GAS2-like 3

Overview
NameGAS2-like 3
Smed IDSMED30026157
Length (bp)1224
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GAS2-like 3 (SMED30026157) t-SNE clustered cells

Violin plots show distribution of expression levels for GAS2-like 3 (SMED30026157) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GAS2-like 3 (SMED30026157) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GAS2-like 3 (SMED30026157) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026157

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30026157SMESG000003788.1 dd_Smed_v4_12425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30026157SMESG000003788.1 dd_Smed_v4_12425_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026157SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026157SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026157SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026157SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026157SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v6_3326_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30026157SMESG000003788.1 dd_Smed_v4_12425_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026157SMESG000003788.1 dd_Smed_v4_12425_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30026157SMESG000003786.1 SMESG000003788.1 SMESG000003787.1 dd_Smed_v4_3326_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GAS2-like 3 vs. Ensembl Human
Match: GAS2 (growth arrest specific 2 [Source:HGNC Symbol;Acc:HGNC:4167])

HSP 1 Score: 82.8037 bits (203), Expect = 5.920e-18
Identity = 50/162 (30.86%), Postives = 84/162 (51.85%), Query Frame = 1
Query:   79 MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWP-KNPPF---PDR-KAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            M++  + L++ H+  +L      ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P KN P    P +  A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   + +  P   K  +E+
Sbjct:   18 MHQYSQWLASRHEANLLP-----MKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEI 173          
BLAST of GAS2-like 3 vs. Ensembl Human
Match: GAS2 (growth arrest specific 2 [Source:HGNC Symbol;Acc:HGNC:4167])

HSP 1 Score: 82.4185 bits (202), Expect = 1.152e-17
Identity = 50/162 (30.86%), Postives = 84/162 (51.85%), Query Frame = 1
Query:   79 MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWP-KNPPF---PDR-KAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            M++  + L++ H+  +L      ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P KN P    P +  A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   + +  P   K  +E+
Sbjct:   18 MHQYSQWLASRHEANLLP-----MKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEI 173          
BLAST of GAS2-like 3 vs. Ensembl Human
Match: GAS2 (growth arrest specific 2 [Source:HGNC Symbol;Acc:HGNC:4167])

HSP 1 Score: 82.8037 bits (203), Expect = 4.972e-17
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWP-KNPPF---PDR-KAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P KN P    P +  A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   + +  P   K  +E+
Sbjct:   33 LLPMKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEI 173          
BLAST of GAS2-like 3 vs. Ensembl Human
Match: GAS2 (growth arrest specific 2 [Source:HGNC Symbol;Acc:HGNC:4167])

HSP 1 Score: 82.8037 bits (203), Expect = 4.972e-17
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWP-KNPPF---PDR-KAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P KN P    P +  A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   + +  P   K  +E+
Sbjct:   33 LLPMKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEI 173          
BLAST of GAS2-like 3 vs. Ensembl Human
Match: GAS2 (growth arrest specific 2 [Source:HGNC Symbol;Acc:HGNC:4167])

HSP 1 Score: 76.2554 bits (186), Expect = 6.247e-16
Identity = 47/144 (32.64%), Postives = 77/144 (53.47%), Query Frame = 1
Query:   79 MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWP-KNPPF---PDR-KAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEV 495
            M++  + L++ H+  +L      ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P KN P    P +  A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +
Sbjct:   18 MHQYSQWLASRHEANLLP-----MKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRI 155          
BLAST of GAS2-like 3 vs. Ensembl Fly
Match: pigs (gene:FBgn0029881 transcript:FBtr0308653)

HSP 1 Score: 72.4034 bits (176), Expect = 2.486e-13
Identity = 41/159 (25.79%), Postives = 72/159 (45.28%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDR-------------------KAKSGSFKAKDNITLFLNWCR-AIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            E L  +RED+ +W++ L+ +  I  D F+  L  G+ LC   + +       L  +  +N                          AKSG+F A+DN++ F+ WCR ++ ++  +LFET  L     EK+++L LL +      F M  P   +  +++
Sbjct:   17 EYLEAMREDLAEWLSTLYPELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMTRSMTSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQI 175          
BLAST of GAS2-like 3 vs. Ensembl Fly
Match: pigs (gene:FBgn0029881 transcript:FBtr0343375)

HSP 1 Score: 72.4034 bits (176), Expect = 2.486e-13
Identity = 41/159 (25.79%), Postives = 72/159 (45.28%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDR-------------------KAKSGSFKAKDNITLFLNWCR-AIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            E L  +RED+ +W++ L+ +  I  D F+  L  G+ LC   + +       L  +  +N                          AKSG+F A+DN++ F+ WCR ++ ++  +LFET  L     EK+++L LL +      F M  P   +  +++
Sbjct:   17 EYLEAMREDLAEWLSTLYPELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMTRSMTSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQI 175          
BLAST of GAS2-like 3 vs. Ensembl Fly
Match: pigs (gene:FBgn0029881 transcript:FBtr0070948)

HSP 1 Score: 72.4034 bits (176), Expect = 2.486e-13
Identity = 41/159 (25.79%), Postives = 72/159 (45.28%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDR-------------------KAKSGSFKAKDNITLFLNWCR-AIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            E L  +RED+ +W++ L+ +  I  D F+  L  G+ LC   + +       L  +  +N                          AKSG+F A+DN++ F+ WCR ++ ++  +LFET  L     EK+++L LL +      F M  P   +  +++
Sbjct:   17 EYLEAMREDLAEWLSTLYPELSINADNFMDRLDTGVALCKHANYVRQAAVDYLARRQARNKSMTRSMTSGLAGPILAMGNVHYLPAAKSGTFFARDNVSNFITWCRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQI 175          
BLAST of GAS2-like 3 vs. Ensembl Zebrafish
Match: gas2l3 (growth arrest-specific 2 like 3 [Source:ZFIN;Acc:ZDB-GENE-030131-2560])

HSP 1 Score: 79.7221 bits (195), Expect = 1.305e-15
Identity = 45/135 (33.33%), Postives = 72/135 (53.33%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIP----TMLPYK---WPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            L+ ++ED+  W++ +  +Q ++ + F+  L +G+ LC L+  +   IP    T +P K   + KN       A  GSF A+DN   FL+WCR IG+  T LFE+ GL    E + + L LL IG +   + +  P
Sbjct:   53 LVPMQEDLAIWLSGMLGEQ-LSAERFMEELDNGVRLCRLVGILQSKIPEDSETPMPSKKIQFKKN-------ASPGSFFARDNTANFLSWCRHIGVDETYLFESEGLVLHKEPRQVCLCLLEIGRIVSRYGIEPP 179          
BLAST of GAS2-like 3 vs. Ensembl Zebrafish
Match: gas2l1 (growth arrest-specific 2 like 1 [Source:ZFIN;Acc:ZDB-GENE-070705-38])

HSP 1 Score: 75.0998 bits (183), Expect = 1.145e-14
Identity = 47/140 (33.57%), Postives = 67/140 (47.86%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCD-------LIHRIYDHIP-TMLPYKWP-KNPPFPDRKAKSGSFKAKDNITLFLNWCRA-IGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            E L  ++ED+ +W+N L+    IT DTF+  L  G  LC          H    + P   L  + P K+  F  R    GSF A+DN++ F+ WCR  + + + ++FET  L     EKN VL LL +      F M  P
Sbjct:   23 EYLYAMKEDLAEWLNTLYDLD-ITADTFMEGLETGCALCRHANNVNRAAHEFKANCPDAALSLRIPSKDVVFQSRNVIPGSFLARDNVSNFIGWCRQELWIKDVLMFETNDLVERCNEKNFVLCLLEVARRGAKFGMLAP 161          
BLAST of GAS2-like 3 vs. Ensembl Zebrafish
Match: gas2b (growth arrest-specific 2b [Source:ZFIN;Acc:ZDB-GENE-030616-552])

HSP 1 Score: 72.0182 bits (175), Expect = 2.097e-13
Identity = 44/141 (31.21%), Postives = 71/141 (50.35%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHI-------PTMLPY-KWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKF 537
            LL +++D+  W+N++     IT DTF+  L +G+VLC L   + + +       P +    +W      PD  A SGSF A+DN   FL WCR IG+  + LFE+  L      +++ L L+ +G +   + +  P   K 
Sbjct:   33 LLPMKDDLALWLNRILGLD-ITVDTFMDRLDNGVVLCQLAEALQEKMILASNGKPIIRRVIRW-----RPD--AASGSFFARDNTANFLYWCRKIGVEQSHLFESEDLVLQKHPRDVCLCLMQLGRIASRYGIEPPALVKL 165          
BLAST of GAS2-like 3 vs. Ensembl Zebrafish
Match: gas2l1 (growth arrest-specific 2 like 1 [Source:ZFIN;Acc:ZDB-GENE-070705-38])

HSP 1 Score: 72.7886 bits (177), Expect = 2.585e-13
Identity = 47/140 (33.57%), Postives = 67/140 (47.86%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCD-------LIHRIYDHIP-TMLPYKWP-KNPPFPDRKAKSGSFKAKDNITLFLNWCRA-IGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            E L  ++ED+ +W+N L+    IT DTF+  L  G  LC          H    + P   L  + P K+  F  R    GSF A+DN++ F+ WCR  + + + ++FET  L     EKN VL LL +      F M  P
Sbjct:   23 EYLYAMKEDLAEWLNTLYDLD-ITADTFMEGLETGCALCRHANNVNRAAHEFKANCPDAALSLRIPSKDVVFQSRNVIPGSFLARDNVSNFIGWCRQELWIKDVLMFETNDLVERCNEKNFVLCLLEVARRGAKFGMLAP 161          
BLAST of GAS2-like 3 vs. Ensembl Zebrafish
Match: gas2a (growth arrest-specific 2a [Source:ZFIN;Acc:ZDB-GENE-091013-1])

HSP 1 Score: 70.4774 bits (171), Expect = 4.457e-13
Identity = 40/134 (29.85%), Postives = 69/134 (51.49%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIP-----TMLPYKWPKNPPFPDRK-AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            LL ++ED+  W++ +   + I+ ++F+  L +G +LC L   + +           P K       P R  A SG+F A+DN   FL+WCR +G+  T LFE+ GL    +++ + L LL +G +   + +  P
Sbjct:   34 LLPMKEDLALWLSSMLGVE-ISAESFMERLDNGFLLCRLAETLQEKFRENSSDVTSPGKSIPCRRIPCRASAASGTFFARDNTANFLSWCREVGVGETCLFESDGLVLHKQQREVCLCLLELGRIAARYKVEPP 166          
BLAST of GAS2-like 3 vs. Ensembl Xenopus
Match: foxo1 (forkhead box O1 [Source:Xenbase;Acc:XB-GENE-482528])

HSP 1 Score: 82.4185 bits (202), Expect = 6.603e-17
Identity = 49/146 (33.56%), Postives = 73/146 (50.00%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRK---------AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+     K+ IT +TF+  L +G +LC L   + D        K+ +N    +RK         A SGSF A+DN   FL WCR IG+  T LFE+ GL    + + + L LL +G +   F +  P   K  +E+
Sbjct:   33 LLPMKEDLALWLTSFLGKE-ITAETFMEKLDNGALLCQLAETLQD--------KFRENHTDANRKLDKIPYRANAPSGSFFARDNTANFLAWCRNIGVGETCLFESEGLVLHKQPREVCLCLLELGRIAARFGVEPPGLIKLEKEI 169          
BLAST of GAS2-like 3 vs. Ensembl Xenopus
Match: foxo1 (forkhead box O1 [Source:Xenbase;Acc:XB-GENE-482528])

HSP 1 Score: 82.0333 bits (201), Expect = 7.640e-17
Identity = 49/153 (32.03%), Postives = 73/153 (47.71%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDH---------------IPTM-LPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+     K+ IT +TF+  L +G +LC L   + D                +PT  +PY+           A SGSF A+DN   FL WCR IG+  T LFE+ GL    + + + L LL +G +   F +  P   K  +E+
Sbjct:   33 LLPMKEDLALWLTSFLGKE-ITAETFMEKLDNGALLCQLAETLQDKFRENHTDANRKLDKSLPTKKIPYR---------ANAPSGSFFARDNTANFLAWCRNIGVGETCLFESEGLVLHKQPREVCLCLLELGRIAARFGVEPPGLIKLEKEI 175          
BLAST of GAS2-like 3 vs. Ensembl Xenopus
Match: GAS2L3 (growth arrest specific 2 like 3 [Source:NCBI gene;Acc:100489160])

HSP 1 Score: 77.411 bits (189), Expect = 1.229e-14
Identity = 45/132 (34.09%), Postives = 69/132 (52.27%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPF---PDRK-AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            L+ ++ED+  W+  L   +V +GD F+  L +G +LC LI  I   +      +  +  P    P R+ A SGSF A+DN   FL WCR IG+  T LFE+ GL    + + + L LL +G +   + +  P
Sbjct:   47 LVPMQEDLSIWLTGLLGVKV-SGDKFMEELDNGFLLCQLISVIQSTMKQCCTAEELRCVPMRKVPCRRDAPSGSFFARDNTANFLRWCRGIGVDETYLFESEGLVLHKDPRQVCLCLLDVGRIVSRYGVEPP 177          
BLAST of GAS2-like 3 vs. Ensembl Xenopus
Match: bcorl1 (BCL6 corepressor like 1 [Source:Xenbase;Acc:XB-GENE-983529])

HSP 1 Score: 75.0998 bits (183), Expect = 7.526e-14
Identity = 45/160 (28.12%), Postives = 78/160 (48.75%), Query Frame = 1
Query:  100 LSTFHKGQILT--------EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRI----------YDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCR-AIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            +ST+  G + +        E L  ++ED+ +W+  +++ +V   D F+  L +G VLC   + +          Y H+   L  + PK+    +  A+ G+F A+DN++ F+ WCR  + + + ++FET  L     EKN VL LL +      F M  P
Sbjct:    1 MSTYQGGSVRSIRPFKSSEEYLYAMKEDLAEWLKDMYNLEVFV-DNFIEILGNGSVLCQHANNVTEVAREFAVQYPHLAEKL--QLPKSGVKLNMMAQPGTFLARDNVSNFIQWCRKEMDIKDVLMFETEDLVLRKNEKNFVLCLLELARRASRFGMSAP 157          
BLAST of GAS2-like 3 vs. Ensembl Xenopus
Match: nek7 (NIMA-related kinase 7 [Source:Xenbase;Acc:XB-GENE-962512])

HSP 1 Score: 72.0182 bits (175), Expect = 6.628e-13
Identity = 52/165 (31.52%), Postives = 77/165 (46.67%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLC----DLIHRIYD----HIPTMLPYKWP-KNPPFPDRKAKSGSFKAKDNITLFLNWCRA-IGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKF--NQEMMLSKSKITHTTSVY 591
            E L  ++ED+ DW+N L+   +  G TFL +L  G +LC    +L H   D    H       + P K   F  + A  GSF A+DN++ F+ WCR  +G+   ++FET  +     EK+ VL LL +        MP P   +     E  LS+ K  +    Y
Sbjct:   23 EYLEAMKEDLTDWLNMLYDLDMEAG-TFLESLETGYILCQHANNLNHLARDFRQQHPEIAAGMRMPQKEVVFQVKGAVPGSFVARDNVSNFIAWCRQELGIPEVLMFETNDIVLRKGEKSFVLCLLEVARRGARLGMPAPTLIQMEEEIEEELSRGKTGNEQGRY 186          
BLAST of GAS2-like 3 vs. Ensembl Mouse
Match: Gas2l1 (growth arrest-specific 2 like 1 [Source:MGI Symbol;Acc:MGI:1926176])

HSP 1 Score: 82.8037 bits (203), Expect = 4.774e-18
Identity = 45/151 (29.80%), Postives = 72/151 (47.68%), Query Frame = 1
Query:  148 VREDICDWINKLFHKQVI-TGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRA-IGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTSVYA 594
            ++ED+ DW+N L+   +  +GD FLT L  G  LC   + + +    +   +  +   F       GSF A+DN+  F+ WCRA +G+   ++FET  L     EK++VL LL +        +  P   +F QE+          +SV A
Sbjct:   29 MKEDLADWLNALYSLGLPGSGDGFLTGLATGTTLCQHANAVTEAARALAAARPTRGVAFQAHSVAPGSFMARDNVASFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRATPQVSSVPA 179          
BLAST of GAS2-like 3 vs. Ensembl Mouse
Match: Gas2 (growth arrest specific 2 [Source:MGI Symbol;Acc:MGI:95657])

HSP 1 Score: 81.2629 bits (199), Expect = 1.446e-17
Identity = 48/163 (29.45%), Postives = 82/163 (50.31%), Query Frame = 1
Query:   79 MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRK------AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            M++  + L++ H+  +L      ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P     P +K      A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   + +  P   K  +E+
Sbjct:   19 MHQYSQWLASRHEANLLP-----MKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAATVQEKFKESMDANKPAKT-LPLKKIPCKASAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEI 174          
BLAST of GAS2-like 3 vs. Ensembl Mouse
Match: Gas2l1 (growth arrest-specific 2 like 1 [Source:MGI Symbol;Acc:MGI:1926176])

HSP 1 Score: 81.6481 bits (200), Expect = 1.026e-16
Identity = 45/151 (29.80%), Postives = 72/151 (47.68%), Query Frame = 1
Query:  148 VREDICDWINKLFHKQVI-TGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRA-IGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTSVYA 594
            ++ED+ DW+N L+   +  +GD FLT L  G  LC   + + +    +   +  +   F       GSF A+DN+  F+ WCRA +G+   ++FET  L     EK++VL LL +        +  P   +F QE+          +SV A
Sbjct:   29 MKEDLADWLNALYSLGLPGSGDGFLTGLATGTTLCQHANAVTEAARALAAARPTRGVAFQAHSVAPGSFMARDNVASFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRATPQVSSVPA 179          
BLAST of GAS2-like 3 vs. Ensembl Mouse
Match: Gas2 (growth arrest specific 2 [Source:MGI Symbol;Acc:MGI:95657])

HSP 1 Score: 81.2629 bits (199), Expect = 1.217e-16
Identity = 46/143 (32.17%), Postives = 73/143 (51.05%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRK------AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P     P +K      A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   + +  P   K  +E+
Sbjct:   34 LLPMKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAATVQEKFKESMDANKPAKT-LPLKKIPCKASAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEI 174          
BLAST of GAS2-like 3 vs. Ensembl Mouse
Match: Gas2 (growth arrest specific 2 [Source:MGI Symbol;Acc:MGI:95657])

HSP 1 Score: 81.2629 bits (199), Expect = 1.217e-16
Identity = 46/143 (32.17%), Postives = 73/143 (51.05%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRK------AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P     P +K      A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   + +  P   K  +E+
Sbjct:   34 LLPMKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAATVQEKFKESMDANKPAKT-LPLKKIPCKASAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEI 174          
BLAST of GAS2-like 3 vs. UniProt/SwissProt
Match: sp|O43903|GAS2_HUMAN (Growth arrest-specific protein 2 OS=Homo sapiens OX=9606 GN=GAS2 PE=1 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.388e-16
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWP-KNPPF---PDR-KAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P KN P    P +  A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   + +  P   K  +E+
Sbjct:   33 LLPMKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEI 173          
BLAST of GAS2-like 3 vs. UniProt/SwissProt
Match: sp|P11862|GAS2_MOUSE (Growth arrest-specific protein 2 OS=Mus musculus OX=10090 GN=Gas2 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.512e-16
Identity = 46/143 (32.17%), Postives = 73/143 (51.05%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRK------AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+  L  K+ IT +TF+  L +G +LC L   + +     +    P     P +K      A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   + +  P   K  +E+
Sbjct:   34 LLPMKEDLALWLTNLLGKE-ITAETFMEKLDNGALLCQLAATVQEKFKESMDANKPAKT-LPLKKIPCKASAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHKQPREVCLCLLELGRIAARYGVEPPGLIKLEKEI 174          
BLAST of GAS2-like 3 vs. UniProt/SwissProt
Match: sp|Q8JZP9|GA2L1_MOUSE (GAS2-like protein 1 OS=Mus musculus OX=10090 GN=Gas2l1 PE=1 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 1.578e-15
Identity = 50/181 (27.62%), Postives = 80/181 (44.20%), Query Frame = 1
Query:   58 IVKLTNSMNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVI-TGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRA-IGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTSVYA 594
            +  +  S  KS      F   +   E +   +ED+ DW+N L+   +  +GD FLT L  G  LC   + + +    +   +  +   F       GSF A+DN+  F+ WCRA +G+   ++FET  L     EK++VL LL +        +  P   +F QE+          +SV A
Sbjct:    5 VAGIAGSAAKSVRP---FRSSEAYVEAM---KEDLADWLNALYSLGLPGSGDGFLTGLATGTTLCQHANAVTEAARALAAARPTRGVAFQAHSVAPGSFMARDNVASFIGWCRAELGVPEVLMFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIERELRATPQVSSVPA 179          
BLAST of GAS2-like 3 vs. UniProt/SwissProt
Match: sp|A0A1L8H8C0|G2L2S_XENLA (GAS2-like protein 2B OS=Xenopus laevis OX=8355 GN=gas2l2.S PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.797e-15
Identity = 44/141 (31.21%), Postives = 73/141 (51.77%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRI----------YDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCR-AIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            E L  ++ED+ +W+  ++H ++I  D F+  L +G VLC   + +          Y H+   L  + PK+    +  A+ GSF A+DN++ F+ WCR  + + + I+FET  L +   EKN +L LL +      F M  P
Sbjct:   20 EYLYAMKEDLAEWLKDMYHLEIIV-DNFIEILENGSVLCQHANNVTEVAREFFVQYPHLAEKL--QLPKSGVKLNMMAQPGSFLARDNVSNFIQWCRKEMDIKDVIMFETEDLVHRKNEKNFLLCLLELARRASRFGMSAP 157          
BLAST of GAS2-like 3 vs. UniProt/SwissProt
Match: sp|Q3UWW6|GA2L3_MOUSE (GAS2-like protein 3 OS=Mus musculus OX=10090 GN=Gas2l3 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.299e-13
Identity = 47/134 (35.07%), Postives = 70/134 (52.24%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRK------AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            LL ++ED+  W++ L     I  +  L  L +G++LC LI+ + + +        P N  FP RK      A SGSF A+DN   FL+WCR IG+  T LFE+ GL    + + + L LL IG +   + +  P
Sbjct:   49 LLPMQEDLSIWLSGLLGVD-IKAERLLEELDNGVLLCQLINVLQNMVKGCH-SDEPGN--FPMRKVPCKKDAASGSFFARDNTANFLHWCRHIGVDETYLFESEGLVLHKDPRQVYLCLLEIGRIVSRYGVEPP 178          
BLAST of GAS2-like 3 vs. TrEMBL
Match: A0A267EA70 (Calponin-homology (CH) domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007149g1 PE=4 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 5.477e-22
Identity = 49/145 (33.79%), Postives = 84/145 (57.93%), Query Frame = 1
Query:  121 QILTEGLLLVREDICDWINKLFHKQV-ITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLN-TILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            Q L   L L+R+D+C+W+++L      I  + +L  L +G++LC L+ ++             ++P    + A++GSF A+DNI++FL WCR+   L+  +LFET GL    EE+N+VLTLL +   C +  +P P+  +  +E+
Sbjct:   46 QSLDRALELIRDDLCEWLSQLLELSTPIDPENYLDYLENGVLLCRLMQKMQSAAG--------QSPRRCHQSARAGSFLARDNISVFLTWCRSDQRLDDVLLFETSGLVERREERNLVLTLLQLARACPNLGLPAPQIVRLEREI 182          
BLAST of GAS2-like 3 vs. TrEMBL
Match: A0A1I8G7R3 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 6.561e-22
Identity = 49/145 (33.79%), Postives = 84/145 (57.93%), Query Frame = 1
Query:  121 QILTEGLLLVREDICDWINKLFHKQV-ITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLN-TILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            Q L   L L+R+D+C+W+++L      I  + +L  L +G++LC L+ ++             ++P    + A++GSF A+DNI++FL WCR+   L+  +LFET GL    EE+N+VLTLL +   C +  +P P+  +  +E+
Sbjct:   27 QSLDRALELIRDDLCEWLSQLLELSTPIDPENYLDYLENGVLLCRLMQKMQSAAG--------QSPRRCHQSARAGSFLARDNISVFLTWCRSDQRLDDVLLFETSGLVERREERNLVLTLLQLARACPNLGLPAPQIVRLEREI 163          
BLAST of GAS2-like 3 vs. TrEMBL
Match: A0A267GNQ9 (Calponin-homology (CH) domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000617g2 PE=4 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.243e-22
Identity = 49/145 (33.79%), Postives = 84/145 (57.93%), Query Frame = 1
Query:  121 QILTEGLLLVREDICDWINKLFHKQV-ITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLN-TILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            Q L   L L+R+D+C+W+++L      I  + +L  L +G++LC L+ ++             ++P    + A++GSF A+DNI++FL WCR+   L+  +LFET GL    EE+N+VLTLL +   C +  +P P+  +  +E+
Sbjct:   45 QSLDRALELIRDDLCEWLSQLLELSTPIDPENYLDYLENGVLLCRLMQKMQSAAG--------QSPRRCHQSARAGSFLARDNISVFLTWCRSDQRLDDVLLFETSGLVERREERNLVLTLLQLARACPNLGLPAPQIVRLEREI 181          
BLAST of GAS2-like 3 vs. TrEMBL
Match: A0A267E832 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016722g1 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 3.100e-21
Identity = 49/145 (33.79%), Postives = 84/145 (57.93%), Query Frame = 1
Query:  121 QILTEGLLLVREDICDWINKLFHKQV-ITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLN-TILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            Q L   L L+R+D+C+W+++L      I  + +L  L +G++LC L+ ++             ++P    + A++GSF A+DNI++FL WCR+   L+  +LFET GL    EE+N+VLTLL +   C +  +P P+  +  +E+
Sbjct:   46 QSLDRALELIRDDLCEWLSQLLELSTPIDPENYLDYLENGVLLCRLMQKMQSAAG--------QSPRRCHQSARAGSFLARDNISVFLTWCRSDQRLDDVLLFETSGLVERREERNLVLTLLQLARACPNLGLPAPQIVRLEREI 182          
BLAST of GAS2-like 3 vs. TrEMBL
Match: T2M790 (GAS2-like protein 1 OS=Hydra vulgaris OX=6087 GN=GAS2L1 PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.816e-17
Identity = 51/166 (30.72%), Postives = 87/166 (52.41%), Query Frame = 1
Query:   67 LTNSMNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCD---LIHRIYDHIPTMLP---YKWPKNP-PFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQ 543
            L    N + EK     +  +L+  +  +RED+ +WIN L +   +T D FL  L +G++LC    LI R  +    + P    K P  P  + ++ A SGSF A+DN+  ++ WC+ +G+ + I+FE+  L     EK+++L+L+ +      F +  PE  +F Q
Sbjct:    3 LAEGFNIAKEKRHEDTRRNLLSRFVQAMREDLSEWINSLSYNVELTPDNFLPGLDNGVILCQQARLIQRFAEEYAVLNPNENLKIPSKPVRYTEKGAFSGSFVARDNVANYIAWCKELGIQDVIIFESDDLVLHKNEKSVILSLMDVARKAYKFGVRPPEIVRFEQ 168          
BLAST of GAS2-like 3 vs. Ensembl Cavefish
Match: gas2a (growth arrest specific 2 [Source:NCBI gene;Acc:103043407])

HSP 1 Score: 87.0409 bits (214), Expect = 9.998e-19
Identity = 46/143 (32.17%), Postives = 73/143 (51.05%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRK------AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+  +   + IT D+F+  L +G +LC L   + +          P   P P+R+      A SGSF A+DN   FL+WCR +G+  T LFE+ GL    + + + L LL +G +   F +  P   K  +E+
Sbjct:   34 LLPMKEDLALWLTSMLGVE-ITADSFMDRLDNGFLLCQLAETLQEKFRQSNGELSPPGKPIPNRRIPCRASAPSGSFFARDNTANFLSWCREVGVGETCLFESEGLVLHKQPREVCLCLLELGRIASRFKVEPPGLIKLEKEI 175          
BLAST of GAS2-like 3 vs. Ensembl Cavefish
Match: gas2l1 (growth arrest specific 2 like 1 [Source:NCBI gene;Acc:103028235])

HSP 1 Score: 85.5001 bits (210), Expect = 2.179e-17
Identity = 44/140 (31.43%), Postives = 76/140 (54.29%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRA-IGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            E L  ++ED+ +W++ L+    IT +TF+ +L  G VLC+  + +        P++  ++  +  R A  GSF A+DN++ F+ WCR+ + + + ++FET  L     EKN VL LL +      F +P P   +  QE+
Sbjct:   24 EYLYAMKEDLAEWLHGLYGLD-ITVETFMESLETGCVLCNHANNVNRAARPFQPHRPWQDVAYQSRGAMPGSFVARDNVSNFIGWCRSELRVKDVLMFETNDLVERGSEKNFVLCLLEVARRGARFGVPAPVLVQLEQEI 162          
BLAST of GAS2-like 3 vs. Ensembl Cavefish
Match: gas2b (growth arrest-specific protein 2-like [Source:NCBI gene;Acc:103023159])

HSP 1 Score: 69.3218 bits (168), Expect = 9.671e-13
Identity = 43/149 (28.86%), Postives = 70/149 (46.98%), Query Frame = 1
Query:   94 EKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDR------KAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            E LS  H+  +L      ++ED+  W+N +     IT + F+  L +G VLC L   + + +  +   K     PF  R       A  GSF A+DN   FL WCR +G+  + LFE+  L      +++ L L+ +G +   + +  P
Sbjct:   23 EWLSCRHEASLLP-----MKEDLALWLNTILGLN-ITAENFMDVLENGAVLCQLAEELQERMILVNSGK-----PFIRRVIRWRADAAPGSFFARDNTANFLYWCRKVGVGESHLFESEDLVLHRHPRDVCLCLMQLGRIAAKYGIDAP 160          
BLAST of GAS2-like 3 vs. Ensembl Cavefish
Match: gas2b (growth arrest-specific protein 2-like [Source:NCBI gene;Acc:103023159])

HSP 1 Score: 68.5514 bits (166), Expect = 3.175e-12
Identity = 44/149 (29.53%), Postives = 70/149 (46.98%), Query Frame = 1
Query:   94 EKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDR------KAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            E LS  H+       LL ++ED+  W+N +     IT + F+  L +G VLC L   + + +  +   K     PF  R       A  GSF A+DN   FL WCR +G+  + LFE+  L      +++ L L+ +G +   + +  P
Sbjct:   23 EWLSCRHEAS-----LLPMKEDLALWLNTILGLN-ITAENFMDVLENGAVLCQLAEELQERMILVNSGK-----PFIRRVIRWRADAAPGSFFARDNTANFLYWCRKVGVGESHLFESEDLVLHRHPRDVCLCLMQLGRIAAKYGIDAP 160          
BLAST of GAS2-like 3 vs. Ensembl Cavefish
Match: gas2l2 (growth arrest specific 2 like 2 [Source:ZFIN;Acc:ZDB-GENE-170206-1])

HSP 1 Score: 66.2402 bits (160), Expect = 4.675e-12
Identity = 39/137 (28.47%), Postives = 67/137 (48.91%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRI------YDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCR-AIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVP 522
            E L  ++ED+ +W+  L+    +T +  L  +  G++LCD  + +      + H       + P +     R A+  +F A+DN++ F+NWCR  + + + ++FET  L     EKN VL LL +      F M  P
Sbjct:   20 EYLYAMKEDLAEWLKDLYRLD-LTVNNLLELMETGVLLCDHANNVTRVAEDFGHKHGHTHLQLPTSGVTFVRSAQPATFLARDNVSNFINWCRNQMYIKDVLMFETDDLVLRKNEKNFVLCLLEVARRASRFGMAAP 155          
BLAST of GAS2-like 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002497.1 (pep scaffold:Pmarinus_7.0:GL476638:223513:267757:1 gene:ENSPMAG00000002275.1 transcript:ENSPMAT00000002497.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 4.699e-15
Identity = 40/151 (26.49%), Postives = 77/151 (50.99%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQV-ITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRK-AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTS 585
            L+ ++ED+  W+ ++  +   I  +TF+  + +G++LC L   +    P     ++P+    P R  A +G+F A+DN   FL WCR  G+  + +FE+ GL    + + + L LL +G +   F +  P   K  +E+   +++    +S
Sbjct:   31 LIPMKEDLAMWLTEILGECTEIRAETFMEQIDNGVLLCRLGSILQAKXPFSAHQRFPRRK-IPCRANAPAGTFFARDNTANFLAWCREAGVDESCMFESEGLVLHKQPREVCLCLLELGRIAARFGIDPPGLIKLEKEIEQEEARAIARSS 180          
BLAST of GAS2-like 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002308.1 (pep scaffold:Pmarinus_7.0:GL477003:24840:25679:-1 gene:ENSPMAG00000002103.1 transcript:ENSPMAT00000002308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 3.587e-10
Identity = 37/147 (25.17%), Postives = 60/147 (40.82%), Query Frame = 1
Query:  148 VREDICDWINKLFHKQV--ITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWP---KNPPFPDRKAKSGSFKAKDNITLFLNWCRA-IGLLNTILFETRGLA-------NSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            ++ED+  W+N +F      ++ D F  TL  G  LC L + +          + P    NP          +F A+D +  FL WCR+ +G+   + FET  L            E+ +VL LL +         P PE     +++
Sbjct:   29 MKEDLAQWLNVIFSDVAFDVSADNFTATLSAGWPLCRLANAVSRWALDCSRARDPGQGSNPGLGAHGLPRATFAARDRVATFLGWCRSELGIPEHLTFETNDLMEVGRQERRGGGERQVVLCLLEVARRGARMGGPAPELVMLERDI 175          
BLAST of GAS2-like 3 vs. Ensembl Nematostella
Match: EDO33092 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST60])

HSP 1 Score: 85.8853 bits (211), Expect = 3.270e-19
Identity = 47/150 (31.33%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFP-------------DRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            L+ ++ED+  WI++L  ++ +  DTF + L  G+VLC    R+ + I T+    + +NP FP              R A  GSF A+DN++ F+ WCR + + + I+FET  L  +  EK ++LTLL +        +  PE  +   E+
Sbjct:    5 LIPLKEDLASWISRLLGEEELNTDTFTSMLDTGVVLC----RLANFIQTVGEEFFVRNPKFPRRGLFPACGVTYKQRGATHGSFVARDNVSNFIRWCRELRVPDVIMFETEDLVLNKNEKTVLLTLLEVARKAFKVGVEPPELVRLENEI 150          
BLAST of GAS2-like 3 vs. Ensembl Nematostella
Match: EDO41193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S571])

HSP 1 Score: 80.1073 bits (196), Expect = 5.587e-17
Identity = 40/145 (27.59%), Postives = 75/145 (51.72%), Query Frame = 1
Query:  133 EGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRI------YDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            E L  ++ED+ +W++++   +V   D F+  L +G++LC L   I      +  I   +    P       + AKSG+F A+DN   FL WC+ +G+ ++++FE+ GL    + + ++L LL +     +F +  P   K  +E+
Sbjct:   36 EDLNPLKEDLAEWLSRVLEVEV-QADNFMDYLDNGVLLCKLAQLIQKAATEWIKIDKAMSVTLPSLGSRFHQNAKSGTFFARDNAAYFLKWCKGVGIQDSVMFESDGLVLQKQPREVLLCLLDVARFAANFGIDPPNLVKLEKEI 179          
BLAST of GAS2-like 3 vs. Ensembl Nematostella
Match: EDO32825 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STY7])

HSP 1 Score: 68.1662 bits (165), Expect = 2.382e-13
Identity = 48/165 (29.09%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  100 LSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAK----------SGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDE----EKNIVLTLLHIGEVCVDFSM-PVPEFAKFNQEM 549
            + +F + +   E L  + ED   W+ KLF + +IT D F   L DG +LC L + I +   T   Y    N   P +K K          S  F +++N+  FL WCR   +   ILFE+  +   DE     + IV+ L+ I    + + +  VP+  +  QE+
Sbjct:   33 VQSFQRWEKENELLYAMIEDETAWLAKLFTEIIITPDFFFYALEDGTLLCKLANYIQEMADT---YGQKHNTHVPGKKIKFKESKRGHRESKLFHSRENVQKFLTWCRWHDIPEAILFESNDVVLVDECRTGGREIVICLMEIARRVIKYEIKQVPKLIQLEQEI 194          
BLAST of GAS2-like 3 vs. Ensembl Medaka
Match: gas2a (growth arrest specific 2 [Source:NCBI gene;Acc:101174828])

HSP 1 Score: 78.1814 bits (191), Expect = 9.236e-16
Identity = 46/145 (31.72%), Postives = 73/145 (50.34%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHI-------PTMLPYKWPKNPPFPDRK-AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+  +   + IT + F+  L +G +LC L   + +         P +   K   N   P R+ A SGSF A+DN   FL WCR +G+  T LFE+ GL    E + + L LL +G +   +++  P   K  +E+
Sbjct:   33 LLPMKEDLALWLTNILGLE-ITAENFMDRLDNGFLLCRLAETLQEKFRQSIEDFPNLGNGKRIPNRRIPCRQSAPSGSFFARDNTANFLAWCREVGVGETCLFESEGLVLHREPREVCLCLLELGRIASRYNIEPPGLIKLEKEI 176          
BLAST of GAS2-like 3 vs. Ensembl Medaka
Match: gas2a (growth arrest specific 2 [Source:NCBI gene;Acc:101174828])

HSP 1 Score: 78.1814 bits (191), Expect = 1.090e-15
Identity = 46/145 (31.72%), Postives = 73/145 (50.34%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHI-------PTMLPYKWPKNPPFPDRK-AKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            LL ++ED+  W+  +   + IT + F+  L +G +LC L   + +         P +   K   N   P R+ A SGSF A+DN   FL WCR +G+  T LFE+ GL    E + + L LL +G +   +++  P   K  +E+
Sbjct:   33 LLPMKEDLALWLTNILGLE-ITAENFMDRLDNGFLLCRLAETLQEKFRQSIEDFPNLGNGKRIPNRRIPCRQSAPSGSFFARDNTANFLAWCREVGVGETCLFESEGLVLHREPREVCLCLLELGRIASRYNIEPPGLIKLEKEI 176          
BLAST of GAS2-like 3 vs. Ensembl Medaka
Match: gas2l3 (GAS2-like protein 3 [Source:NCBI gene;Acc:101175284])

HSP 1 Score: 79.7221 bits (195), Expect = 1.152e-15
Identity = 46/150 (30.67%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFP------DRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKI 570
            L+ ++ED+  W++ L  ++V   + F+  L++G+ LC LI  +   +    P +  K   FP       R A  GSF A+DN   FL WCR IG+  T LFE+ GL    + + + L LL IG +   + +  P   K  +E+ + ++++
Sbjct:   55 LVPMQEDLAIWLSSLLGEEV-RAEFFMEELNNGVRLCQLIGVLQAKVNQNGPPERSKL--FPTKTVACKRDASPGSFFARDNTANFLAWCRRIGVEETYLFESEGLVLHKDPRQVCLCLLEIGRIVSKYGVEPPVLVKLEKEIEMEETRL 201          
BLAST of GAS2-like 3 vs. Ensembl Medaka
Match: gas2l3 (GAS2-like protein 3 [Source:NCBI gene;Acc:101175284])

HSP 1 Score: 79.7221 bits (195), Expect = 1.152e-15
Identity = 46/150 (30.67%), Postives = 78/150 (52.00%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFP------DRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKI 570
            L+ ++ED+  W++ L  ++V   + F+  L++G+ LC LI  +   +    P +  K   FP       R A  GSF A+DN   FL WCR IG+  T LFE+ GL    + + + L LL IG +   + +  P   K  +E+ + ++++
Sbjct:   55 LVPMQEDLAIWLSSLLGEEV-RAEFFMEELNNGVRLCQLIGVLQAKVNQNGPPERSKL--FPTKTVACKRDASPGSFFARDNTANFLAWCRRIGVEETYLFESEGLVLHKDPRQVCLCLLEIGRIVSKYGVEPPVLVKLEKEIEMEETRL 201          
BLAST of GAS2-like 3 vs. Ensembl Medaka
Match: gas2b (growth arrest-specific protein 2-like [Source:NCBI gene;Acc:101166700])

HSP 1 Score: 70.4774 bits (171), Expect = 3.887e-13
Identity = 42/139 (30.22%), Postives = 68/139 (48.92%), Query Frame = 1
Query:  139 LLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDR------KAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKF 537
            LL ++ED+  W+N +     +T D  +  L +G+VLC L   + + +  +      K+ PF  R       A SGSF A+DN   FL WCR IG+  + LFE+  L    + + + L L+ +G +   + +  P   K 
Sbjct:   34 LLPMKEDLALWLNNIMGVN-LTADCLMEQLDNGVVLCQLAKLLQEKMTNV---NTAKSQPFVRRVIHWRADATSGSFFARDNTANFLYWCRKIGVDESYLFESEDLVLHKQPREVCLCLMDVGRIAARYGVEPPGLVKL 168          
BLAST of GAS2-like 3 vs. Planmine SMEST
Match: SMESG000003788.1 (SMESG000003788.1)

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 350/351 (99.72%), Postives = 351/351 (100.00%), Query Frame = 1
Query:   79 MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTSVYALGDTSDLGSMESGSLSARSESNIFDAFDSERSVSIGRESIDNSESIQEIFPQIIVPIKDHSSSNQIQTKRKSSKTQEKSPSDKIVDTTLDILKDVHIEQENKKEEKIPDNKVIKYTKKVNSYSIKNLKAVKCGVGGFNDSHELKKKLIRSKSRDSVVNIPESDSPICHRHSNSGNVELK 1131
            MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTSVYALGDTSDLGSMESGSLSARSESNIFDAFDSERSVSIGRESIDNSESIQEI+PQIIVPIKDHSSSNQIQTKRKSSKTQEKSPSDKIVDTTLDILKDVHIEQENKKEEKIPDNKVIKYTKKVNSYSIKNLKAVKCGVGGFNDSHELKKKLIRSKSRDSVVNIPESDSPICHRHSNSGNVELK
Sbjct:    1 MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTSVYALGDTSDLGSMESGSLSARSESNIFDAFDSERSVSIGRESIDNSESIQEIYPQIIVPIKDHSSSNQIQTKRKSSKTQEKSPSDKIVDTTLDILKDVHIEQENKKEEKIPDNKVIKYTKKVNSYSIKNLKAVKCGVGGFNDSHELKKKLIRSKSRDSVVNIPESDSPICHRHSNSGNVELK 351          
BLAST of GAS2-like 3 vs. Planmine SMEST
Match: SMESG000003788.1 (SMESG000003788.1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 263/264 (99.62%), Postives = 264/264 (100.00%), Query Frame = 1
Query:   79 MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTSVYALGDTSDLGSMESGSLSARSESNIFDAFDSERSVSIGRESIDNSESIQEIFPQIIVPIKDHSSSNQIQTKRKSSKTQEKSPSDKIVDTTLDIL 870
            MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTSVYALGDTSDLGSMESGSLSARSESNIFDAFDSERSVSIGRESIDNSESIQEI+PQIIVPIKDHSSSNQIQTKRKSSKTQEKSPSDKIVDTTLDIL
Sbjct:    1 MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTLHDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEMMLSKSKITHTTSVYALGDTSDLGSMESGSLSARSESNIFDAFDSERSVSIGRESIDNSESIQEIYPQIIVPIKDHSSSNQIQTKRKSSKTQEKSPSDKIVDTTLDIL 264          
BLAST of GAS2-like 3 vs. Planmine SMEST
Match: SMESG000041563.1 (SMESG000041563.1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.148e-12
Identity = 41/155 (26.45%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  154 EDICDWINKLFH---KQVITGDTFLTTLHDGIVL----------CDLIHRIYDHIPTMLPYKW-------PKNPP---FPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            ED+CDW+N L+    +  +T   F + L DG++L           ++  ++ ++    LP K        P NPP     D  A   SF  +DN+  F+ WCR   +  ++ FE+  L      +N+V+ LL +  +   F M VP+  +  +++
Sbjct:   31 EDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDI 185          
BLAST of GAS2-like 3 vs. Planmine SMEST
Match: SMESG000041563.1 (SMESG000041563.1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.164e-12
Identity = 41/155 (26.45%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  154 EDICDWINKLFH---KQVITGDTFLTTLHDGIVL----------CDLIHRIYDHIPTMLPYKW-------PKNPP---FPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            ED+CDW+N L+    +  +T   F + L DG++L           ++  ++ ++    LP K        P NPP     D  A   SF  +DN+  F+ WCR   +  ++ FE+  L      +N+V+ LL +  +   F M VP+  +  +++
Sbjct:   33 EDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDI 187          
BLAST of GAS2-like 3 vs. Planmine SMEST
Match: SMESG000041563.1 (SMESG000041563.1)

HSP 1 Score: 67.3958 bits (163), Expect = 7.520e-12
Identity = 41/155 (26.45%), Postives = 72/155 (46.45%), Query Frame = 1
Query:  154 EDICDWINKLFH---KQVITGDTFLTTLHDGIVL----------CDLIHRIYDHIPTMLPYKW-------PKNPP---FPDRKAKSGSFKAKDNITLFLNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEFAKFNQEM 549
            ED+CDW+N L+    +  +T   F + L DG++L           ++  ++ ++    LP K        P NPP     D  A   SF  +DN+  F+ WCR   +  ++ FE+  L      +N+V+ LL +  +   F M VP+  +  +++
Sbjct:   53 EDLCDWLNFLYKLDDENKMTPSRFFSQLQDGVILNKHANSVQYLAEIYLKLKNNSSRDLPLKIGNRFIKVPINPPKYVIRDFSAPMNSFHKRDNVANFIQWCRDFNIPPSLTFESEDLILMKLPRNVVVCLLEVARIGKLFGMEVPDIIQLEEDI 207          
The following BLAST results are available for this feature:
BLAST of GAS2-like 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAS25.920e-1830.86growth arrest specific 2 [Source:HGNC Symbol;Acc:H... [more]
GAS21.152e-1730.86growth arrest specific 2 [Source:HGNC Symbol;Acc:H... [more]
GAS24.972e-1733.80growth arrest specific 2 [Source:HGNC Symbol;Acc:H... [more]
GAS24.972e-1733.80growth arrest specific 2 [Source:HGNC Symbol;Acc:H... [more]
GAS26.247e-1632.64growth arrest specific 2 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of GAS2-like 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GAS2-like 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pigs2.486e-1325.79gene:FBgn0029881 transcript:FBtr0308653[more]
pigs2.486e-1325.79gene:FBgn0029881 transcript:FBtr0343375[more]
pigs2.486e-1325.79gene:FBgn0029881 transcript:FBtr0070948[more]
back to top
BLAST of GAS2-like 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gas2l31.305e-1533.33growth arrest-specific 2 like 3 [Source:ZFIN;Acc:Z... [more]
gas2l11.145e-1433.57growth arrest-specific 2 like 1 [Source:ZFIN;Acc:Z... [more]
gas2b2.097e-1331.21growth arrest-specific 2b [Source:ZFIN;Acc:ZDB-GEN... [more]
gas2l12.585e-1333.57growth arrest-specific 2 like 1 [Source:ZFIN;Acc:Z... [more]
gas2a4.457e-1329.85growth arrest-specific 2a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of GAS2-like 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxo16.603e-1733.56forkhead box O1 [Source:Xenbase;Acc:XB-GENE-482528... [more]
foxo17.640e-1732.03forkhead box O1 [Source:Xenbase;Acc:XB-GENE-482528... [more]
GAS2L31.229e-1434.09growth arrest specific 2 like 3 [Source:NCBI gene;... [more]
bcorl17.526e-1428.13BCL6 corepressor like 1 [Source:Xenbase;Acc:XB-GEN... [more]
nek76.628e-1331.52NIMA-related kinase 7 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of GAS2-like 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gas2l14.774e-1829.80growth arrest-specific 2 like 1 [Source:MGI Symbol... [more]
Gas21.446e-1729.45growth arrest specific 2 [Source:MGI Symbol;Acc:MG... [more]
Gas2l11.026e-1629.80growth arrest-specific 2 like 1 [Source:MGI Symbol... [more]
Gas21.217e-1632.17growth arrest specific 2 [Source:MGI Symbol;Acc:MG... [more]
Gas21.217e-1632.17growth arrest specific 2 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of GAS2-like 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43903|GAS2_HUMAN2.388e-1633.80Growth arrest-specific protein 2 OS=Homo sapiens O... [more]
sp|P11862|GAS2_MOUSE8.512e-1632.17Growth arrest-specific protein 2 OS=Mus musculus O... [more]
sp|Q8JZP9|GA2L1_MOUSE1.578e-1527.62GAS2-like protein 1 OS=Mus musculus OX=10090 GN=Ga... [more]
sp|A0A1L8H8C0|G2L2S_XENLA6.797e-1531.21GAS2-like protein 2B OS=Xenopus laevis OX=8355 GN=... [more]
sp|Q3UWW6|GA2L3_MOUSE1.299e-1335.07GAS2-like protein 3 OS=Mus musculus OX=10090 GN=Ga... [more]
back to top
BLAST of GAS2-like 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EA705.477e-2233.79Calponin-homology (CH) domain-containing protein (... [more]
A0A1I8G7R36.561e-2233.79Calponin-homology (CH) domain-containing protein O... [more]
A0A267GNQ98.243e-2233.79Calponin-homology (CH) domain-containing protein (... [more]
A0A267E8323.100e-2133.79Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
T2M7901.816e-1730.72GAS2-like protein 1 OS=Hydra vulgaris OX=6087 GN=G... [more]
back to top
BLAST of GAS2-like 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gas2a9.998e-1932.17growth arrest specific 2 [Source:NCBI gene;Acc:103... [more]
gas2l12.179e-1731.43growth arrest specific 2 like 1 [Source:NCBI gene;... [more]
gas2b9.671e-1328.86growth arrest-specific protein 2-like [Source:NCBI... [more]
gas2b3.175e-1229.53growth arrest-specific protein 2-like [Source:NCBI... [more]
gas2l24.675e-1228.47growth arrest specific 2 like 2 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of GAS2-like 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002497.14.699e-1526.49pep scaffold:Pmarinus_7.0:GL476638:223513:267757:1... [more]
ENSPMAT00000002308.13.587e-1025.17pep scaffold:Pmarinus_7.0:GL477003:24840:25679:-1 ... [more]
back to top
BLAST of GAS2-like 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GAS2-like 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO330923.270e-1931.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411935.587e-1727.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328252.382e-1329.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GAS2-like 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gas2a9.236e-1631.72growth arrest specific 2 [Source:NCBI gene;Acc:101... [more]
gas2a1.090e-1531.72growth arrest specific 2 [Source:NCBI gene;Acc:101... [more]
gas2l31.152e-1530.67GAS2-like protein 3 [Source:NCBI gene;Acc:10117528... [more]
gas2l31.152e-1530.67GAS2-like protein 3 [Source:NCBI gene;Acc:10117528... [more]
gas2b3.887e-1330.22growth arrest-specific protein 2-like [Source:NCBI... [more]
back to top
BLAST of GAS2-like 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003788.10.000e+099.72SMESG000003788.1[more]
SMESG000003788.10.000e+099.62SMESG000003788.1[more]
SMESG000041563.17.148e-1226.45SMESG000041563.1[more]
SMESG000041563.17.164e-1226.45SMESG000041563.1[more]
SMESG000041563.17.520e-1226.45SMESG000041563.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026157 ID=SMED30026157|Name=GAS2-like 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1224bp
GATTAATGTAATAAACTCATTGTAAGGTCATATTTGAACGTATTATTATG
TATCGTAATTGTAAAATTAACGAATTCAATGAATAAGAGCTTTGAAAAAT
TATCAACATTTCATAAGGGTCAAATTCTCACTGAAGGTCTGCTTCTTGTA
AGAGAAGACATTTGTGATTGGATTAATAAATTATTTCATAAACAAGTTAT
TACTGGTGATACGTTTCTAACAACTTTGCATGATGGAATAGTGCTTTGTG
ACCTTATTCATAGGATATACGATCATATTCCAACCATGTTGCCTTATAAA
TGGCCTAAAAACCCACCATTTCCAGATCGGAAAGCTAAAAGTGGGTCATT
CAAAGCCAAAGATAATATTACATTATTTTTAAATTGGTGTCGAGCAATTG
GTCTGTTAAATACTATATTATTTGAAACAAGAGGACTGGCCAATAGTGAT
GAAGAAAAGAATATCGTTCTTACTTTATTGCATATTGGAGAAGTCTGCGT
TGATTTTAGTATGCCAGTGCCTGAATTCGCAAAATTTAACCAGGAAATGA
TGTTATCCAAAAGTAAAATAACTCATACTACATCAGTTTATGCACTGGGA
GATACAAGTGATCTTGGGTCGATGGAAAGTGGTTCTCTGTCTGCCAGGTC
GGAATCGAATATCTTTGATGCGTTTGATTCTGAACGATCTGTTAGCATTG
GGCGAGAGTCCATCGATAATTCAGAGAGTATCCAGGAGATTTTTCCACAG
ATTATTGTTCCTATCAAAGATCATAGTTCTTCTAATCAGATACAAACCAA
AAGGAAGTCATCAAAAACTCAAGAGAAGTCTCCGTCAGATAAAATAGTTG
ATACTACATTGGATATATTGAAGGATGTACACATTGAACAGGAAAATAAA
AAAGAAGAAAAAATTCCAGATAACAAGGTGATAAAATATACGAAAAAAGT
CAATAGTTATAGCATTAAAAATTTAAAAGCCGTCAAATGTGGAGTGGGCG
GATTCAATGATAGCCACGAATTGAAAAAGAAACTAATCCGATCAAAAAGC
CGAGATTCCGTAGTTAACATTCCTGAATCCGACTCGCCCATTTGTCATAG
GCATTCGAATTCTGGCAATGTTGAGTTAAAGGAAAGTTTTGTCCTTTAGA
ATGTTTTCCCAAAAAATCACCGCAAATAAATAACTCATTCTTTATTAGAT
TAACAGAACTTCTGTTTCTGTCTT
back to top

protein sequence of SMED30026157-orf-1

>SMED30026157-orf-1 ID=SMED30026157-orf-1|Name=SMED30026157-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=357bp
MNKSFEKLSTFHKGQILTEGLLLVREDICDWINKLFHKQVITGDTFLTTL
HDGIVLCDLIHRIYDHIPTMLPYKWPKNPPFPDRKAKSGSFKAKDNITLF
LNWCRAIGLLNTILFETRGLANSDEEKNIVLTLLHIGEVCVDFSMPVPEF
AKFNQEMMLSKSKITHTTSVYALGDTSDLGSMESGSLSARSESNIFDAFD
SERSVSIGRESIDNSESIQEIFPQIIVPIKDHSSSNQIQTKRKSSKTQEK
SPSDKIVDTTLDILKDVHIEQENKKEEKIPDNKVIKYTKKVNSYSIKNLK
AVKCGVGGFNDSHELKKKLIRSKSRDSVVNIPESDSPICHRHSNSGNVEL
KESFVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
GO:0030036actin cytoskeleton organization
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0005515protein binding
GO:0008017microtubule binding
GO:0008093cytoskeletal adaptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR001715CH-domain
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton