK  C     + + E  +N R+  F+GRT +SW  I +FY ++Y  LTA F   M V L+  V +  P+   + +     PGL +RP  ++   ++   I++ +S+  +   +  FL PY D       +        + PDN       + C+FN T L DC+      ++GYS G PCV IKMN++  +      N S  + C G+   D +N+G    FP NG+       D  ++PY G+     Y  P+VAV+F+ +  N  V V+C+       +D
Sbjct:    6 EKKSCG-QVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSLTMWVMLQ-TVSDHTPKYQDRLAT----PGLMIRPKTENLDVIVN--ISDTESWGQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFIKMNRVINFYAGA--NQSMNVTCVGKRDEDAENLGHFVMFPANGS------IDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATD 271          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp1b3 (ATPase, Na+/K+ transporting, beta 3 polypeptide [Source:MGI Symbol;Acc:MGI:107788])

HSP 1 Score: 123.635 bits (309), Expect = 5.511e-31
Identity = 91/276 (32.97%), Postives = 130/276 (47.10%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVD--------KICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 923
            YN  S  FLGRT  SW  I +FY ++Y  L A F   M   L+ L  +++P+   Q       PGL + P P  T     F+++EPQ+YK    D+ +FL PY    +++ KN   C      PD           + C+F +++LE+C+     NFGYSKG PC+L+KMN+I   IPD      P I C     + K+    I  +P        G  D  ++PY G+    GY  P+VAVQ                  +KF+S L K E+ V+
Sbjct:   21 YNPSSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWAMLQTL-NDEVPKYRDQIP----SPGLMVFPKP-QTALEYTFSMSEPQTYKKLVEDLESFLKPYS---VEEQKNLTSC------PDGAPFIQHGPDYRACQFPVSLLEECSGVTDANFGYSKGQPCILVKMNRIIDLIPD----GYPQISC-----LPKEENATIATYPEF------GVLDLKYFPYYGKKRHVGYRQPLVAVQ------------------VKFDSGLNKKEVTVE 248          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp1b4 (ATPase, (Na+)/K+ transporting, beta 4 polypeptide [Source:MGI Symbol;Acc:MGI:1915071])

HSP 1 Score: 102.064 bits (253), Expect = 4.862e-23
Identity = 79/274 (28.83%), Postives = 133/274 (48.54%), Query Frame = 3
Query:  108 RCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN----MTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLL 902
            + Q   E  ++   +  L RT  S   I + YF +Y SL A  +++ +  L   +   +P  T Q       PG+ +RP   H+     F ++EP++++ Y + +  FL  Y D  L+++ N         +     D   K C+F  + L++C+  +   FGYS G PC+L+KMN+I G+ P+  D     + C  Q   D+++I  I Y+P + +      FD  +YPY G+     Y SP+VA+ F  + KN  V V+CQ       +D++
Sbjct:   84 KLQIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYASLAAV-ITLFIYMLFLAISPYMPTFTEQVK----PPGVMIRPFA-HSLNF-NFNVSEPETWQRYVISLNGFLQGYND-SLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGDPVK--VSCKVQKG-DENDIRSINYYPESAS------FDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVI 340          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp4b (ATPase, H+/K+ exchanging, beta polypeptide [Source:MGI Symbol;Acc:MGI:88114])

HSP 1 Score: 98.2117 bits (243), Expect = 4.081e-22
Identity = 72/278 (25.90%), Postives = 128/278 (46.04%), Query Frame = 3
Query:   84 EKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRP-LPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFA----ICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIG----EIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQFM 875
            EK  C   R   F    +N  +   LGRT + W  I ++Y  +Y  +T  F   + V ++ +     P        LK  PG+ +RP +       I + ++E  S+      + +FL  Y     +D  N          +   P++    C+F   ML++C+     +FG+ +G PC +IKMN+I  ++P  ++N++P + C  Q+   K        +++Y+P NG       F  +++PY G   QP Y +P+VA + + + KN  V + C+ +
Sbjct:    6 EKKSCS-QRMAEFRHYCWNPDTGQMLGRTPARWVWISLYYAGFYVVMTGLFALCIYVLMQTI----DPYTPDYQDQLK-SPGVTLRPDVYGERGLKISYNVSENSSWAGLTHTLHSFLAGYTPASQQDSINCTSEKYFFQESFAAPNHTKFSCKFTADMLQNCSGLADPSFGFEEGKPCFIIKMNRIVKFLP--SNNTAPRVDCTFQDDPQKPRKDTEPLQVEYYPPNGT------FSLHYFPYYGKKAQPHYSNPLVAAKLLNVPKNMQVSIVCKIL 269          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|Q93235|AT1B1_CAEEL (Sodium/potassium-transporting ATPase subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=nkb-1 PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 1.916e-47
Identity = 97/295 (32.88%), Postives = 168/295 (56.95%), Query Frame = 3
Query:  114 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 923
            ++F E  YN ++ T +GRT  SW +I +FY I+Y  L AF+++ + +F++ L    +PR  G+ +++ + PG+G +P     PD  +TLI++ + + +SYK+Y   M+T+LT Y D    + +     +    +  N D + CRF+L++ +  C++K++FGY  G PCV+I +N++ GW P D  +NS P             I C G   +D+++IG++ Y P+NG        D  +YPY+   GY  PI  V+F T+ +N LV+V+C+   +  E D      ++ FE++V+
Sbjct:   27 ETFREFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKERPD--STLIKYNLRDQKSYKAYLEQMKTYLTKY-DSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNG-------IDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|P25169|AT1B1_ARTSF (Sodium/potassium-transporting ATPase subunit beta OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 2.116e-44
Identity = 107/321 (33.33%), Postives = 152/321 (47.35%), Query Frame = 3
Query:   72 DEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHT---TTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPT---------------------------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDL------LKFEILVD 923
            DE       K ++ QSF    +NS +  F+GRT  SW KI IFY I+Y  L  FF  M+++F + L    IP+   + SL+   PGLG RP+P      +TLI+F       ++ +   +  FL PYE +     + F  C+     P    K C FN+ +L D C K+NNFGY  G PCVLIK+   FGW P+  ++S+                             + C G+   DK+ IG I Y P  G       F   +YPY+  PGYL+P+VA+QF +L+    V V+C+        D       + FEI +D
Sbjct:    7 DEQFVGSGPKETKWQSFKGFVWNSETSQFMGRTAGSWAKITIFYVIFYTLLAGFFAGMLMIFYQTL-DFKIPKWQNKDSLIGANPGLGFRPMPPEAQVDSTLIQFKHGIKGDWQYWVHSLTEFLEPYETL-TSSGQEFTNCDFDK--PPQEGKACNFNVELLGDHCTKENNFGYELGKPCVLIKLTD-FGWRPEVYNSSAEVPEDMPADLKSYIKDIETGNKTHMNMVWLSCEGETANDKEKIGTITYTPFRG-------FPAYYYPYLNVPGYLTPVVALQFGSLQNGQAVNVECKAWANNISRDRQRRLGSVHFEIRMD 315          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|Q9XUY5|AT1B3_CAEEL (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis elegans OX=6239 GN=nkb-3 PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 4.585e-43
Identity = 95/300 (31.67%), Postives = 155/300 (51.67%), Query Frame = 3
Query:  114 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYL-----KDDKNFAICNMTSKVPDNVDKICRFNLTMLE--DCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP-------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 923
            ++F +  YN    T LGRT +SWC+I +FY I+Y  L+AFF+  + +FL  L    +PR  G+ +++ + PG+G +P     PD  +TLI+F + + +S++ Y   +  +L+ Y++          D N A+   T   P      CRF+L + E  +C  K+ +GY  G PCV + +N++ GW P   D+ S              TI C G    DK+++G+++Y P  G        D  +YPY+  P Y  PI  V+F T+ +N LV+V+C+      E D      ++ FE+ V+
Sbjct:   24 ETFAQFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLRTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKENPD--STLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFP------CRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG-------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMVYFELFVE 307          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|A8X4W9|AT1B3_CAEBR (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis briggsae OX=6238 GN=nkb-3 PE=3 SV=3)

HSP 1 Score: 159.458 bits (402), Expect = 1.787e-42
Identity = 92/296 (31.08%), Postives = 158/296 (53.38%), Query Frame = 3
Query:  114 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLE--DCNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 923
            ++F +  YN +  T LGRT +SWC+I +FY I+Y  L+AFF+  + +FL+ L    +PR  G+ +++ + PG+G +P     PD  +TLI+F + + +S++ Y   +  + + Y +    D +     +    +  + D + CRF+L + E  +C  K+ +G+  G PCV++ +N++ GW P D   NS P            TI C G    DK+++G+++Y P  G        D  +YPY+  P Y  PI  V+F T+ +N LV+V+C+      E D      ++ FE+ V+
Sbjct:   33 ETFRQFLYNKQKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLAIFLKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKENPD--STLIKFNLQDSKSWEPYVKQLDGYFSRYNNT--NDTRECGAEDSNEALQTDPDSLPCRFDLGLFEKANCGAKDQYGFKSGKPCVVVSLNRLIGWRPVDYDGNSVPEEIKSRYKSGSITINCEGATPFDKEHLGKVKYIPEAG-------IDGRYYPYVFLPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDVSTRIGMVYFELFVE 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|Q24046|ATPB1_DROME (Sodium/potassium-transporting ATPase subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=nrv1 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 1.209e-39
Identity = 99/306 (32.35%), Postives = 151/306 (49.35%), Query Frame = 3
Query:   99 KPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTT--TLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD--------------NSSPT-------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFM--NMKFESDL------LKFEILVD 923
            +P++ Q+F E  YN +  TF GRT  SW ++ +FY I+Y  L A F   M   L   + +  P+   Q SL+   PGLG RPL + T   ++I F   +P     +   +  FL  Y     +D K+        +V +  D +C  N  +   C+K NN+GY    PC+ +K+NKIFGWIP+  D              N + T       + C G    DK+N   I+YFP+ G       F   +YP++ QPGYLSP+VAVQF +  K  ++ V+C+    N+++   +      + F+IL+D
Sbjct:   17 QPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLS-TISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGF----GQVLEPTD-VCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG-------FPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILLD 309          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: A0A564YRD5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8659 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 1.966e-72
Identity = 120/278 (43.17%), Postives = 175/278 (62.95%), Query Frame = 3
Query:  102 PSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP--TIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMK-FESDLLKFEILVD 923
            PSRC ++I   YN + K+ LGRT  SW +I  +Y I+Y  L  FFM MM VFL+ +V    P RTGQ SLLK +PGLG+RP+ D   TLI ++  +PQ Y  Y  ++   L+ YE I  K +  FA C    KVP++  K+CRF+L  L  CNK NNFGY    PC ++K+N+++GW+PD  D   P   + C GQN  D DN+G ++++P+   N +  G F + ++P++GQ GY SP+VAVQF  L K+ +++++C    +K  ++D + FEIL+D
Sbjct:   20 PSRCPNWI---YNKKDKSILGRTCVSWAQIFTYYCIFYALLIGFFMGMMTVFLQLIVPPQYPLRTGQQSLLKFQPGLGVRPIVDEDKTLIFYSKKDPQVYYEYVDNINALLSYYEKINEKPETGFATCTTDGKVPNDPKKVCRFDLNSLGPCNKANNFGYPDDKPCAILKLNRVYGWMPDVMDPEIPHTLVSCQGQNPEDHDNMGPVKFYPSITANGTEYGVFHNQYFPFLGQNGYTSPLVAVQFENLTKHVIILIQCTLQGVKNIDTDPVTFEILLD 294          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: A0A068XXJ4 (Sodium:potassium dependent atpase beta subunit OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000413500 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 4.940e-72
Identity = 116/278 (41.73%), Postives = 182/278 (65.47%), Query Frame = 3
Query:  102 PSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP--TIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNM-KFESDLLKFEILVD 923
            PSRC +++   YN + K+FLGRT +SW KI ++Y  +Y  L+ FF+ M++VFL+ +V   +P RTG  SLL+ +PGLGMRP+ D   TLI ++  +PQ Y  Y  ++   ++ YE+I +K    FA C    K P+   K+CRF+L  L  CNK NN+GY    PCV++K+N+++GW+PD TD + P   + C GQN  D++N+G ++++P+   N +  G F + ++P++GQ GY SP+VAVQF  L+K+ L++V+C+       + + +KFEIL+D
Sbjct:   18 PSRCPTWL---YNKKDKSFLGRTCASWAKIFLYYCFFYAILSGFFLGMIMVFLQFIVPAKVPMRTGHQSLLRFQPGLGMRPIIDEDKTLIYYSSRDPQVYYEYVDNLNALISYYEEINVKPAIGFANCTNDQKSPNEPKKVCRFDLESLGPCNKSNNYGYPDDKPCVILKLNRVYGWMPDVTDAAIPHTLVSCEGQNPEDQENVGPMKFYPSIIKNGTEYGVFHNQYFPFLGQNGYTSPLVAVQFEKLEKHILILVQCRLHGATNVDPEPVKFEILLD 292          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: U6JI80 (Sodium/potassium-transporting ATPase subunit beta-2 OS=Echinococcus granulosus OX=6210 GN=EGR_08763 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 4.992e-72
Identity = 116/278 (41.73%), Postives = 182/278 (65.47%), Query Frame = 3
Query:  102 PSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP--TIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNM-KFESDLLKFEILVD 923
            PSRC +++   YN + K+FLGRT +SW KI ++Y  +Y  L+ FF+ M++VFL+ +V   +P RTG  SLL+ +PGLGMRP+ D   TLI ++  +PQ Y  Y  ++   ++ YE+I +K    FA C    K P+   K+CRF+L  L  CNK NN+GY    PCV++K+N+++GW+PD TD + P   + C GQN  D++N+G ++++P+   N +  G F + ++P++GQ GY SP+VAVQF  L+K+ L++V+C+       + + +KFEIL+D
Sbjct:   18 PSRCPTWL---YNKKDKSFLGRTCASWAKIFLYYCFFYAILSGFFLGMIMVFLQFIVPAKVPMRTGHQSLLRFQPGLGMRPIIDEDKTLIYYSSRDPQVYYEYVDNLNALISYYEEINVKPAIGFANCTNDQKSPNEPKKVCRFDLESLGPCNKSNNYGYPDDKPCVILKLNRVYGWMPDVTDAAIPHTLVSCEGQNPEDQENVGPMKFYPSIIKNGTEYGVFHNQYFPFLGQNGYTSPLVAVQFEKLEKHILILVQCRLYGATNVDPEPVKFEILLD 292          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: A0A267GYP4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022013g1 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.367e-71
Identity = 118/284 (41.55%), Postives = 171/284 (60.21%), Query Frame = 3
Query:   63 INFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDD--KNFAICNMTSKVPDNVDKICRFNLT-MLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNS--SPTIKCFGQNLIDKDNIGEIQYFPN-----NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMK 884
            ++ D D    E +P R  +F+   YN  +   LGRT  SW KIG FY +YY  L  FF+ M+ VFL G++  DIP RTG++SLL++ PGLG RP P   +TLI F   EP +Y     +++     Y+++ LK D       C   SK      K+C+FN T  L+DCN   +FGY+ G PCV++KMN+++GW+PD  D     P + CFG+N  D +NIGE++YFP+      G  +  GYF   ++PY+ Q GY +P+VAV+F  L+ N+LVMV+C+  N++
Sbjct:   24 LDVDIDATNEEARPCRGAAFLRFLYNRNTGQILGRTGVSWAKIGAFYIVYYSCLAGFFVGMLSVFLYGVIVEDIPYRTGENSLLQMNPGLGFRPQPSMDSTLIEFVQGEPATYAGEMANLQQMYDTYKEMELKPDNVNVRKACEPDSKPDREPFKVCKFNWTRWLQDCNPSTDFGYAVGKPCVVLKMNRVYGWLPDPLDPEVPHPMVTCFGENPADTENIGELEYFPSMETNYTGTPARMGYFSQAYFPYLKQVGYRAPLVAVRFSNLRNNSLVMVRCELRNLR 307          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: A0A267DGL6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008425g2 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.650e-71
Identity = 118/284 (41.55%), Postives = 171/284 (60.21%), Query Frame = 3
Query:   63 INFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDD--KNFAICNMTSKVPDNVDKICRFNLT-MLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNS--SPTIKCFGQNLIDKDNIGEIQYFPN-----NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMK 884
            ++ D D    E +P R  +F+   YN  +   LGRT  SW KIG FY +YY  L  FF+ M+ VFL G++  DIP RTG++SLL++ PGLG RP P   +TLI F   EP +Y     +++     Y+++ LK D       C   SK      K+C+FN T  L+DCN   +FGY+ G PCV++KMN+++GW+PD  D     P + CFG+N  D +NIGE++YFP+      G  +  GYF   ++PY+ Q GY +P+VAV+F  L+ N+LVMV+C+  N++
Sbjct:   33 LDVDIDATNEEARPCRGAAFLRFLYNRNTGQILGRTGVSWAKIGAFYIVYYSCLAGFFVGMLSVFLYGVIVEDIPYRTGENSLLQMNPGLGFRPQPSMDSTLIEFVQGEPATYAGEMANLQQMYDTYKEMELKPDNVNVRKACEPDSKPDREPFKVCKFNWTRWLQDCNPSTDFGYAVGKPCVVLKMNRVYGWLPDPLDPEVPHPMVTCFGENPADTENIGELEYFPSMETNYTGTPARMGYFSQAYFPYLKQVGYRAPLVAVRFSNLRNNSLVMVRCELRNLR 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 135.576 bits (340), Expect = 2.745e-35
Identity = 86/272 (31.62%), Postives = 143/272 (52.57%), Query Frame = 3
Query:   96 CKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAI-------CNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQFM 875
             K  +   + E F+N R++ F GRT SSW  I +FY  +Y  L   F+  M V L  L  N   + T Q  L    PGL +RP  +    +  +A    +S+ ++   + +FL+PY D  +++ KN+A           +  V +N  + C+F  ++LEDC+   +  +GY +G PC++IK+N++ G +P   D  +P+I C    + D D +GE+ YFP NG       F+  ++PY G   Q  Y  P+VA++F+ +  NT + V+C+ +
Sbjct:    2 AKGDKKNEWKEFFWNPRTREFCGRTASSWGLIFLFYLAFYIFLAGMFILTMYVMLLTLDDN---KPTYQDRLAT--PGLMIRPKGEEMEII--YAKENTESWDTHVQALNSFLSPYND-SVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLP-GKDGQAPSISC-APKIDDTDKMGEVAYFPRNGT------FNLMYFPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKII 257          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 132.494 bits (332), Expect = 4.524e-34
Identity = 87/280 (31.07%), Postives = 146/280 (52.14%), Query Frame = 3
Query:   96 CKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAI-------CNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKC------FGQN--LIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQFM 875
             K  +   + E F+N R++ F GRT SSW  I +FY  +Y  L   F+  M V L  L  N   + T Q  L    PGL +RP  +    +  +A    +S+ ++   + +FL+PY D  +++ KN+A           +  V +N  + C+F  ++LEDC+   +  +GY +G PC++IK+N++ G +P   D  +P+I C       G++  + D D +GE+ YFP NG       F+  ++PY G   Q  Y  P+VA++F+ +  NT + V+C+ +
Sbjct:    2 AKGDKKNEWKEFFWNPRTREFCGRTASSWGLIFLFYLAFYIFLAGMFILTMYVMLLTLDDN---KPTYQDRLAT--PGLMIRPKGEEMEII--YAKENTESWDTHVQALNSFLSPYND-SVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLP-GKDGQAPSISCAPKKYKIGKDEWIDDTDKMGEVAYFPRNGT------FNLMYFPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKII 266          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b2a (sodium/potassium-transporting ATPase subunit beta-2-like [Source:NCBI gene;Acc:103043075])

HSP 1 Score: 130.183 bits (326), Expect = 2.037e-33
Identity = 90/270 (33.33%), Postives = 139/270 (51.48%), Query Frame = 3
Query:   93 ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDI--YLKDD----KNFAICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            E    +   + E F+N R+   LGRT SSW  I +FY ++Y  L   F   M V L  L   D  + T Q  L    PGL +R  P  ++  I+++    +S+  Y   + +FLTPY++    + +D      + I   +  V +N  + C+FN T+L DC+     N+GY  G PC+ IK+N++ G +P   D  SP + C G    D + +G++ YFP+N +      F+  +YPY G   Q  Y  P+VAV+F+ L  NT V V+C+
Sbjct:    4 EEDKKKSGEWREFFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGMFCLTMYVMLLTL---DDYKPTWQDRLAT--PGLMIR--PKGSSMEIQYSKQNTESWDKYVKTLNSFLTPYDNSQQVMNNDPCTPDKYFIQEDSGSVRNNPKRSCQFNRTVLGDCDGLTDPNYGYRDGKPCIFIKLNRVIGMLP-GKDGQSPYVTC-GAKREDSELLGDMAYFPSNAS------FNLMYYPYYGKKAQVNYSQPLVAVKFLNLTLNTDVNVECK 258          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b3b (sodium/potassium-transporting ATPase subunit beta-3-like [Source:NCBI gene;Acc:103044362])

HSP 1 Score: 122.865 bits (307), Expect = 7.470e-31
Identity = 90/272 (33.09%), Postives = 133/272 (48.90%), Query Frame = 3
Query:   84 EKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN---VDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKK--NTLVMVKCQ 869
            EK E K S  + FI   YN R+  F+GRT SSW  I +FY ++Y  L   F   M V L+ L  ND    T ++      PGL +RP        I    + PQ Y  Y   + +FL  Y D     ++N         + +N   V  +C+F  + L  C+     NFGY++G PCVLIKMN+I G +P       P I C  +    +D   ++QYFP+ G       FD  ++PY G+   P Y+ P+VAV+ +  ++  NT + ++C+
Sbjct:    6 EKPEGKDSSWKDFI---YNPRTGEFIGRTASSWALIFLFYLVFYGFLAGMFSLTMWVMLQTL--NDY---TPKYRDRVASPGLMIRP----KYFDIEVNRSNPQQYNKYVQGLESFLQQYNDTL--QEQNTVCTEGDYYMQENNELVKNVCQFKRSQLRQCSGLADTNFGYAEGQPCVLIKMNRIIGLVP----RGDPYINCTAK----RDTPLQMQYFPSEGR------FDKMYFPYYGKKAHPNYVQPVVAVKLLFSEQDYNTQLTIECR 249          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b1b (sodium/potassium-transporting ATPase subunit beta-233-like [Source:NCBI gene;Acc:103031172])

HSP 1 Score: 117.857 bits (294), Expect = 7.583e-29
Identity = 86/275 (31.27%), Postives = 130/275 (47.27%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAIC-----------NMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKI--FGWIPDTTDNSSPT------------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            +NS ++  LGRT  SW KI +FY I+Y  L   F+  +   L  L  N  P  T Q  +    PGL   P  D +   + F++N+ ++Y  Y   MR FL  Y +   +D   F  C           ++ S +     K CRF  T L  C+  +   FG+S+G PC+++K+N+I  F   P  T+ S P             I C  +   D+  +GE++Y+        GG F   +YPY G+   P YL P+VAVQF+ L  N  + ++C+
Sbjct:   16 WNSETREVLGRTGGSWAKILLFYVIFYGFLAGIFIGTIQALLLTL-SNYKP--TWQDRIAP--PGLTHTPRSDKSE--LSFSVNDVETYLKYTKSMREFLEAYNEETQRDQMKFEDCGDQPQEYKHRGDLESDI--GARKACRFQRTFLGPCSGIEDKEFGFSEGKPCLIVKLNRIVNFKPKPPLTNESIPEEAQHKIQRNVIPIYCHNKREEDEGKLGEVKYY------GIGGGFPLQYYPYYGKLLHPQYLQPLVAVQFVNLTMNYELRIECK 275          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005979.1 (pep scaffold:Pmarinus_7.0:GL479225:261160:295076:-1 gene:ENSPMAG00000005385.1 transcript:ENSPMAT00000005979.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 2.017e-24
Identity = 78/253 (30.83%), Postives = 122/253 (48.22%), Query Frame = 3
Query:  189 IGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNM-----TSKVPDNVDKI---CRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQFM--NMKFESDLLKF 908
            I +FY ++Y  L + F+  M V L+  V +  P+   + S     PG+ MRP        +   IN   ++      + TF   Y ++   +  N A+C         K P N D +   CRFN +   +C   + +GY+   PCV IK+N+I G+ P T    +P + C  +   +  N+GE++YFP      NGG  D  ++PY G+   P Y  P+VAV+F+ L K   V V+C+ +  N+K   D  KF
Sbjct:    3 ILLFYTVFYAFLASLFVFTMWVMLQ-TVDDKNPKYQDRVS----SPGVVMRP---KMNKALELYINR-NTHSDIIEHLNTFFEAYNEV---NQTNKALCEAGKYRDNQKGPPNEDNVWPACRFNRSDFGECASPD-YGYTNQTPCVFIKLNRIIGFKPGTV-KEAPKVMCSSKK--ESGNLGELEYFP------NGGTMDQMYFPYYGKKLDPMYTQPLVAVRFLNLTKQMEVTVECKVIARNVKVIDDRDKF 233          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005895.1 (pep scaffold:Pmarinus_7.0:GL479457:3011:19118:1 gene:ENSPMAG00000005327.1 transcript:ENSPMAT00000005895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 2.389e-12
Identity = 67/271 (24.72%), Postives = 112/271 (41.33%), Query Frame = 3
Query:  108 RCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNM------TSKVPDNVDKICRFNLTMLE--------DCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHN--FYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQF 872
            R +     FYN  +   +GRT  SW +I +FYF+Y+  L A F   M   +  L   ++P+   + S     PGL +R  P      I F  N P+S++ Y   +   L+ Y++      +NF    +       +  P  V  +C F    L+          +  N F   K +      + +     P+  DN S  I C  ++ +     G  ++FPN  +  +  YF      +P   Q  Y  P+VA +F+ L  +T V ++C+ 
Sbjct:   12 RLKGLRHFFYNPHTGEVVGRTPKSWGQICLFYFLYFSFLGALFAFTMWALVMTL-SYELPKYQDRVS----SPGLMIR--PRAPLFEINFMSNSPKSFEPYVNSINELLSSYQNT----SENFCDAGLYRDQQAGAGQPGPVPLMCPFASPPLDAPYVYRQCSSSADNRFQAGKSHESGQSHLRREAVNWPE--DNGSSEINCTNRDEVS----GNSEFFPN--DIFDPMYFSRAPVVFPLRAQGMYTQPLVAARFLNLTHDTPVTIECRL 263          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Nematostella
Match: EDO32320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVE8])

HSP 1 Score: 107.457 bits (267), Expect = 7.423e-26
Identity = 80/276 (28.99%), Postives = 132/276 (47.83%), Query Frame = 3
Query:   75 EDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLG-MRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFA--ICNMTS--KVPDNVDKICRFNLTMLEDCNKKNN---FGYSKGNPCVLIKMNKIFGWIPDTTDN-SSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFM 875
            E + ++E        F    YN      +GR   SW KIG+F+ ++Y  L  FF +M+ +FL  L     P R     L +   G   + P+P  +  +  +  N+  SY S+  D+ +FL  Y      +   FA   CN TS    P +  K CRF+LT L  C K      +G+  G+PC  ++MNK+F ++P+     S   ++C  ++   K+N+  I+ +P      N G+   +FYPY  +  +L+P++AVQ  T    +   V+C+ +
Sbjct:    9 EGMTRWEVIVQNANDFKTFLYNKEKGEVMGRNGQSWAKIGLFFLVFYLCLAGFFAAMLSIFLSTL-----PDRADGPKLTQYIAGKPVLNPVP--SNKIEGYDPNKASSYSSHVSDINSFLNQYVRQGGANKDQFAPDFCNGTSGEPRPKDAKKQCRFDLTNLGPCYKNETGFKYGFDTGSPCFFLRMNKVFNFVPEPNSGLSYIKVECDAKD-SSKNNL--IKVYP----EENPGW-PVSFYPYRMEDNWLAPVIAVQVNT---TSTTEVRCRAL 266          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 141.354 bits (355), Expect = 2.643e-37
Identity = 89/261 (34.10%), Postives = 137/261 (52.49%), Query Frame = 3
Query:  126 EGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAIC-------NMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQF 872
            E  +N R++ FLGRT SSW  I +FY ++Y  L   F   M + L+ L   D  + T Q  L    PG+ +RP  D T  ++ + I   +S+  Y   +  FL PY D  L+  KN             +  V +N  + C+FN T+LE+C+  N+  +GY +G PC++IKMN++ G +P   D  +P++ C  +   D D +GE+ YFP NG       F+  +YPY G   Q  Y  P+VAV+F+ +  N  V ++C+ 
Sbjct:   11 EYLWNPRTREFLGRTASSWGLILLFYLVFYIFLAGLFALTMYIMLQTL---DDHKPTWQDRLAT--PGMVIRPNTDETFEIV-YNIQNTESWDMYAQALDKFLAPYNDT-LQAQKNHECTPDQYFQQEDSGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPG-KDGQTPSVTCAAKR-DDSDKLGELVYFPPNGT------FNLMYYPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKI 256          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 131.724 bits (330), Expect = 6.014e-34
Identity = 84/257 (32.68%), Postives = 138/257 (53.70%), Query Frame = 3
Query:  126 EGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTF---LTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQF 872
            E  +N R++ FLGRT SSW  I +FY ++Y  L   F   M + L+ L   D  + T Q  L    PG+ +RP  D T  ++ + I   +S+  +Y+   ++   L   ++     D+ F   + +  V +N  + C+FN T+LE+C+  N+  +GY +G PC++IKMN++ G +P   D  +P++ C  +   D D +GE+ YFP NG       F+  +YPY G   Q  Y  P+VAV+F+ +  N  V ++C+ 
Sbjct:   11 EYLWNPRTREFLGRTASSWGLILLFYLVFYIFLAGLFALTMYIMLQTL---DDHKPTWQDRLAT--PGMVIRPNTDETFEIV-YNIQNTESWDIFYIKADSYNDTLQAQKNHECTPDQYFQQED-SGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPG-KDGQTPSVTCAAKR-DDSDKLGELVYFPPNGT------FNLMYYPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKI 252          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b1b (sodium/potassium-transporting ATPase subunit beta-233-like [Source:NCBI gene;Acc:101166353])

HSP 1 Score: 112.079 bits (279), Expect = 6.206e-27
Identity = 84/273 (30.77%), Postives = 131/273 (47.99%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAIC-------NMTSKVPDN--VDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKI--FGWIPDTTDNSSPT------------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQ 869
            ++S    F+GRT  SW KI +FY +++  L   F+  + V L  L  ND  + T Q  +    PGL   P  D     + ++I   ++Y  +   +R F++ Y+D    D   F  C            + DN  V K CRF+ T+L  C+  +   FG+  G PCV++K+N+I  F   P ++++S P             + C  +   D D IGEI+Y+  NG       F   +YPY G+   P YL P+VAVQF  L +N  + ++C+
Sbjct:   15 WDSDKGEFMGRTGGSWFKITLFYVVFFGCLAGVFVGTIQVML--LTLNDF-KPTWQDRVAP--PGLSHTPKLDKAE--VSYSIKGIETYLPFTKTLREFVSQYDDSKQLDASKFENCPAEPADYKERGTLDDNAGVRKACRFSRTLLGPCSGLEDETFGFKDGKPCVIVKLNRIVNFRPRPPSSNDSIPEEAWPKVQPNLIPLFCTNKREEDADKIGEIKYYGINGG------FPLQYYPYYGKRLHPHYLQPLVAVQFTNLTQNMELRIECK 274          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b3a (ATPase Na+/K+ transporting subunit beta 3 [Source:NCBI gene;Acc:101157248])

HSP 1 Score: 110.923 bits (276), Expect = 1.122e-26
Identity = 81/260 (31.15%), Postives = 122/260 (46.92%), Query Frame = 3
Query:  117 SFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN--MTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPG---YLSPIVAVQFMTLKK--NTLVMVKCQ 869
            S+ +  YN R+   +GRT SSW  I +FY ++YC L   F   M V L  L  + +P+   +       PGL +RP     +  I F  ++P  Y  Y   +  FL  Y D   + ++N       +       V + C F   +L  C+     N+GY +G PCV++KMN+I G  PD      P I C     + KD+  ++ Y PNNG        D  F+PY G+     YL P+VAV+ +  K+  N  + V+C+
Sbjct:   16 SWKDSIYNPRTGELMGRTASSWALILLFYLVFYCFLAGLFALTMWVLLFTL-DDYVPKYRDRVPY----PGLVIRP----NSLDISFNKSDPLKYAQYVQHLEKFLERYNDSAQEKNENCISGEFYLQDGPISMVRRACPFRRALLSFCSGLSDTNYGYQEGKPCVILKMNRIIGLKPD----GEPYINC----TVKKDHPIQMYYSPNNGQ------IDKMFFPYYGKKAHENYLQPLVAVKLLITKEDYNKELTVECR 252          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b4 (ATPase Na+/K+ transporting family member beta 4 [Source:NCBI gene;Acc:101161164])

HSP 1 Score: 98.5969 bits (244), Expect = 4.719e-22
Identity = 77/258 (29.84%), Postives = 127/258 (49.22%), Query Frame = 3
Query:  132 FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRP-LPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVD-----KICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQF 872
             +N+ +K F+GR+  SW  I +FY   Y  L A F   +   +  +     P     +  + + PG+ M P L  H    I F  ++ +S+K Y   M  FL PY D   +D KN    +    + D+++     K C+F  + L DC+  +  ++GYS+G PC+L++MN+I G++P       P            + +GEIQ+FP +        FD  +YPY G+     Y SP+VAV+F  ++ +T + V+C+ 
Sbjct:   78 LWNAETKEFMGRSGKSWSLILLFYAALYAFLAAMFGGCLFCLMWSIS----PYHPTYNDRV-MPPGMTMAPHLEGHE---IAFNASDRKSWKKYARSMDEFLRPYNDG-AQDRKNIRCTHDAYFMQDDLEESAERKACQFKRSWLGDCSGLQDPHYGYSQGRPCILLRMNRILGYLP---GQGKPINVTCAVKKGPAETLGEIQFFPRS-------IFDLKYYPYYGKLRHVNYSSPVVAVRFAGVQYDTHIQVQCKL 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000071416.1 (SMESG000071416.1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 289/291 (99.31%), Postives = 290/291 (99.66%), Query Frame = 3
Query:   51 MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 923
            MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLK+DKNFAICNMTSKVPDNVDKICRFNLTMLEDCN KNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD
Sbjct:    1 MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKEDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNNKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 291          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000061672.1 (SMESG000061672.1)

HSP 1 Score: 224.172 bits (570), Expect = 2.792e-68
Identity = 114/267 (42.70%), Postives = 159/267 (59.55%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNS---SPTIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 923
            Y+S +K FLGR+K  W K   F+FI    +   F+ M  +F EG++  D+P RTG +S+LK  P L  RP+ D  T LIR++  +P +Y  Y   MR  +  YED  L  + ++A C    K PD++ K CRFN+  L+ C K+ NFGY +  PCVLIKMN+IFGW+PD  ++S      IKC GQN  D +N   ++Y+PN   N    GY    +YPY+ Q GY  P+V V+F   KKN L+M+ C  +N+  +S  L FEIL+D
Sbjct:    3 YDSANKKFLGRSKIDWVKFLAFFFICLILMIIIFIGMFFLFTEGVINEDVPYRTGLNSILKNIPNLSFRPVIDFKTALIRYSDADPSTYMLYIQSMRALVQTYEDADLISEDSYATCIDGKKTPDDITKPCRFNILQLDRCIKQYNFGYDRTKPCVLIKMNRIFGWLPDIANSSFSKDILIKCAGQNAEDVENFNTVRYYPNVTINGVVYGYMSSLYYPYLVQYGYRQPLVGVEFDRPKKNVLLMITCHIVNLLTKSAPLTFEILID 269          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000061673.1 (SMESG000061673.1)

HSP 1 Score: 222.631 bits (566), Expect = 2.840e-67
Identity = 112/269 (41.64%), Postives = 163/269 (60.59%), Query Frame = 3
Query:  135 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPT---IKCFGQNLIDKDNIGEIQYFPN---NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 923
            YN     +LGRT + W K  + + +   SL A F+ M  +F EG++  D P RTG HS L+  P L  RP+ D  T LIR+A ++P +Y  Y   MRTF+  YED  L  + ++A C    K PD++++ CRFN+  L+ C K+ NFGY +  PCV +K+NK++GW+PD T++S      + C GQNL D +    I Y+PN   NGN    GYF + +YPY+ Q GY  PI+A++    KKN ++M++C+ +N+   +D L FEILVD
Sbjct:   33 YNKNENKYLGRTPNDWGKFILLFLMLVGSLIAIFVGMFFMFTEGVIDEDRPFRTGSHSALQNIPSLSFRPVIDFKTALIRYADSDPSTYMGYIQSMRTFIQTYEDADLISEDSYATCIDGKKTPDDINRPCRFNILQLDRCIKQYNFGYDRTKPCVFLKLNKVYGWVPDVTNSSVSKDVLVTCGGQNLEDIEYFPNILYYPNVTVNGNIY--GYFSNLYYPYLVQYGYRQPIIALEINQPKKNVVLMIRCRIINLLTPTDPLTFEILVD 299          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000064593.1 (SMESG000064593.1)

HSP 1 Score: 158.303 bits (399), Expect = 1.602e-43
Identity = 97/297 (32.66%), Postives = 157/297 (52.86%), Query Frame = 3
Query:   51 MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAIN-EPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMT-SKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD---NSSPTIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 923
            MS+Y     D      + ++CQ  +   YN++  T  GRT  SW  I +FY I+Y  L+ FF+ M+ VF+ G V    P RTG++S+L   PG+   P   + + LI  + N + + YK+Y      FL  Y    +   K    CN T  + P N+ K C+F+L++L  C         KG  CV ++ NKI+GW+P   +   ++   I+C GQN  D +N+G+ +++P+   N+   G   + FYP++ Q  Y SP+VAVQF  + KN  ++V+C   N+      ++FE+++ 
Sbjct:    1 MSSYHKAKTDEFDTTSEKNKCQKCLTNLYNNKKGTICGRTPKSWGLICVFYLIFYSCLSGFFLGMISVFMYGFVSKMEPMRTGRNSILTFTPGVNANPRSTNESALIVGSTNKDSKLYKNYLKMANEFLKKYTLNPVDGVK----CNETVDQTPKNLTKFCKFDLSLLGPCANP-EAELDKGLLCVYVRPNKIYGWLPQIENPNLSNDILIECDGQNPGDTNNLGKPKFYPSYTNNTKTYGRIPNMFYPFVMQRNYSSPMVAVQFPEMVKNLAILVQCSLKNLINSYKPVRFEVMLQ 292          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000064592.1 (SMESG000064592.1)

HSP 1 Score: 150.599 bits (379), Expect = 1.255e-40
Identity = 91/296 (30.74%), Postives = 148/296 (50.00%), Query Frame = 3
Query:   54 SNYINFDEDIE-KYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDM--RTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD---NSSPTIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILV 920
            + YI   ED E K + KP++ Q  +   YN R+    GRT  +WC++ +++  +Y  LTAFF +M+ +F+  ++    P RTG +S+L   PG+   P     + LI    NE     + Y+    + FL  + D+    + +  +     + P N+   C FN TML  C          G  CV IK+NKI+GW+P   D   ++   + C GQ   D +N+G+  Y+P     +   G   + ++P+  Q  Y SP VA+QF  + KN  +M++C   N+K     +KFEI++
Sbjct:    3 TKYIRAKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDL---QNSSAGLNCSDDRTPTNISNFCIFNKTMLGPCADPEK-ELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYKPIKFEIML 294          
The following BLAST results are available for this feature:
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP1B15.900e-3634.56ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B15.900e-3634.56ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B31.295e-3334.84ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
ATP1B26.940e-3129.43ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
ATP1B43.276e-2530.07ATPase Na+/K+ transporting family member beta 4 [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkb-11.506e-4832.88Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-11.506e-4832.88Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-11.506e-4832.88Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-33.412e-4431.67Probable sodium/potassium-transporting ATPase subu... [more]
nkb-33.605e-4431.67Probable sodium/potassium-transporting ATPase subu... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrv28.887e-4231.15gene:FBgn0015777 transcript:FBtr0079382[more]
nrv28.887e-4231.15gene:FBgn0015777 transcript:FBtr0079383[more]
nrv28.887e-4231.15gene:FBgn0015777 transcript:FBtr0100381[more]
nrv11.206e-4032.35gene:FBgn0015776 transcript:FBtr0332370[more]
nrv11.206e-4032.35gene:FBgn0015776 transcript:FBtr0079384[more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2a1.628e-3435.56ATPase Na+/K+ transporting subunit beta 2a [Source... [more]
atp1b2b5.079e-3030.97ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b2b5.079e-3030.97ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b3a3.435e-2829.07ATPase Na+/K+ transporting subunit beta 3a [Source... [more]
atp1b42.533e-2729.84ATPase Na+/K+ transporting subunit beta 4 [Source:... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b36.685e-2932.22ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
fam151a7.708e-2933.21family with sequence similarity 151 member A [Sour... [more]
tpst29.030e-2831.73tyrosylprotein sulfotransferase 2 [Source:Xenbase;... [more]
atp1b32.020e-2430.34ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
ATP1B41.696e-2229.67pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp1b16.969e-3735.27ATPase, Na+/K+ transporting, beta 1 polypeptide [S... [more]
Atp1b23.925e-3129.79ATPase, Na+/K+ transporting, beta 2 polypeptide [S... [more]
Atp1b35.511e-3132.97ATPase, Na+/K+ transporting, beta 3 polypeptide [S... [more]
Atp1b44.862e-2328.83ATPase, (Na+)/K+ transporting, beta 4 polypeptide ... [more]
Atp4b4.081e-2225.90ATPase, H+/K+ exchanging, beta polypeptide [Source... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q93235|AT1B1_CAEEL1.916e-4732.88Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|P25169|AT1B1_ARTSF2.116e-4433.33Sodium/potassium-transporting ATPase subunit beta ... [more]
sp|Q9XUY5|AT1B3_CAEEL4.585e-4331.67Probable sodium/potassium-transporting ATPase subu... [more]
sp|A8X4W9|AT1B3_CAEBR1.787e-4231.08Probable sodium/potassium-transporting ATPase subu... [more]
sp|Q24046|ATPB1_DROME1.209e-3932.35Sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YRD51.966e-7243.17Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068XXJ44.940e-7241.73Sodium:potassium dependent atpase beta subunit OS=... [more]
U6JI804.992e-7241.73Sodium/potassium-transporting ATPase subunit beta-... [more]
A0A267GYP41.367e-7141.55Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DGL61.650e-7141.55Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2b2.745e-3531.62sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b4.524e-3431.07sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2a2.037e-3333.33sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b3b7.470e-3133.09sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b1b7.583e-2931.27sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005979.12.017e-2430.83pep scaffold:Pmarinus_7.0:GL479225:261160:295076:-... [more]
ENSPMAT00000005895.12.389e-1224.72pep scaffold:Pmarinus_7.0:GL479457:3011:19118:1 ge... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO323207.423e-2628.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2b2.643e-3734.10ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b2b6.014e-3432.68ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b1b6.206e-2730.77sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b3a1.122e-2631.15ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
atp1b44.719e-2229.84ATPase Na+/K+ transporting family member beta 4 [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071416.10.000e+099.31SMESG000071416.1[more]
SMESG000061672.12.792e-6842.70SMESG000061672.1[more]
SMESG000061673.12.840e-6741.64SMESG000061673.1[more]
SMESG000064593.11.602e-4332.66SMESG000064593.1[more]
SMESG000064592.11.255e-4030.74SMESG000064592.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026182 ID=SMED30026182|Name=Sodium/potassium-transporting ATPase subunit beta-2|organism=Schmidtea mediterranea sexual|type=transcript|length=1930bp
TTTTAATTAATCAATTACATCAGTCAAAACAAAATTTATAATAAATCAAA
ATGTCAAATTATATCAATTTTGATGAAGATATAGAAAAATATGAATGTAA
ACCAAGTCGTTGTCAATCATTTATAGAAGGATTTTATAATTCAAGAAGCA
AAACATTTTTAGGAAGAACAAAGAGTAGTTGGTGTAAAATTGGAATTTTT
TATTTTATTTATTATTGCTCATTAACGGCCTTTTTCATGTCCATGATGCT
TGTTTTTCTCGAAGGTTTAGTTGGAAATGATATACCCAGAAGAACTGGTC
AGCACAGCTTGCTCAAATTAGAACCTGGTCTTGGCATGAGACCACTTCCA
GACCATACTACAACTCTTATTCGATTCGCTATAAATGAACCTCAATCTTA
CAAGAGTTATTATATGGATATGCGTACTTTTCTAACACCATACGAAGATA
TTTATCTCAAAGATGACAAAAACTTTGCGATTTGTAACATGACATCAAAG
GTACCAGATAATGTGGATAAAATATGCCGATTTAATCTGACAATGCTTGA
GGATTGCAACAAAAAAAATAATTTTGGATATTCAAAAGGAAATCCTTGTG
TGTTGATTAAGATGAATAAAATATTTGGATGGATTCCTGATACGACTGAC
AATTCAAGCCCCACAATAAAATGTTTTGGACAAAATCTAATTGACAAGGA
TAATATTGGTGAAATACAATATTTTCCAAACAACGGAAATAGCTCGAATG
GTGGCTACTTTGATCATAACTTTTATCCGTATATCGGTCAACCTGGTTAT
TTATCACCGATTGTTGCCGTTCAATTCATGACTCTTAAAAAGAATACCCT
CGTTATGGTGAAATGTCAATTTATGAACATGAAATTTGAAAGTGATTTAC
TCAAATTCGAAATACTTGTGGATTAATGCATTAACCGCTCCATTACAAAA
AAAAACGATAAAAAAATAATAATAACAATAATAGTATATTTACATTTATC
CAATTGAATATTAATAGGTTAACATAGTCATTTGAGATTTGTCTTGACAT
TTCTATCAATTATAGTCCGTAAGTTATTTATGTTATTTTATTGTTTGTGA
AAGTATTACAAGCTACTATTATATTTCTTAACTGCATTTATATGACAGTC
AATTTTGTTACATTATGGCAAAACAATGATTCAATCAGCCTTGTTAGTGC
CTCAAGAAAACTTATAATTATTGTTTGTCGAAATTATCTATATCAAATGA
TCTCTCTCTCTCTCTGTATTTCTCTCTATTTCTATAATCTCATAATTTGA
ATCTCGTCAGGTTACATTGATGTTATTATTACATTTATATTTATATGTAT
ATGTATATACATATTATTGTTTGAATAAGTTTATTATTATTGTGGTCTTC
GTTTATTTTAGGAAATTTTATGCTTTATTGACTAGGAAACGTTGTTTTAG
AGATTCCATTTAAACTATTGTGTACTATTAAAACTATGAGTTTTTATTTA
AAGTGTTTATAGTGTATGTGCAATTTATTCATATATTTTTAATTCTTGTA
ACCTTGATCTTTTTAACAATATGCCTTCTCAGTCGGAGAAGTTAGATATA
TTGTTTTTTTAGGTGTGAACAATCAAATTGGTTGGTTATGATTAGGATAT
TGCCGTAGCACATTAAAAGCACTCGTTTGATTTGAGATAAAATCAATAAA
TGTATGTAACAGGTTTTTATTTTATGTCGTTATTTAGATGTTATTTAGTG
TTTTTATTATCTCTCTCTCTCTTTCTCGATAATATATATGTATATATATA
TAGTTAGTGTAGAAATTGTTCGTTTTTTCATATTGATTAGTGTTATTGAA
ATTCAGTTTTTTAGAAAATTATTAACAGACTTATTCTATAAATAAATTAA
CTGCTTTTTAGAATTTGCTAGATATTCTGC
back to top

protein sequence of SMED30026182-orf-1

>SMED30026182-orf-1 ID=SMED30026182-orf-1|Name=SMED30026182-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=292bp
MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIF
YFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLP
DHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSK
VPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD
NSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGY
LSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR038702Na/K_ATPase_sub_beta_sf
IPR000402Na/K_ATPase_sub_beta
Vocabulary: cellular component
TermDefinition
GO:0005890sodium:potassium-exchanging ATPase complex
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006813potassium ion transport
GO:0006814sodium ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000402Sodium/potassium-transporting ATPase subunit betaPFAMPF00287Na_K-ATPasecoord: 19..278
e-value: 1.7E-69
score: 234.1
IPR000402Sodium/potassium-transporting ATPase subunit betaPANTHERPTHR11523SODIUM/POTASSIUM-DEPENDENT ATPASE BETA SUBUNITcoord: 19..276
IPR038702Sodium/potassium-transporting ATPase subunit beta superfamilyGENE3DG3DSA:2.60.40.1660coord: 15..290
e-value: 4.7E-77
score: 261.3
NoneNo IPR availableTMHMMTMhelixcoord: 47..69