WD repeat domain 82

Overview
NameWD repeat domain 82
Smed IDSMED30026151
Length (bp)1462
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat domain 82 (SMED30026151) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat domain 82 (SMED30026151) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat domain 82 (SMED30026151) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat domain 82 (SMED30026151) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026151

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026151SMESG000059185.1 SMESG000059184.1 SmedASXL_016182SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026151SMESG000059185.1 SMESG000059184.1 SmedASXL_016182SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30026151SMESG000059185.1 SmedASXL_016183SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026151SMESG000059185.1 SmedASXL_016183SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30026151SMESG000059185.1 dd_Smed_v4_3926_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026151SMESG000059185.1 SMESG000059184.1 Contig17161uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026151SMESG000059185.1 SMESG000059184.1 Contig17161newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026151SMESG000059185.1 Contig48101uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026151SMESG000059185.1 Contig48101newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30026151SMESG000059185.1 DN305959ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30026151SMESG000059185.1 DN305959ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026151SMESG000059185.1 DN305959ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30026151SMESG000059185.1 DN297595ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30026151SMESG000059185.1 DN297595ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026151SMESG000059185.1 DN297595ncbi_smed_estsPMID:23235145
Hubert et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat domain 82 vs. Ensembl Human
Match: WDR82 (WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:28826])

HSP 1 Score: 320.087 bits (819), Expect = 4.109e-106
Identity = 155/335 (46.27%), Postives = 220/335 (65.67%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D  LRS+   K F++NSDK+N  +F+ NGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH+K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF +          + + L+FS DGK++L+S  G+ I L+D+F G  +H       NS  + + A FTPDS++IM GS +G++++W   +  ++A+L     G                   I  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKM----QYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYA-NSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGP------------------ITCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. Ensembl Human
Match: WDR82 (WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:28826])

HSP 1 Score: 108.612 bits (270), Expect = 2.453e-28
Identity = 48/73 (65.75%), Postives = 59/73 (80.82%), Query Frame = 1
Query:  373 MSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTF 591
            MSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF
Sbjct:    1 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATF 73          
BLAST of WD repeat domain 82 vs. Ensembl Human
Match: WDR5 (WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12757])

HSP 1 Score: 95.1301 bits (235), Expect = 6.401e-21
Identity = 67/263 (25.48%), Postives = 130/263 (49.43%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+++ F+ NGE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L      G  + +  I A F+    ++I++GS +  +YIW +   + +  LQ
Sbjct:   48 VSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 298          

HSP 2 Score: 55.0694 bits (131), Expect = 1.399e-7
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 1
Query:   43 DDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGH--TKKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            D+S+R ++     C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y GH   K  I  + S T   ++ SGS D  + +W+L+T      +Q
Sbjct:  150 DESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 298          

HSP 3 Score: 52.7582 bits (125), Expect = 7.103e-7
Identity = 38/129 (29.46%), Postives = 67/129 (51.94%), Query Frame = 1
Query:   58 SYECFKCF-KDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C K    D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DNL Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI+LW
Sbjct:  202 SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330          

HSP 4 Score: 51.2174 bits (121), Expect = 2.385e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  116 VSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 248          
BLAST of WD repeat domain 82 vs. Ensembl Human
Match: WDR5B (WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:17826])

HSP 1 Score: 92.4337 bits (228), Expect = 6.160e-20
Identity = 65/267 (24.34%), Postives = 133/267 (49.81%), Query Frame = 1
Query:   88 NSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            +++ V+++ F+ NGE L SSS D  I ++   +GK+ +T+Y     +  + ++  S+ ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+T+++W+++T  C   +      ++A+  +  G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   GR L      G  + +  I A F+    ++I++GS +  +YIW +   + +  LQ
Sbjct:   40 HTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSSRLVSASD--DKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQ-------CLKTLVDDDNP-PVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 294          

HSP 2 Score: 53.1434 bits (126), Expect = 4.802e-7
Identity = 41/142 (28.87%), Postives = 68/142 (47.89%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            +KL D  +RS +C K  K +S+ V   NF      +IS S D+++ +++V  GK L+T+ +    V  + F +CS ++I  S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  107 LKLWD--VRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHF-NCSGSLI-VSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRC 244          

HSP 3 Score: 51.6026 bits (122), Expect = 1.880e-6
Identity = 36/127 (28.35%), Postives = 66/127 (51.97%), Query Frame = 1
Query:   64 ECFKCFKDNSDK-VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            +C K   D+ +  V+ + F+ NG+ +++++ D+++ ++D   G+ L+T    K     I      T      +  +DNL Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI+LW
Sbjct:  200 QCLKTLVDDDNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLW 326          
BLAST of WD repeat domain 82 vs. Ensembl Human
Match: WDR82 (WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:28826])

HSP 1 Score: 76.2554 bits (186), Expect = 4.552e-17
Identity = 34/47 (72.34%), Postives = 39/47 (82.98%), Query Frame = 1
Query:  373 MSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLI 513
            MSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLI
Sbjct:    1 MSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLI 47          
BLAST of WD repeat domain 82 vs. Ensembl Celegans
Match: swd-2.2 (Set1 WD40 repeat protein [Source:UniProtKB/TrEMBL;Acc:Q18403])

HSP 1 Score: 219.55 bits (558), Expect = 2.363e-67
Identity = 117/282 (41.49%), Postives = 179/282 (63.48%), Query Frame = 1
Query:   28 KMKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIAL 873
            ++++  +SL      K   D + +VN++++   G+ +I S+ DDS+ +YD+  G   +++ SKKYG   +KF   S   +H S KVD+ +RYLSL DNKYIR + GH K V  +++SP +D FLS + DKTIRLWDL+T NC  LM L    +A  DPEGL+F   + ++  KLYDLR+F++GPF +F   PL +E N V+ +++RFSP GK +++    +Q+ L+D+FTG     L+    N+ +I + A FTP+S +IM GS +G +Y + V   + IAL
Sbjct:    5 EVEITAESLAKLTPAKQPNDTTTRVNSLSYGLKGDHMIMSTDDDSMFLYDMNTGLRSRSVNSKKYGCSHVKFASDSMCALHGSTKVDNTIRYLSLTDNKYIRYFQGHDKLVTGINVSPMDDMFLSVAEDKTIRLWDLKTHNCIGLMNLSATPIATFDPEGLLFAAGLDNNIIKLYDLRSFDKGPFSSFG--PLENEDN-VEWTAMRFSPCGKYIMICTNSSQLLLVDAFTGLIKFTLE-EHQNAQKIPLMASFTPESSHIMVGSSDGYIYFYDVETGE-IAL 281          
BLAST of WD repeat domain 82 vs. Ensembl Celegans
Match: swd-2.1 (Set1 WD40 repeat protein [Source:UniProtKB/TrEMBL;Acc:Q18404])

HSP 1 Score: 134.806 bits (338), Expect = 1.816e-35
Identity = 92/319 (28.84%), Postives = 154/319 (48.28%), Query Frame = 1
Query:   73 KCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTN-DTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMP 1026
            K F + S+K+  + ++ +G  LI S++D  + VYD+ +G   ++I  KKYGV  +++      V    N  D  +R L L    Y+R + GH   V  +  +P + + FLS S+D  IR++D RT      +      L A DP+G++F V   SDT KL+D+R+F+ GPF +F +    ++    + S + FSP GK +L+S     +  +D+F G  +H       N  +I + A  + DS ++M GS +  +YI+                 T  GG           P ++ A     QF   ++G+ +  +W P
Sbjct:   22 KKFNETSNKLLDLAYSDDGNNLIVSAED-VVLVYDLRDGSKGKSIECKKYGVNCLEYLDTVKCVHSGPN--DTTIRLLHLQKKSYVRYFDGHRMPVNFIRTNPKDREKFLSSSVDGEIRMFDTRTFENYGCLLAGHTPLIAFDPDGILFAVATKSDTIKLFDMRSFDLGPFQSFIITKTDND----EWSDIEFSPCGKFILISTTAGSVKWIDAFDGTLIHSFS-QHKNPNKIPLRASVSTDSGFVMVGSADRNVYIY----------------STETGGVTCKLPTPYPEPSHVVAFN-QKQFLMTSLGR-EVILWAP 314          
BLAST of WD repeat domain 82 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 78.9518 bits (193), Expect = 1.170e-15
Identity = 65/282 (23.05%), Postives = 136/282 (48.23%), Query Frame = 1
Query:   61 YECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGT 897
            Y+     + ++  +++  F+  G+ L +SS D ++ ++++ +    +T+   K GV  I ++  S  V+ AS+  D  L+   +  ++  +   GH   V   + +P +   +SGS D+++R+WD++T  C   +      ++A+  + +G +          +++D    +    L     P         V+ ++FSP+GK +L S   + + L D   G++L Q    G  +++  I A F+    ++I++GS + ++YIW   N Q   ++Q  EG T
Sbjct:   77 YKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASD--DKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENP--------PVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQY--TGHENSKYCIFANFSVTGGKWIISGSEDCKIYIW---NLQTREIVQCLEGHT 343          
BLAST of WD repeat domain 82 vs. Ensembl Celegans
Match: wdr-5.1 (WD repeat-containing protein wdr-5.1 [Source:UniProtKB/Swiss-Prot;Acc:Q17963])

HSP 1 Score: 78.9518 bits (193), Expect = 1.170e-15
Identity = 65/282 (23.05%), Postives = 136/282 (48.23%), Query Frame = 1
Query:   61 YECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGT 897
            Y+     + ++  +++  F+  G+ L +SS D ++ ++++ +    +T+   K GV  I ++  S  V+ AS+  D  L+   +  ++  +   GH   V   + +P +   +SGS D+++R+WD++T  C   +      ++A+  + +G +          +++D    +    L     P         V+ ++FSP+GK +L S   + + L D   G++L Q    G  +++  I A F+    ++I++GS + ++YIW   N Q   ++Q  EG T
Sbjct:   77 YKLMCTLEGHTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASD--DKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENP--------PVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQY--TGHENSKYCIFANFSVTGGKWIISGSEDCKIYIW---NLQTREIVQCLEGHT 343          
BLAST of WD repeat domain 82 vs. Ensembl Celegans
Match: wdr-5.3 (WD repeat-containing protein wdr-5.3 [Source:UniProtKB/Swiss-Prot;Acc:Q23256])

HSP 1 Score: 75.0998 bits (183), Expect = 3.356e-14
Identity = 64/286 (22.38%), Postives = 123/286 (43.01%), Query Frame = 1
Query:   61 YECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQL------------PGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            +   K    ++  V+ I F+  G+ L + S D  I V++ ++  +LQT+ S + G+    ++  S  +  AS+  D  ++   +     +R   GHT  V   S +P +    S   D+T+R+WD +T  C   +               G  +A    +G I     +S +C    L+T                + +   V+ + FSP+GK LL +   + + L D    + L      G  + +  + A  + P  ++I++GS +GR+ +W +   Q + +L+
Sbjct:  203 FSLVKTISGHTKSVSVIKFSYCGKYLGTGSADKQIKVWNTVDMTYLQTLASHQLGINDFSWSSNSQFIASASD--DTTVKIFDVISGACLRTMRGHTNYVFCCSFNPQSSLIASAGFDETVRVWDFKTGLCVKCIPAHSDPITSISYNHDGNTMATSSYDGCIRVWDAASGSC----LKTLV--------------DTDHAPVTFVCFSPNGKYLLSAQLDSSLKLWDPKKAKPLKYYN--GHKNKKYCLFANMSVPLGKHIISGSEDGRILVWSIQTKQIVQILE 466          
BLAST of WD repeat domain 82 vs. Ensembl Fly
Match: Wdr82 (gene:FBgn0032030 transcript:FBtr0079650)

HSP 1 Score: 312.383 bits (799), Expect = 1.836e-103
Identity = 154/333 (46.25%), Postives = 216/333 (64.86%), Query Frame = 1
Query:   28 KMKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMP 1026
            K+KL D  +RS++  K F++N+DK+NAI+F  NGE LIS S+DD I +YD   G   +T+ SKKYGV++I FTH +   IH+S KVDD +RYLSLHDNKY+R +PGHTKKVISL +SP  DTFLSGSLDKT+RLWDLR+ NCQ LM L G+ +AA DPEGLIF   ++S++ KLYDLR+F++GPF+TF L    ++    D + L+FS DGK +L+S  G+ I L+D+F G  L        N+  I I A F+PDS++I +GS +GR++IW      ++++L     G                   +  ++ NP++  +A      + W+P
Sbjct:    2 KIKLIDSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVNSKKYGVDLIHFTHANNTAIHSSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVEDTFLSGSLDKTLRLWDLRSPNCQGLMHLSGRPIAAYDPEGLIFAAGVNSESIKLYDLRSFDKGPFVTFKL----NQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGY-PNNKGIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNGDHPGP------------------VQCVQFNPKYMMLASACTNMAFWLP 311          
BLAST of WD repeat domain 82 vs. Ensembl Fly
Match: CG3515 (gene:FBgn0031431 transcript:FBtr0077750)

HSP 1 Score: 128.257 bits (321), Expect = 1.930e-32
Identity = 85/347 (24.50%), Postives = 163/347 (46.97%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTND-TFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLS----WAGTQIAL----LDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALEC---NPQFSQIAVGQIQTSIWMPQIN 1035
            ++LNDD++R +   K F +      A+ F+S+G +L+      +++++       +  +    Y  ++  F    T V+H+++K D  +R L L+    +R++ GH K +  L+  P  +  F+S   D  + +WD+R       ++   + L A DPEGL       ++  ++ D+R     P   F    ++    + + + L+F+P+GK LLLS    W  +  A+      SFTG S         N  ++ ++A +TPDS++I++G+ +GR++IWR ++   +A+L+ +                     N+G + C   NP+ +       +   WMP  N
Sbjct:    3 IRLNDDAMRQFRVAKVFPETKHHTLAMEFSSDGLRLLVCDHS-ALSIFSSTRQVQVCKVPMHHYLPDVACFVQQDTRVLHSTSKHDYTIRCLDLNTRHCVRVFGGHAKTINRLASQPGGENVFISAGRDDQVYMWDIRVKTHTHRIKNLRRPLCAFDPEGLFLATSSGTEGIQIRDVRMMGGEPSRKF----VYQVNAKANWTQLQFAPNGKSLLLSTDHSWCFSVSAIDGTYQQSFTGYS---------NKLRLPLDATYTPDSQFILSGADKGRIHIWRAADGFPVAVLKGN---------------------NMGPVRCMRFNPRATMFVSSDSRIVFWMPMAN 314          
BLAST of WD repeat domain 82 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0308566)

HSP 1 Score: 98.2117 bits (243), Expect = 4.012e-22
Identity = 69/263 (26.24%), Postives = 130/263 (49.43%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+A+ F+ NGE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++  S+  D  L+   L   K ++   GH+  V   + +P ++  +SGS D+++R+WD+RT  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L      G  + +  I A F+    ++I++GS +  +YIW + + + +  LQ
Sbjct:   75 VSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSD--DKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325          

HSP 2 Score: 56.225 bits (134), Expect = 2.545e-8
Identity = 39/143 (27.27%), Postives = 73/143 (51.05%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHT--KKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            +R+ +C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y GH   K  I  + S T   ++ SGS D  + +W+L++      +Q
Sbjct:  185 VRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325          

HSP 3 Score: 51.6026 bits (122), Expect = 1.003e-6
Identity = 35/129 (27.13%), Postives = 66/129 (51.16%), Query Frame = 1
Query:   58 SYECFKCF-KDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C K    D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DN+ Y+ +L   + ++   GHT  V+  +  PT +   S +L  DKTI+LW
Sbjct:  229 SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLW 357          

HSP 4 Score: 50.0618 bits (118), Expect = 2.700e-6
Identity = 36/144 (25.00%), Postives = 64/144 (44.44%), Query Frame = 1
Query:   40 NDDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            +D +L+ +E       K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  134 DDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 275          
BLAST of WD repeat domain 82 vs. Ensembl Fly
Match: wds (gene:FBgn0040066 transcript:FBtr0070438)

HSP 1 Score: 98.2117 bits (243), Expect = 4.012e-22
Identity = 69/263 (26.24%), Postives = 130/263 (49.43%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+A+ F+ NGE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++  S+  D  L+   L   K ++   GH+  V   + +P ++  +SGS D+++R+WD+RT  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L      G  + +  I A F+    ++I++GS +  +YIW + + + +  LQ
Sbjct:   75 VSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSD--DKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325          

HSP 2 Score: 56.225 bits (134), Expect = 2.545e-8
Identity = 39/143 (27.27%), Postives = 73/143 (51.05%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHT--KKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            +R+ +C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y GH   K  I  + S T   ++ SGS D  + +W+L++      +Q
Sbjct:  185 VRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQ 325          

HSP 3 Score: 51.6026 bits (122), Expect = 1.003e-6
Identity = 35/129 (27.13%), Postives = 66/129 (51.16%), Query Frame = 1
Query:   58 SYECFKCF-KDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C K    D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DN+ Y+ +L   + ++   GHT  V+  +  PT +   S +L  DKTI+LW
Sbjct:  229 SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLW 357          

HSP 4 Score: 50.0618 bits (118), Expect = 2.700e-6
Identity = 36/144 (25.00%), Postives = 64/144 (44.44%), Query Frame = 1
Query:   40 NDDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            +D +L+ +E       K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  134 DDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 275          
BLAST of WD repeat domain 82 vs. Ensembl Fly
Match: CG10931 (gene:FBgn0034274 transcript:FBtr0089545)

HSP 1 Score: 73.559 bits (179), Expect = 6.301e-14
Identity = 78/323 (24.15%), Postives = 137/323 (42.41%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAID--PEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLS--------WAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQ--SSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTS----IW 1020
            V  + F+SNGE L+SSS D  + ++D+   + +Q++     GV  + +   S A + AS   D  +R         +++  GH++   S   +P  +   S S D+T+RLWD+RT     ++      + ++D   +G IF         +L+D  T      L         + + + V  ++FSP+G+ +L S        W   +   + ++ G  L++     +N +        T    +I++GS +  L IW   N Q   L+Q  S+EG                    I +  C+P  + IA G +Q S    IW
Sbjct:   59 VTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLAGHGDGVNDVAW---SAAGLIASCSDDMTVRLWDARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDPITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLV--------DVDNIPVGYVKFSPNGRYILSSTLNNTLRLWNYKKPKCMRTYRGH-LNEFYCSNSNFS--------TTGGIWIVSGSEDNTLCIW---NLQTRELVQKISTEGD------------------QILSTHCHPTANVIASGALQNSYAIKIW 340          
BLAST of WD repeat domain 82 vs. Ensembl Zebrafish
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:321614])

HSP 1 Score: 322.783 bits (826), Expect = 2.435e-107
Identity = 158/335 (47.16%), Postives = 221/335 (65.97%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D  LRS+   K F++NSDK+N  +F+SNGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF    L +E    + + L+FS DGK++L+S  G  + +LD+F G  LH       NS  + + A FTPDS++IM GS +G++++W   +  ++ALL     G                   +  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSSNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHNKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFK---LQYE-RTCEWTGLKFSNDGKLILVSTNGGTLRVLDAFKGAVLHSFGGY-NNSKGVILEASFTPDSQFIMIGSEDGKIHVWNAESGMKVALLDGKHTGP------------------VTCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 93.5893 bits (231), Expect = 1.490e-20
Identity = 66/263 (25.10%), Postives = 130/263 (49.43%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+++ F+ +GE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L      G  + +  I A F+    ++I++GS +  +YIW +   + +  LQ
Sbjct:   48 VSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          

HSP 2 Score: 54.6842 bits (130), Expect = 1.027e-7
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 1
Query:   43 DDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGH--TKKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            D+S+R ++     C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y GH   K  I  + S T   ++ SGS D  + +W+L+T      +Q
Sbjct:  150 DESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          

HSP 3 Score: 51.6026 bits (122), Expect = 1.092e-6
Identity = 37/129 (28.68%), Postives = 67/129 (51.94%), Query Frame = 1
Query:   58 SYECFKCF-KDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C K    D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DN+ Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI+LW
Sbjct:  202 SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330          

HSP 4 Score: 50.447 bits (119), Expect = 2.205e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  116 VSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 248          
BLAST of WD repeat domain 82 vs. Ensembl Zebrafish
Match: wdr5 (WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-040426-2082])

HSP 1 Score: 72.0182 bits (175), Expect = 3.184e-14
Identity = 38/126 (30.16%), Postives = 70/126 (55.56%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPG 477
            V+++ F+ +GE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C  L  LP 
Sbjct:   48 VSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC--LKTLPA 169          
BLAST of WD repeat domain 82 vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 72.0182 bits (175), Expect = 3.794e-13
Identity = 66/309 (21.36%), Postives = 128/309 (41.42%), Query Frame = 1
Query:   25 FKMKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSD---------TCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASG 924
             + K++    R +  F+  + +   +  + F  +G   I+ S D +  ++D  +G+ L T+   +  V  I F +     + A+   D   +  S    K    + GHT +++ L+ +P +    +GS+D T +LWD+ +             LA    E +  C   + D         T  L+D+ +  +   L+         G+R ++S ++F+ D  ++  +       + D+  G+ L  L  LG N   +D+  CF    + I   S +G   ++     Q +  L+  +G  S   FNA G
Sbjct:   70 LQEKVSQKDERKFYLFRALQAHILPLTNVAFNKSGSCFITGSYDRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPYGDKV-ATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGE-------EVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWDVPSGRKVHVLS---------GHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATL--LGHNDEVLDV--CFNYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQG 357          
BLAST of WD repeat domain 82 vs. Ensembl Zebrafish
Match: daw1 (dynein assembly factor with WDR repeat domains 1 [Source:NCBI gene;Acc:556760])

HSP 1 Score: 72.0182 bits (175), Expect = 4.165e-13
Identity = 66/309 (21.36%), Postives = 128/309 (41.42%), Query Frame = 1
Query:   25 FKMKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSD---------TCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASG 924
             + K++    R +  F+  + +   +  + F  +G   I+ S D +  ++D  +G+ L T+   +  V  I F +     + A+   D   +  S    K    + GHT +++ L+ +P +    +GS+D T +LWD+ +             LA    E +  C   + D         T  L+D+ +  +   L+         G+R ++S ++F+ D  ++  +       + D+  G+ L  L  LG N   +D+  CF    + I   S +G   ++     Q +  L+  +G  S   FNA G
Sbjct:   70 LQEKVSQKDERKFYLFRALQAHILPLTNVAFNKSGSCFITGSYDRTCKIWDTASGEELHTLEGHRNVVYAIAFNNPYGDKV-ATGSFDKTCKLWSAETGKCFYTFRGHTAEIVCLAFNPQSTLVATGSMDTTAKLWDVESGE-------EVSTLAGHFAEIISLCFNTTGDRLVTGSFDHTAILWDVPSGRKVHVLS---------GHRGEISCVQFNWDCSLIATASLDKSCKVWDAEGGQCLATL--LGHNDEVLDV--CFNYTGQLIATASADGTSRVFSTDTFQCLCQLEGHKGEISKVCFNAQG 357          
BLAST of WD repeat domain 82 vs. Ensembl Xenopus
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:Xenbase;Acc:XB-GENE-993827])

HSP 1 Score: 317.005 bits (811), Expect = 6.437e-105
Identity = 152/335 (45.37%), Postives = 219/335 (65.37%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D+ LRS+   K F++NSDK+N  +F+  GE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH+K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF +          + ++L+FS DGK++L+S  G  + L+D+F G  +H       NS  + + A FTPDS++IM GS +G++++W   +  ++A+L     G                   I  L+ NP+F          + W+P I+
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSPTGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKM----QYDRTCEWTALKFSNDGKLILMSTNGGFLRLVDAFKGAVMHTFGGY-NNSKAVTLEATFTPDSQFIMIGSEDGKIHVWNCESGMKVAVLDGKHTGP------------------ITCLQFNPKFMTFTSACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. Ensembl Xenopus
Match: agxt2 (alanine--glyoxylate aminotransferase 2 [Source:Xenbase;Acc:XB-GENE-993827])

HSP 1 Score: 311.612 bits (797), Expect = 3.237e-99
Identity = 144/288 (50.00%), Postives = 206/288 (71.53%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGG 894
            MKL D+ LRS+   K F++NSDK+N  +F+  GE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH+K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF +          + ++L+FS DGK++L+S  G  + L+D+F G  +H       NS  + + A FTPDS++IM GS +G++++W   +  ++A+L     G
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSPTGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKM----QYDRTCEWTALKFSNDGKLILMSTNGGFLRLVDAFKGAVMHTFGGY-NNSKAVTLEATFTPDSQFIMIGSEDGKIHVWNCESGMKVAVLDGKHTG 283          
BLAST of WD repeat domain 82 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 95.5153 bits (236), Expect = 3.460e-21
Identity = 66/262 (25.19%), Postives = 126/262 (48.09%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+++ F+ NGE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L            I  N   T   ++I++GS +  +YIW +   + +  LQ
Sbjct:   23 VSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVT-GGKWIVSGSEDNLVYIWNLQTKEVVQKLQ 273          

HSP 2 Score: 52.373 bits (124), Expect = 7.796e-7
Identity = 38/129 (29.46%), Postives = 67/129 (51.94%), Query Frame = 1
Query:   58 SYECFKCF-KDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C K    D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DNL Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI+LW
Sbjct:  177 SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 305          

HSP 3 Score: 51.6026 bits (122), Expect = 1.335e-6
Identity = 41/151 (27.15%), Postives = 75/151 (49.67%), Query Frame = 1
Query:   43 DDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHT--KKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            D+S+R ++     C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y  H   K  I  + S T   ++ SGS D  + +W+L+T      +Q
Sbjct:  125 DESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQ 273          

HSP 4 Score: 50.8322 bits (120), Expect = 2.710e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:   91 VSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 223          
BLAST of WD repeat domain 82 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 95.1301 bits (235), Expect = 3.860e-21
Identity = 66/262 (25.19%), Postives = 126/262 (48.09%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+++ F+ NGE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L            I  N   T   ++I++GS +  +YIW +   + +  LQ
Sbjct:   46 VSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVT-GGKWIVSGSEDNLVYIWNLQTKEVVQKLQ 296          

HSP 2 Score: 51.2174 bits (121), Expect = 1.908e-6
Identity = 41/151 (27.15%), Postives = 75/151 (49.67%), Query Frame = 1
Query:   43 DDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHT--KKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            D+S+R ++     C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y  H   K  I  + S T   ++ SGS D  + +W+L+T      +Q
Sbjct:  148 DESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQ 296          

HSP 3 Score: 50.0618 bits (118), Expect = 3.980e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  114 VSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 246          
BLAST of WD repeat domain 82 vs. Ensembl Xenopus
Match: ppp4r1l (protein phosphatase 4 regulatory subunit 1 like (pseudogene) [Source:Xenbase;Acc:XB-GENE-5997807])

HSP 1 Score: 95.1301 bits (235), Expect = 5.694e-21
Identity = 66/262 (25.19%), Postives = 126/262 (48.09%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+++ F+ NGE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L            I  N   T   ++I++GS +  +YIW +   + +  LQ
Sbjct:   48 VSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVT-GGKWIVSGSEDNLVYIWNLQTKEVVQKLQ 298          

HSP 2 Score: 51.9878 bits (123), Expect = 1.051e-6
Identity = 38/129 (29.46%), Postives = 67/129 (51.94%), Query Frame = 1
Query:   58 SYECFKCF-KDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C K    D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DNL Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI+LW
Sbjct:  202 SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330          

HSP 3 Score: 51.2174 bits (121), Expect = 1.778e-6
Identity = 41/151 (27.15%), Postives = 75/151 (49.67%), Query Frame = 1
Query:   43 DDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGH--TKKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            D+S+R ++     C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y  H   K  I  + S T   ++ SGS D  + +W+L+T      +Q
Sbjct:  150 DESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQ 298          

HSP 4 Score: 50.447 bits (119), Expect = 3.404e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  116 VSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 248          
BLAST of WD repeat domain 82 vs. Ensembl Mouse
Match: Wdr82 (WD repeat domain containing 82 [Source:MGI Symbol;Acc:MGI:1924555])

HSP 1 Score: 320.087 bits (819), Expect = 2.821e-106
Identity = 155/335 (46.27%), Postives = 220/335 (65.67%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D  LRS+   K F++NSDK+N  +F+ NGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH+K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF +          + + L+FS DGK++L+S  G+ I L+D+F G  +H       NS  + + A FTPDS++IM GS +G++++W   +  ++A+L     G                   I  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKM----QYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYA-NSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGP------------------ITCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. Ensembl Mouse
Match: Wdr5 (WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155884])

HSP 1 Score: 95.1301 bits (235), Expect = 4.395e-21
Identity = 67/263 (25.48%), Postives = 130/263 (49.43%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+++ F+ NGE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L      G  + +  I A F+    ++I++GS +  +YIW +   + +  LQ
Sbjct:   48 VSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 298          

HSP 2 Score: 55.0694 bits (131), Expect = 9.604e-8
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 1
Query:   43 DDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGH--TKKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            D+S+R ++     C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y GH   K  I  + S T   ++ SGS D  + +W+L+T      +Q
Sbjct:  150 DESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQ 298          

HSP 3 Score: 52.7582 bits (125), Expect = 4.877e-7
Identity = 38/129 (29.46%), Postives = 67/129 (51.94%), Query Frame = 1
Query:   58 SYECFKCF-KDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C K    D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DNL Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI+LW
Sbjct:  202 SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330          

HSP 4 Score: 51.2174 bits (121), Expect = 1.638e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  116 VSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 248          
BLAST of WD repeat domain 82 vs. Ensembl Mouse
Match: Wdr5b (WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:1916794])

HSP 1 Score: 90.1225 bits (222), Expect = 2.447e-19
Identity = 63/267 (23.60%), Postives = 130/267 (48.69%), Query Frame = 1
Query:   88 NSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSR-YIMAGSPEGRLYIWRVSNAQRIALLQ 879
            +S  ++++ F+ NGE L SS+ D  I ++   +G   +T+Y     +  + ++  S+ ++ AS+  D  L+   +   K ++   GH+  V     +P ++  +SGS D+++++W+++T  C   +      ++A+  +  G +         C+++D  + +        L  L  EGN   VS ++FSP+GK +L +     + L D   GR L      G  + +  + A F+   R ++++GS +  +YIW +   + +  LQ
Sbjct:   38 HSAAISSVKFSPNGEWLASSAADALIIIWGAYDGNCKKTLYGHSLEISDVAWSSDSSRLVSASD--DKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQ-------CLRTLADEGNP-PVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYT--GHKNEKYCLFASFSVTGRKWVVSGSEDNMVYIWNLQTKEIVQRLQ 292          

HSP 2 Score: 55.0694 bits (131), Expect = 9.426e-8
Identity = 36/135 (26.67%), Postives = 64/135 (47.41%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVIS-LSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            +RS +C K  K +SD V   +F      ++S S D+S+ +++V  GK L+T+ +    +  + F +C+ ++I  S   D   R       + +R         +S +  SP     L+ +LD T++LWD     C
Sbjct:  110 MRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNF-NCNGSLI-VSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRC 242          

HSP 3 Score: 50.8322 bits (120), Expect = 1.982e-6
Identity = 33/129 (25.58%), Postives = 67/129 (51.94%), Query Frame = 1
Query:   58 SYECFKCFKDNSDK-VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C +   D  +  V+ + F+ NG+ +++++ D+++ ++D   G+ L+T    K     +  +   T      +  +DN+ Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI++W
Sbjct:  196 SGQCLRTLADEGNPPVSFVKFSPNGKYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCLFASFSVTGRKWVVSGSEDNMVYIWNLQTKEIVQRLQGHTDVVISAACHPTKNIIASAALENDKTIKVW 324          
BLAST of WD repeat domain 82 vs. Ensembl Mouse
Match: Wdr38 (WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:1923896])

HSP 1 Score: 84.7297 bits (208), Expect = 9.295e-18
Identity = 71/250 (28.40%), Postives = 115/250 (46.00%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTAN-CQALMQLPGKGLAAIDPEGLIFCVCISSD---TCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDI-NAC-FTPDSRYIMAGSPEGR 831
            V +  F+ +G  + SSS D SI ++DV   K L  +   +  VE + F+  S  +  AS   D       +   + + L  GH   + S   SPT+D+  +GS D T+ +WDLR +    +   L G         G I C+C S+        +D       P  T +  PL  +G+ + V+SL FSPD   L  +     + + D  TG+ L  L+ +      +D+ +AC FTPD + +++G+   R
Sbjct:   71 VKSCCFSPDGRLIASSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSPDSKQL--ASGGWDKRAIVWEVQSGRRVHLLVGHCDSIQSSDFSPTSDSLATGSWDSTVHIWDLRASTPVVSYHNLEGH-------TGNISCLCYSASGLLASGSWDKTICVWKP--TTNNLPLQLKGHTIWVNSLAFSPDELKLASAGYSRTVKVWDCLTGKCLETLKGM------LDVAHACIFTPDGKLLVSGAAVTR 303          
BLAST of WD repeat domain 82 vs. Ensembl Mouse
Match: Wdr38 (WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:1923896])

HSP 1 Score: 84.7297 bits (208), Expect = 9.295e-18
Identity = 71/250 (28.40%), Postives = 115/250 (46.00%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTAN-CQALMQLPGKGLAAIDPEGLIFCVCISSD---TCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDI-NAC-FTPDSRYIMAGSPEGR 831
            V +  F+ +G  + SSS D SI ++DV   K L  +   +  VE + F+  S  +  AS   D       +   + + L  GH   + S   SPT+D+  +GS D T+ +WDLR +    +   L G         G I C+C S+        +D       P  T +  PL  +G+ + V+SL FSPD   L  +     + + D  TG+ L  L+ +      +D+ +AC FTPD + +++G+   R
Sbjct:   71 VKSCCFSPDGRLIASSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSPDSKQL--ASGGWDKRAIVWEVQSGRRVHLLVGHCDSIQSSDFSPTSDSLATGSWDSTVHIWDLRASTPVVSYHNLEGH-------TGNISCLCYSASGLLASGSWDKTICVWKP--TTNNLPLQLKGHTIWVNSLAFSPDELKLASAGYSRTVKVWDCLTGKCLETLKGM------LDVAHACIFTPDGKLLVSGAAVTR 303          
BLAST of WD repeat domain 82 vs. UniProt/SwissProt
Match: sp|Q6NV31|WDR82_DANRE (WD repeat-containing protein 82 OS=Danio rerio OX=7955 GN=wdr82 PE=2 SV=1)

HSP 1 Score: 322.783 bits (826), Expect = 1.838e-106
Identity = 158/335 (47.16%), Postives = 221/335 (65.97%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D  LRS+   K F++NSDK+N  +F+SNGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF    L +E    + + L+FS DGK++L+S  G  + +LD+F G  LH       NS  + + A FTPDS++IM GS +G++++W   +  ++ALL     G                   +  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSSNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHNKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFK---LQYE-RTCEWTGLKFSNDGKLILVSTNGGTLRVLDAFKGAVLHSFGGY-NNSKGVILEASFTPDSQFIMIGSEDGKIHVWNAESGMKVALLDGKHTGP------------------VTCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. UniProt/SwissProt
Match: sp|Q5ZMV7|WDR82_CHICK (WD repeat-containing protein 82 OS=Gallus gallus OX=9031 GN=WDR82 PE=2 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 2.463e-106
Identity = 157/335 (46.87%), Postives = 220/335 (65.67%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D+ LRS+   K F++NSDK+N  +F+ NGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGHTK+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF +          + + L+FS DGK++L+S  G  I L+D+F G  LH       NS  + + A FTPDS++IM GS +G++++W   +  ++A+L     G                   I  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKM----QYDRTCEWTGLKFSNDGKLILISTNGGFIRLIDAFKGAVLHTFGGY-NNSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGMKVAVLDGKHTGP------------------ITCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. UniProt/SwissProt
Match: sp|Q58E77|WD82B_XENLA (WD repeat-containing protein 82-B OS=Xenopus laevis OX=8355 GN=wdr82-b PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.238e-105
Identity = 156/335 (46.57%), Postives = 220/335 (65.67%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D+ LRS+   K F++NSDK+N  +F+  GE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH+K+V+SLSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   I+S+  KLYDLR+F++GPF TF +          + ++L+FS DGK++LLS  G  + L+D+F G  +H       NS  + + A FTPDS++IM GS +G++++W   +  ++A+L     G                   I  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSPTGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVSLSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGINSEMVKLYDLRSFDKGPFATFKM----QYDRTCEWTALKFSNDGKLILLSTNGGFLRLVDAFKGAVMHTFGGY-NNSKAVTLEASFTPDSQFIMIGSEDGKIHVWNCESGMKVAVLDGKHTGP------------------ITCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. UniProt/SwissProt
Match: sp|Q8BFQ4|WDR82_MOUSE (WD repeat-containing protein 82 OS=Mus musculus OX=10090 GN=Wdr82 PE=1 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.973e-105
Identity = 155/335 (46.27%), Postives = 220/335 (65.67%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D  LRS+   K F++NSDK+N  +F+ NGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH+K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF +          + + L+FS DGK++L+S  G+ I L+D+F G  +H       NS  + + A FTPDS++IM GS +G++++W   +  ++A+L     G                   I  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKM----QYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYA-NSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGP------------------ITCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. UniProt/SwissProt
Match: sp|Q6UXN9|WDR82_HUMAN (WD repeat-containing protein 82 OS=Homo sapiens OX=9606 GN=WDR82 PE=1 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.973e-105
Identity = 155/335 (46.27%), Postives = 220/335 (65.67%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D  LRS+   K F++NSDK+N  +F+ NGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH+K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF +          + + L+FS DGK++L+S  G+ I L+D+F G  +H       NS  + + A FTPDS++IM GS +G++++W   +  ++A+L     G                   I  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDSVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHSKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKM----QYDRTCEWTGLKFSNDGKLILISTNGSFIRLIDAFKGVVMHTFGGYA-NSKAVTLEASFTPDSQFIMIGSEDGKIHVWNGESGIKVAVLDGKHTGP------------------ITCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. TrEMBL
Match: A0A120H2D8 (WDR82 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 723.776 bits (1867), Expect = 0.000e+0
Identity = 348/348 (100.00%), Postives = 348/348 (100.00%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQINIDVPMEIPVDNAE 1074
            MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQINIDVPMEIPVDNAE
Sbjct:    1 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQINIDVPMEIPVDNAE 348          
BLAST of WD repeat domain 82 vs. TrEMBL
Match: A0A1S3H4D9 (WD repeat-containing protein 82 OS=Lingula unguis OX=7574 GN=LOC106151330 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 5.992e-106
Identity = 158/335 (47.16%), Postives = 223/335 (66.57%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D  +RS+   K F++NS+KVN+++F++NGE LISSS+DD I +YD  NG   +T+ SKKYGV++I FTH     IH+S KVDD +RYLSLHDNKYIR +PGHTKKV+++SMSP +DTFLSGSLDKTIRLWDLR+ NCQ LM +PG+ +AA DPEGLIF   I+S+  KLYDLR+F++GPF TF L     +    D + L+FSPDGKM+L+S  G  I L+D+F G  L Q  +  TN   + + A F+PDS+++ +GS +G+++ W      ++ +L +   G                   +  ++ NP+F  ++   I  + W+PQ++
Sbjct:    1 MKLTDTVVRSFRVAKVFRENSEKVNSLDFSANGELLISSSEDDQIVIYDCQNGTPKRTLNSKKYGVDLIHFTHAPNTAIHSSTKVDDTIRYLSLHDNKYIRYFPGHTKKVVTISMSPVDDTFLSGSLDKTIRLWDLRSPNCQGLMHVPGRPVAAFDPEGLIFAAGINSEMVKLYDLRSFDKGPFATFKL----QQDRDCDWTGLKFSPDGKMVLISTNGQVIRLIDAFQGHPL-QTFMGHTNQKGLPLEASFSPDSQFVFSGSTDGKIHCWNAETGSKVCVLNAEHTGP------------------VQCIQFNPRFMMLSSACINMAFWLPQMD 312          
BLAST of WD repeat domain 82 vs. TrEMBL
Match: A0A3B3ST12 (WD repeat domain 82 OS=Paramormyrops kingsleyae OX=1676925 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 1.891e-105
Identity = 159/335 (47.46%), Postives = 221/335 (65.97%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D+ LRS+   K F++NSDK+N  +F+SNGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF LP         + + L+FS DGK++L+S  G  + LLD+F G  LH       NS  + + A FTPDS++IM GS +G++++W   +  ++ALL     G                   +  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSSNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHNKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFKLP----LDRNCEWTGLKFSNDGKLILVSTNGGALRLLDAFKGAVLHCFGGY-NNSKGVTLEASFTPDSQFIMIGSEDGKIHVWNAESGMKVALLDGKHTGP------------------VTCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. TrEMBL
Match: A0A183JDQ0 (WD_REPEATS_REGION domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS813 PE=4 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 3.494e-105
Identity = 162/334 (48.50%), Postives = 226/334 (67.66%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQI 1032
            MKL D ++R+++  K FK+NSD++N+++++SNGE LISSS DD +  YD  +G   +T+ SKKYGV +I+FTH  T  IHAS K+DD +RYLSLHDNKYIR +  HTK+V+SL MSP +DTFLSGS+D TIRLWDLR+ NC  +M + G+  AA DPEGLIF   I+S++ KLYDLR+F++GPF TF    L  E +    + L+FS DGK LL++  GT I L+D+F G  LH L ++  N+ +  ++A FTPDS++++ GSP+G ++IW V    R+A L   E  T     NA+          I +L  NP+F+ +A G  QTS W+P +
Sbjct:    1 MKLTDSTIRTFKPVKYFKENSDRINSLSYSSNGETLISSSDDDQMVTYDCSSGTPKRTLNSKKYGVNLIQFTHSPTTAIHASTKIDDTIRYLSLHDNKYIRYFQSHTKRVVSLCMSPIDDTFLSGSMDSTIRLWDLRSPNCHGVMHVSGRPTAAFDPEGLIFAAGINSESVKLYDLRSFDKGPFATFK---LGMETSGCIWTGLQFSSDGKALLITTNGTHIRLVDAFKGSHLHTLAVI-PNTDRQTLHASFTPDSQFVLIGSPDGVVHIWSVETGVRVASLPGYEAATQLP--NAA----------IHSLAFNPRFAMLATGSNQTSFWLPAL 318          
BLAST of WD repeat domain 82 vs. TrEMBL
Match: A0A2C9JUK3 (WD_REPEATS_REGION domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106068907 PE=4 SV=1)

HSP 1 Score: 325.479 bits (833), Expect = 3.996e-105
Identity = 156/335 (46.57%), Postives = 221/335 (65.97%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL DD +RS    K F++N+D+++++NF++NGE LI+SS DDSI +YD +NG   +T+ SKKYGV++I++TH     +H S KVDD +RYLSLHDNKYIR +PGHTKKV++L MSP +D F+SGS+DKTIRLWDLR+ NCQ LM L G+ +AA DPEGLIF   ++S++ KLYDLR+F++GPF TF LP    +    D + L+FSPDGKM+L+S  G  I L+D+F G  L       TN   I + A FTPD+RY+ +GS +G+++ W   +  ++A+LQS   G                   I  ++ NP++  +A      + W P ++
Sbjct:    1 MKLVDDVVRSLRVSKIFRENTDRISSLNFSANGETLITSSDDDSIVIYDCLNGTPKRTLNSKKYGVDLIRYTHAQNTALHCSTKVDDTIRYLSLHDNKYIRYFPGHTKKVVTLCMSPIDDAFISGSMDKTIRLWDLRSQNCQGLMHLSGRPVAAFDPEGLIFAAGVNSESVKLYDLRSFDKGPFTTFKLP----QDKECDWTGLKFSPDGKMILISTNGNVIRLIDAFQGTPLQAFMGF-TNHKGIPLEASFTPDARYVFSGSTDGKVHCWSTESGVKMAILQSDHPGP------------------IQCIQFNPKYMMMASACQNMAFWQPAVD 312          
BLAST of WD repeat domain 82 vs. Ensembl Cavefish
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:103023310])

HSP 1 Score: 323.168 bits (827), Expect = 1.137e-107
Identity = 158/335 (47.16%), Postives = 222/335 (66.27%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D+ LRS+   K F++NSDK+N  +F+SNGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGH K+V++LSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   ++S+  KLYDLR+F++GPF TF    L +E    + + L+FS DGK++L+S  G  + LLD+F G  LH       NS  + + A FTPDS+++M GS +G++++W   +  ++ALL     G                   +  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSSNGETVISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHNKRVVALSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGVNSEMVKLYDLRSFDKGPFATFK---LQYE-RTCEWTGLKFSNDGKLILVSSNGGTLRLLDAFKGAILHSFGGY-NNSKGVVLEASFTPDSQFVMIGSEDGKIHVWNAESGMKVALLDGKHTGP------------------VTCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 93.5893 bits (231), Expect = 1.216e-20
Identity = 66/263 (25.10%), Postives = 130/263 (49.43%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+++ F+ +GE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L      G  + +  I A F+    ++I++GS +  +YIW +   + +  LQ
Sbjct:   48 VSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          

HSP 2 Score: 54.6842 bits (130), Expect = 8.858e-8
Identity = 42/151 (27.81%), Postives = 76/151 (50.33%), Query Frame = 1
Query:   43 DDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGH--TKKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            D+S+R ++     C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y GH   K  I  + S T   ++ SGS D  + +W+L+T      +Q
Sbjct:  150 DESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          

HSP 3 Score: 51.6026 bits (122), Expect = 9.759e-7
Identity = 37/129 (28.68%), Postives = 67/129 (51.94%), Query Frame = 1
Query:   58 SYECFKCF-KDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C K    D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DN+ Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI+LW
Sbjct:  202 SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330          

HSP 4 Score: 50.447 bits (119), Expect = 2.042e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  116 VSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 248          
BLAST of WD repeat domain 82 vs. Ensembl Cavefish
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:103033424])

HSP 1 Score: 91.6633 bits (226), Expect = 4.560e-20
Identity = 71/264 (26.89%), Postives = 128/264 (48.48%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPL---HHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+++ F+ +GE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C  L  LP    A  DP   +  V  + D            G  +  S P L   + + +   VS ++FSP+GK +L +     + L D   G+ L      G  + +  I A F+    ++I++GS +  +YIW +   + +  LQ
Sbjct:   48 VSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKC--LKTLP----AHSDP---VSAVHFNRD------------GSLIVSSSPQLLLFNWDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 286          

HSP 2 Score: 50.8322 bits (120), Expect = 1.353e-6
Identity = 34/121 (28.10%), Postives = 64/121 (52.89%), Query Frame = 1
Query:   79 FKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            + D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DN+ Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI+LW
Sbjct:  198 WDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 318          

HSP 3 Score: 50.447 bits (119), Expect = 2.094e-6
Identity = 34/134 (25.37%), Postives = 61/134 (45.52%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S ++   L +    DN  +            +  SP     L+ +LD T++LWD     C
Sbjct:  116 VSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSPQL---LLFNWDDDNPPVSF----------VKFSPNGKYILAATLDNTLKLWDYSKGKC 236          
BLAST of WD repeat domain 82 vs. Ensembl Cavefish
Match: ENSAMXT00000007963.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 90.1225 bits (222), Expect = 1.593e-19
Identity = 63/263 (23.95%), Postives = 130/263 (49.43%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            ++++ F+ NGE L SSS D  I ++   +GK  +++   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L      G  + +  + A F+    ++I++GS +  +YIW +   + +  LQ
Sbjct:   45 ISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASD--DKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQKLQ 295          

HSP 2 Score: 53.1434 bits (126), Expect = 2.843e-7
Identity = 41/151 (27.15%), Postives = 76/151 (50.33%), Query Frame = 1
Query:   43 DDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGH--TKKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQ 468
            D+S+R ++     C K    +SD V+A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y GH   K  +  + S T   ++ SGS D  + +W+L+T      +Q
Sbjct:  147 DESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHMVYIWNLQTKEIVQKLQ 295          

HSP 3 Score: 50.0618 bits (118), Expect = 2.478e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  113 MGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 245          
BLAST of WD repeat domain 82 vs. Ensembl Cavefish
Match: ENSAMXT00000007962.2 (WD repeat-containing protein 5-like [Source:NCBI gene;Acc:103023146])

HSP 1 Score: 81.2629 bits (199), Expect = 2.033e-16
Identity = 68/305 (22.30%), Postives = 133/305 (43.61%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLD------------------------SFTGRSLHQLQIL---------GTNSTQI------DINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEG 891
            ++++ F+ NGE L SSS D  I ++   +GK  +++   K G+  + ++  S  ++ AS+  D  L+   +   K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D                        S TG  + +L  L         G   T +       IN       ++I++GS +  +YIW +   + +  LQ   G
Sbjct:   45 ISSVKFSPNGEWLASSSADKLIKIWGSFDGKFEKSLSGHKLGISDVAWSPDSNLLVSASD--DKTLKIWDMGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRMWDSTSGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKVRRLLFLDLVTFSAAFGRGQTVLFLVSVYSINTSLIDSIQWIVSGSEDHMVYIWNLQTKEIVQKLQGHAG 339          

HSP 2 Score: 50.8322 bits (120), Expect = 1.703e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  113 MGSGKCLKTLKGHSNYVFCCNFNPQSNLVVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRMWDSTSGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 245          
BLAST of WD repeat domain 82 vs. Ensembl Sea Lamprey
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:321614])

HSP 1 Score: 318.931 bits (816), Expect = 1.105e-106
Identity = 152/335 (45.37%), Postives = 219/335 (65.37%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D+ +RS+   K F++NSDK+N  +F  NGE +ISSS DDSI +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGHTKKV++L MSP +DTF+S SLDKTIRLWDLR+ NCQ LM L G+ + + DPEGLIF   ++S+  KLYDLR+F++GPF TF L     +    D + L+ S DGK +L++  G  + L+D+F G +LH      TNS  I + A F+PDS++IM GS +G++++W   +  ++A+L     G                   +  L+ NP++  +A      + W+P I+
Sbjct:    1 MKLTDNVMRSFRVAKVFRENSDKINCFDFAPNGETMISSSDDDSIVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTKKVVALCMSPVDDTFISASLDKTIRLWDLRSPNCQGLMHLQGRPVCSFDPEGLIFAAGLNSEMVKLYDLRSFDKGPFATFRL----QQDRTCDWTGLKISNDGKFILIATNGGVLRLVDAFQGSALHMFT-GHTNSKGITLEASFSPDSQFIMTGSEDGKIHVWHTESGTKVAILDGKHTGP------------------VTCLQFNPKYMMVASACANMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. Ensembl Sea Lamprey
Match: POC1A (POC1 centriolar protein A [Source:HGNC Symbol;Acc:HGNC:24488])

HSP 1 Score: 74.7146 bits (182), Expect = 1.151e-14
Identity = 58/259 (22.39%), Postives = 120/259 (46.33%), Query Frame = 1
Query:   79 FKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYG-VEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAID--PEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWR 846
            F  + D V ++ F+ +G  ++S+S+D ++ ++ V + K   T++      V  + F+    +++ AS+  D +++  ++H  K++     H+  V S   SP     +SGS D+T+R+WD  +  C       G  +  +D  P G       + +T K++D+R       L       H++ +   V+SL F P G  L+ +   + + +LD   GR  + L      +T +     F+    +  +G  + ++ +W+
Sbjct:   56 FVGHKDAVMSVQFSPSGHLVVSASRDKTVRLW-VPSVKGESTVFKAHTATVRSVSFSADGQSLVTASD--DKSIKVWTVHRQKFLYSLNQHSNWVRSAKFSPDGRLIVSGSDDRTVRVWDSNSRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIR---MNKLLQ------HYQVHGAAVNSLSFHPTGNYLITASNDSTLKVLDLVEGRLFYTLHGHQGPATAV----AFSRAGDFFASGGSDEQVMVWK 298          

HSP 2 Score: 53.9138 bits (128), Expect = 4.819e-8
Identity = 33/125 (26.40%), Postives = 57/125 (45.60%), Query Frame = 1
Query:   58 SYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLW 432
            S EC   F ++   VN ++F  +G  + ++  D+++ V+D+   K LQ        V  + F      +I ASN  D  L+ L L + +      GH     +++ S   D F SG  D+ + +W
Sbjct:  175 SRECVHTFYEHGGFVNQVDFHPSGTCIAAAGTDNTVKVWDIRMNKLLQHYQVHGAAVNSLSFHPTGNYLITASN--DSTLKVLDLVEGRLFYTLHGHQGPATAVAFSRAGDFFASGGSDEQVMVW 297          
BLAST of WD repeat domain 82 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004902.1 (pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 gene:ENSPMAG00000004437.1 transcript:ENSPMAT00000004902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 1.494e-14
Identity = 59/254 (23.23%), Postives = 111/254 (43.70%), Query Frame = 1
Query:   88 NSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALM--QLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIW 843
            ++D +   +F   G  L +   D ++ V+D   G  + T+    + V    +  C   +  AS+ +D++ +   ++  +  +   GHT  V S+   P + T L+ S DKT+ LWD RT  C  +    L        + +G     C S    K++D+R  +    +T +L P  H  NR     L F P G ++ ++     + ++D  TG     ++ L  +   +     F+PD   + +G  +G + +W
Sbjct:  376 HTDWIGDCDFNPTGTNLATGGGDSTVKVWDFSQGACVLTLEGHGHAVWGCSWHSCGDFI--ASSSMDNSSKVWDVNSERCRQTLRGHTDSVNSVEFLPYSSTLLTSSADKTLSLWDARTGRCAQIFYGHLHSCNHGTFNLKGDTVVSCDSYGVIKVWDVR--KGTATMTLNLGP--HPANR-----LSFHPSGHVMAVASDDACVRIVDLLTG----HVETLSGHEDAVQA-VVFSPDGDTLFSGGSDGTIRMW 613          

HSP 2 Score: 46.9802 bits (110), Expect = 9.020e-6
Identity = 38/168 (22.62%), Postives = 66/168 (39.29%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSK--------------------KYGVEMIKFTHCSTAVI------HASNKV--------------DDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWD 435
            + S  C +  + ++D VN++ F      L++SS D +++++D   G+  Q  Y                       YGV  +      TA +      H +N++              D  +R + L    ++    GH   V ++  SP  DT  SG  D TIR+W+
Sbjct:  448 VNSERCRQTLRGHTDSVNSVEFLPYSSTLLTSSADKTLSLWDARTGRCAQIFYGHLHSCNHGTFNLKGDTVVSCDSYGVIKVWDVRKGTATMTLNLGPHPANRLSFHPSGHVMAVASDDACVRIVDLL-TGHVETLSGHEDAVQAVVFSPDGDTLFSGGSDGTIRMWE 614          
BLAST of WD repeat domain 82 vs. Ensembl Sea Lamprey
Match: GNB3 (G protein subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:4400])

HSP 1 Score: 60.8474 bits (146), Expect = 8.803e-11
Identity = 43/171 (25.15%), Postives = 76/171 (44.44%), Query Frame = 1
Query:  337 YPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAID--PEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIW 843
            + GH+  V+SL+++P    F+SG+ D + +LWD+R   C+         + AI   P G  F       TC+L+DLR  ++       L    H+     ++S+ FS  G++LL  +      + D+       +  +L  +  ++      T D   +  GS +  L IW
Sbjct:   92 FVGHSGDVMSLALAPDGRAFVSGACDASAKLWDVRDGMCRQTFSGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQE-------LVLYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNVWDAMKA---ERAGVLAGHDNRVSCLG-VTEDGMAVATGSWDSFLKIW 251          
BLAST of WD repeat domain 82 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 6.488e-10
Identity = 67/278 (24.10%), Postives = 115/278 (41.37%), Query Frame = 1
Query:   73 KCFKDNSDKV-NAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSA 903
            K  K + D V   + F  N  +++S S D+++ V+  + GK L+T+     GV    ++      I  S   D  L+  +    + +    GHT  V  + +    +  +SGS D T+R+WD+ T  C  ++      +  +  +G          T K++D       P     L  L    NR  V SL+F  DG  ++     T I + D+ TG  LH L  +G  S    + +        +++G+ +  + IW +   Q +  LQ      SA
Sbjct:  227 KVLKGHDDHVITCLQFCGN--RIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGV----WSSQMRGNIIVSGSTDRTLKVWNADTGQCVHTLYGHTSTVRCMHLH--GNRVVSGSRDATLRVWDIETGQCLHVLAGHVAAVRCVQYDGRRVVSGAYDYTVKVWD-------PESETCLHTLQGHTNR--VYSLQF--DGVHIVSGSLDTSIRVWDAETGTCLHTL--VGHQS----LTSGMELRDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSA 479          

HSP 2 Score: 54.6842 bits (130), Expect = 3.255e-8
Identity = 49/192 (25.52%), Postives = 87/192 (45.31%), Query Frame = 1
Query:   40 NDDSLRSY-----ECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFC---VCISSD--TCKLYDLRTFEQGPFL 585
             D +LR +     +C      +   V  + +  +G +++S + D ++ V+D  +   L T+      V  ++F      V   S  +D ++R         +    GH  + ++  M   ++  +SG+ D T+++WD++T  C   +Q P K  +A+    L F    V  SSD  T KL+DLRT   G FL
Sbjct:  332 RDATLRVWDIETGQCLHVLAGHVAAVRCVQY--DGRRVVSGAYDYTVKVWDPESETCLHTLQGHTNRVYSLQFD----GVHIVSGSLDTSIRVWDAETGTCLHTLVGH--QSLTSGMELRDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAV--TCLQFSRKLVVTSSDDGTVKLWDLRT---GDFL 510          
BLAST of WD repeat domain 82 vs. Ensembl Yeast
Match: SWD2 (Subunit of the COMPASS (Set1C) histone H3K4 methyltransferase complex; required for Set1C stability and optimal activity; COMPASS methylates histone H3 on lys 4 and is involved in telomeric silencing; subunit of CPF (cleavage and polyadenylation factor), a complex involved in RNAP II transcription termination [Source:SGD;Acc:S000001501])

HSP 1 Score: 162.155 bits (409), Expect = 3.437e-46
Identity = 94/285 (32.98%), Postives = 157/285 (55.09%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSD---KVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSD-TCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDI-----NACFTPDSRYIMAGSPEGRLYIWRVSNA 858
            + +N  +L  ++  K F+        V ++NF  NG+ L++SS +D++ +Y   N K L TI SKKYG     FTH     I++S   + +++YL+L  N+Y+R + GH   V  L M+P NDTFLS S D+++RLWDL+ +  Q ++        A DP GL+F +    +    LY+L+  ++GPFL   +    ++      + L FS +GK LL+  +  +  + D+FTG+ L +L  +GT +  +       +ACFTPD  +++    +GR+ IW  S++
Sbjct:    4 VSINKPNLLKFKHVKSFQPQEKDCGPVTSLNFDDNGQFLLTSSSNDTMQLYSATNCKFLDTIASKKYGCHSAIFTHAQNECIYSSTMKNFDIKYLNLETNQYLRYFSGHGALVNDLKMNPVNDTFLSSSYDESVRLWDLKISKPQVIIPSLVPNCIAYDPSGLVFALGNPENFEIGLYNLKKIQEGPFLIIKI----NDATFSQWNKLEFSNNGKYLLVGSSIGKHLIFDAFTGQQLFEL--IGTRAFPMREFLDSGSACFTPDGEFVLGTDYDGRIAIWNHSDS 282          
BLAST of WD repeat domain 82 vs. Ensembl Yeast
Match: TAF5 (Subunit (90 kDa) of TFIID and SAGA complexes; involved in RNA polymerase II transcription initiation and in chromatin modification [Source:SGD;Acc:S000000402])

HSP 1 Score: 67.781 bits (164), Expect = 1.758e-12
Identity = 55/189 (29.10%), Postives = 78/189 (41.27%), Query Frame = 1
Query:  343 GHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAID----PEGLIFCVCISSDTCKL------YDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            GH+  V S S SP N   LSGS DKT+RLW + T    AL+   G      D    P G  F       T +L      Y LR F                G+  DV  + F P+G  +    +     + D  TG S+     LG  +  I I  C  PD R++  GS +G + +W +   +R+  ++
Sbjct:  523 GHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHT--ALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIF---------------AGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLF--LGHTAPVISIAVC--PDGRWLSTGSEDGIINVWDIGTGKRLKQMR 690          

HSP 2 Score: 56.225 bits (134), Expect = 8.369e-9
Identity = 62/287 (21.60%), Postives = 119/287 (41.46%), Query Frame = 1
Query:   67 CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAV-----IHASNKVDDNLRYLSLHDNKYIRL-----------YPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQAL--MQLPGKGLAAID-----PEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNA 858
            C   F++ +  ++ ++F+ +     +  QD  I ++  ++G  L          +  +   C T V     +++++   DN   LS  ++K +RL           Y GH   V  +S SP    F + S D+T RLW     +C  +  +++    L  +D     P G       S  TC+++D+ T   G  +   L      G+   V S+   PDG+ L        I + D  TG+ L Q++  G N+     +  ++ +   +++G  +  + +W +  A
Sbjct:  458 CMYTFQNTNKDMSCLDFSDDCRIAAAGFQDSYIKIWS-LDGSSLNNPNIALNNNDKDEDPTCKTLVGHSGTVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLW-----SCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVST---GDSVRLFL------GHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAI---YSLSYSKEGNVLISGGADHTVRVWDLKKA 726          

HSP 3 Score: 48.9062 bits (115), Expect = 1.236e-6
Identity = 35/152 (23.03%), Postives = 67/152 (44.08%), Query Frame = 1
Query:   19 NFFKMKLNDDSLRSYEC-----FKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVI-SLSMSPTNDTFLSGSLDKTIRLWDLRTANCQ 456
            ++F    +D + R + C      + F  + + V+ ++F  NG  + + S D +  ++DV  G  ++      +   +I    C      ++   D  +    +   K ++   GH K  I SLS S   +  +SG  D T+R+WDL+ A  +
Sbjct:  580 HYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLG--HTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTE 729          

HSP 4 Score: 48.1358 bits (113), Expect = 2.508e-6
Identity = 42/182 (23.08%), Postives = 78/182 (42.86%), Query Frame = 1
Query:   49 SLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI-----DPEGLIFCVCISSDTCKLYDLRTFEQGP 579
            S+ ++     +K ++  V  ++F+  G    ++S D +  ++   +   L+        V+ + F      V   S+  D   R   +     +RL+ GHT  VIS+++ P      +GS D  I +WD+ T   + L Q+ G G  AI       EG +     +  T +++DL+     P
Sbjct:  553 SMDTHTALVSYKGHNHPVWDVSFSPLGHYFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSS--DKTCRMWDVSTGDSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTG--KRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVRVWDLKKATTEP 730          
BLAST of WD repeat domain 82 vs. Ensembl Yeast
Match: CDC40 (Pre-mRNA splicing factor; important for catalytic step II of pre-mRNA splicing and plays a role in cell cycle progression, particularly at the G1/S phase transition; required for DNA synthesis during mitosis and meiosis; has WD repeats; thermosensitivity of the cdc40 null mutant is functionally complemented by a chimeric construct containing the N-terminal 156 amino acids of yeast Cdc40p fused to the C-terminal two thirds (297 amino acids) of human CDC40 [Source:SGD;Acc:S000002772])

HSP 1 Score: 64.3142 bits (155), Expect = 1.466e-11
Identity = 64/282 (22.70%), Postives = 124/282 (43.97%), Query Frame = 1
Query:   46 DSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGK-----HLQT----IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWD------LRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLR-TFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNS-TQIDINACFTPDSRYIMAGSPEGRLYI 840
            D    YEC + F+ ++  + A+ FT + +  +SSS D S+ ++D   GK     HL +    + S+            ++ ++H  ++V +N           ++ Y  H   +++L   P    F+S S DKT+R+W+      ++  +  A   +P      + P    FC     +    + L+  +++ P   F      H      + SL FS DG+ +    + +++   D  T R L+ ++I G    TQ+D +   T  S+ I +G+  G++Y+
Sbjct:  191 DFYHDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDRVSEN--------QGLVQTYDHHLSSILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTAQHSMP---FLNVHPSQNYFCAQSMDNRIYSFSLKPKYKRHPKKIFKG----HSSAGYGI-SLAFSGDGRYICSGDSKSRLFTWDWNTSRLLNNIKIPGNKPITQVDWHPQET--SKVICSGAA-GKIYV 453          

HSP 2 Score: 50.0618 bits (118), Expect = 5.112e-7
Identity = 46/201 (22.89%), Postives = 87/201 (43.28%), Query Frame = 1
Query:  313 HDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPG--KGLAAIDPEGLIFCVCISSDTCKLYDLRTFE-QGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAG 906
            HD + +R + GH K + +L  +    +FLS S D+++++WD  T   +  + L      + +       F V +S+     YD R  E QG   T+     HH  +   + +L++ PDG   + S     + + ++     + Q+     +S    +N    P   Y  A S + R+Y + +    +    +  +G +SAG
Sbjct:  194 HDYECLRDFQGHNKPIKALRFTEDCQSFLSSSFDRSVKIWDTETGKVKTRLHLNSTPADVESRPTNPHEFIVGLSNSKILHYDDRVSENQGLVQTYD----HHLSS---ILALKYFPDGSKFISSSEDKTVRIWENQINVPIKQISDTAQHSMPF-LNV--HPSQNYFCAQSMDNRIYSFSLKPKYKRHPKKIFKGHSSAG 384          
BLAST of WD repeat domain 82 vs. Ensembl Yeast
Match: PWP2 (Conserved 90S pre-ribosomal component; essential for proper endonucleolytic cleavage of the 35 S rRNA precursor at A0, A1, and A2 sites; contains eight WD-repeats; PWP2 deletion leads to defects in cell cycle and bud morphogenesis [Source:SGD;Acc:S000000653])

HSP 1 Score: 56.6102 bits (135), Expect = 5.266e-9
Identity = 37/129 (28.68%), Postives = 63/129 (48.84%), Query Frame = 1
Query:   67 CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHC-----STAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDL 438
            C   F++++  V A+ F   G+ + SSS D ++  +D+I  ++ +T      G E I+F +C     S  V+ A +  + ++   S+   + +    GH   V  LS S  N    S S DKTIR+W +
Sbjct:  379 CLATFEEHTSSVTAVQFAKRGQVMFSSSLDGTVRAWDLIRYRNFRTFT----GTERIQF-NCLAVDPSGEVVCAGSLDNFDIHVWSVQTGQLLDALSGHEGPVSCLSFSQENSVLASASWDKTIRIWSI 502          

HSP 2 Score: 51.6026 bits (122), Expect = 2.331e-7
Identity = 50/220 (22.73%), Postives = 98/220 (44.55%), Query Frame = 1
Query:   94 DKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVIS-LSMSPTNDTFLSGSLDK-TIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSD-----------TCKLYDL--RTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLD 708
            D  N++ ++ +G +++++S+D  I V+D+ +G  L T       V  ++F      +  +S  +D  +R   L   +  R + G  +   + L++ P+ +   +GSLD   I +W ++T   Q L  L G        EG + C+  S +           T +++ +  R+ +  P   +S           DV +L   PDGK + +S    QI++ +
Sbjct:  346 DSTNSLAYSPDGSRVVTASEDGKIKVWDITSGFCLATFEEHTSSVTAVQFAKRGQVMFSSS--LDGTVRAWDLIRYRNFRTFTGTERIQFNCLAVDPSGEVVCAGSLDNFDIHVWSVQTG--QLLDALSGH-------EGPVSCLSFSQENSVLASASWDKTIRIWSIFGRSQQVEPIEVYS-----------DVLALSMRPDGKEVAVSTLKGQISIFN 543          
BLAST of WD repeat domain 82 vs. Ensembl Yeast
Match: CAF4 (WD40 repeat-containing protein associated with the CCR4-NOT complex; interacts in a Ccr4p-dependent manner with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p and plays a role in mitochondrial fission; CAF4 has a paralog, MDV1, that arose from the whole genome duplication [Source:SGD;Acc:S000001744])

HSP 1 Score: 56.225 bits (134), Expect = 7.268e-9
Identity = 49/193 (25.39%), Postives = 90/193 (46.63%), Query Frame = 1
Query:   67 CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGK---HLQTIYSKKY-----------------GVE--MIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALM--QLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQ 573
            C   F+ + D++ A++F S  E L+S S+D  I  +D+  GK    L  I++  +                 G E  MI    C  + +    K D  +R   L   K +RL  GHT  + SL     ++  ++GS+D ++R+WDLRT++   ++   LP   ++++D +G +  V  +     ++++   E 
Sbjct:  416 CIHNFELHKDEITALSFDS--EALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNGACLLGTEAPMIGALQCYNSALATGTK-DGIVRLWDLRVGKPVRLLEGHTDGITSLKFD--SEKLVTGSMDNSVRIWDLRTSSILDVIAYDLP---VSSLDFDGKLITVGANEGGVNVFNMERDEH 600          
BLAST of WD repeat domain 82 vs. Ensembl Nematostella
Match: EDO40534 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6W9])

HSP 1 Score: 303.523 bits (776), Expect = 1.990e-100
Identity = 151/337 (44.81%), Postives = 214/337 (63.50%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINAC---FTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQI 1032
            MKL+D  +RS    K F++NSD VN + F++NGE LI+SS DDSI +YD ++GK  +TIYSKKYGV  I++TH    VIH S KVDD +RYLSLHDNKY+R +PGHTK+V +L MSP  DTF+SGSLD T+R+WDLR+ NCQ LM + G+ +AA DPEGLIF   I  +  KLYDLR+F++GPF TF +         ++ +S++FS DGKM+LLS  G  I L+D+F G  LH       + T    N C   F+PDS+Y+++GS +G+++ W   +  +I+ L+ +  G++                    ++ NP+F  +A      + W+P +
Sbjct:    1 MKLDDSVVRSLRVAKVFRENSDNVNHMAFSANGESLITSSNDDSIVIYDCVDGKPKKTIYSKKYGVANIQYTHAQNTVIHTSTKVDDTIRYLSLHDNKYLRYFPGHTKRVTTLHMSPVEDTFVSGSLDCTLRIWDLRSPNCQGLMHVNGRPVAAFDPEGLIFAAGIDCEMIKLYDLRSFDKGPFSTFHI----QTDPNIEWNSIKFSYDGKMILLSTNGGSIYLIDAFQGTQLHAFTGHAVSKT----NPCEVTFSPDSQYVISGSQDGKVHFWASDSGHKISTLEGNHPGSTR------------------CVKFNPKFMMLASACTNMAFWLPNL 311          
BLAST of WD repeat domain 82 vs. Ensembl Nematostella
Match: EDO33297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL6])

HSP 1 Score: 94.3597 bits (233), Expect = 2.930e-21
Identity = 67/268 (25.00%), Postives = 130/268 (48.51%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFE-QGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEG 891
            V+++ F+ NGE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+       K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      + A+  + +G +         C+++D  + +     +    PP         VS ++FSP+GK +L +     + L D   G+ L      G  + +  + A F+    ++I++GS + ++YIW   N Q   ++Q  +G
Sbjct:   68 VSSVKFSHNGEWLASSSADKVIKIWGAYDGKFEKTITGHKLGISDVAWSTDSRHLVSASD--DKTLKIWDFATGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPP---------VSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIW---NLQSKEVVQKLDG 319          

HSP 2 Score: 51.9878 bits (123), Expect = 2.930e-7
Identity = 41/154 (26.62%), Postives = 78/154 (50.65%), Query Frame = 1
Query:   43 DDSLRSYE-----CFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQT-IYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHT--KKVISLSMSPTNDTFL-SGSLDKTIRLWDLRTANCQALMQLPG 477
            D+S+R ++     C K    +SD V A++F  +G  ++SSS D    ++D  +G+ L+T I      V  +KF+     ++ A+  +D+ L+       K ++ Y GH   K  +  + S T   ++ SGS D  + +W+L++   + + +L G
Sbjct:  170 DESVRIWDVKTGKCLKTLPAHSDPVTAVHFNRDGALIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAAT--LDNTLKLWDYSKGKCLKTYTGHKNEKYCVFANFSVTGGKWIVSGSEDHKVYIWNLQSK--EVVQKLDG 319          
BLAST of WD repeat domain 82 vs. Ensembl Nematostella
Match: EDO45346 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA6])

HSP 1 Score: 78.9518 bits (193), Expect = 7.157e-16
Identity = 63/270 (23.33%), Postives = 127/270 (47.04%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYG-VEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAID--PEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVS 852
            +R+Y     F  + D + ++ F+ +G  + S+S+D ++ ++ V + K   T++      V  + F+    +++ AS+  D +L+  ++H  K++     H   V     SP     +SGS DKTI+LWD  + +C      PG  + +++  P G       +  T K++D+R       L       H++ +   V+S+ F P G  L+ + + T + +LD   GR  + L      +T +     F+ +  Y  +GS + ++ +W+ +
Sbjct:   51 MRAYR----FVGHKDAILSVKFSPSGHLIASASRDKTVRLW-VPSVKGESTVFKAHTATVRSVDFSGDGQSLLTASD--DKSLKVWTVHRQKFLYSLNAHMNWVRCAKFSPDGRLIVSGSDDKTIKLWDRTSKDCVHTFYDPGGFVNSVEFHPSGTCIAAGGTDSTVKVWDIR---MNKLLQ------HYQAHTGAVNSVSFHPSGNYLVSASSDTTLKILDLMEGRLFYTLHGHQGPATSV----VFSRNGEYFASGSSDEQVMVWKTN 300          
BLAST of WD repeat domain 82 vs. Ensembl Nematostella
Match: EDO35821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKD9])

HSP 1 Score: 75.8702 bits (185), Expect = 2.773e-15
Identity = 67/277 (24.19%), Postives = 128/277 (46.21%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMS-PTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDT-------CKL--YDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTS 900
            V A+ F S+G   ++   D  + +++      L+T YS  +G E++       +   AS   D  +    +   + IR Y GHT +V  +  + P +   +SGS D TIR WD     C++  Q P + +   D +  +  V +SS         CK+  YD+R           +  +H +     V+S+ F+ DG+ +L+S     + L+D  TG  L++ +  G  + +  +++C      ++++GS +G ++ W +  A+ I  L+ +  G +
Sbjct:   22 VRAVRFNSDGNYCLTCGSDKILALWNPHKATRLKT-YSG-HGYEVLDAVAAGDSSRIASCSADRTVVLWDVSTGQVIRRYRGHTSRVNCVKFNQPDSTVIISGSYDSTIRCWD-----CRSRSQEPVQVID--DAKDSVTSVHVSSHEILSGSVDCKVRNYDIR-----------MGTMHADCIGEPVTSVTFTQDGQCILVSSLDNTVRLMDKDTGELLNEFK--GHQNKEYKLDSCLNHTDTHVISGSEDGSIHFWDLIEAKLIFSLEKAHKGVA 276          
BLAST of WD repeat domain 82 vs. Ensembl Nematostella
Match: EDO41896 (Lissencephaly-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:A7S338])

HSP 1 Score: 72.7886 bits (177), Expect = 5.939e-14
Identity = 71/297 (23.91%), Postives = 127/297 (42.76%), Query Frame = 1
Query:  136 LISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDP--EGLIFCVCISSDTCKLY---------DLR----TFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASG---KAGTISPLNIGALECN 972
            +++SS+D ++ V+D   G   +T+      V+ + F H  T    AS+  D  ++       + IR   GH   V S+S  P+ D  +S S DKTI++W++ T  C    Q  G+ +  + P  +G +   C +  T +++         DLR      E   +   S  P+ +E   V+      SP G  L+ +     I + D   G  L  + ++G ++    +   F P  ++I++ S +  L IW   N +    L + E   +   F+ S      G++  L +   EC 
Sbjct:  121 MVTSSEDATVKVWDYETGDFERTLKGHTDAVQDLAFDH--TGKFLASSSADMTIKLWDFQGFECIRTLHGHDHNVSSISFLPSGDHLVSASRDKTIKMWEIATGYCVKTFQGHGEWVRRVRPNADGSLIASCSNDQTIRVWVVASRECKCDLRDHDHVIEDLNWAPESATPVINEAAGVEGGKKAMSP-GPFLVSASRDKSIKIWDVSAGVCL--VTLVGHDNWVRAV--MFHPGGKFIVSCSDDKTLRIWDYKNKRCAKTLVAHEHFVTTLDFHKSAPFVATGSVD-LTLKVWECR 409          
BLAST of WD repeat domain 82 vs. Ensembl Medaka
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:110015105])

HSP 1 Score: 324.709 bits (831), Expect = 3.739e-108
Identity = 160/335 (47.76%), Postives = 219/335 (65.37%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKL D+ LRS+   K F++NSDK+N  +F+SNGE +ISSS DDS+ +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGHTK+V SLSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   I+S+  KLYDLR+F++GPF TF L          + + L+FS DGK++LLS  G  + +LD+F G  LH       NS  + + A FTPDS ++M GS +G++++W   +  ++ALL     G                   I  L+ NP+F   A      + W+P I+
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSSNGETIISSSDDDSLVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTKRVTSLSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGINSEMVKLYDLRSFDKGPFATFKL----QYDRTCEWTGLKFSNDGKLILLSTNGGALRILDAFKGVVLHSFGGY-NNSKGVTLEASFTPDSLFVMIGSEDGKIHVWNAESGMKVALLDGKHTGP------------------ITCLQFNPKFMTFASACSNMAFWLPTID 312          
BLAST of WD repeat domain 82 vs. Ensembl Medaka
Match: wdr82 (WD repeat domain 82 [Source:NCBI gene;Acc:110015105])

HSP 1 Score: 317.005 bits (811), Expect = 2.050e-101
Identity = 157/321 (48.91%), Postives = 213/321 (66.36%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIA 993
            MKL D+ LRS+   K F++NSDK+N  +F+SNGE +ISSS DDS+ +YD   GK  +T+YSKKYGV++I++TH +  V+++SNK+DD +RYLSLHDNKYIR +PGHTK+V SLSMSP +DTF+SGSLDKTIRLWDLR+ NCQ LM L GK + + DPEGLIF   I+S+  KLYDLR+F++GPF TF L          + + L+FS DGK++LLS  G  + +LD+F G  LH       NS  + + A FTPDS ++M GS +G++++W   +  ++ALL     G                   I  L+ NP+F   A
Sbjct:    1 MKLTDNVLRSFRVAKVFRENSDKINCFDFSSNGETIISSSDDDSLVLYDCQEGKPKRTLYSKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTKRVTSLSMSPVDDTFISGSLDKTIRLWDLRSPNCQGLMHLQGKPVCSFDPEGLIFAAGINSEMVKLYDLRSFDKGPFATFKL----QYDRTCEWTGLKFSNDGKLILLSTNGGALRILDAFKGVVLHSFGGY-NNSKGVTLEASFTPDSLFVMIGSEDGKIHVWNAESGMKVALLDGKHTGP------------------ITCLQFNPKFMTFA 298          
BLAST of WD repeat domain 82 vs. Ensembl Medaka
Match: ENSORLT00000042356.1 (WD repeat-containing protein 82 [Source:NCBI gene;Acc:101173843])

HSP 1 Score: 280.796 bits (717), Expect = 4.555e-91
Identity = 143/334 (42.81%), Postives = 210/334 (62.87%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHC-STAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRV-DVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMP 1026
            MK+ D  LRS+   + ++ NS+KVN ++++ NGE +ISSS DD I +YD+  GK  +T++SKKYGV++I++T+  S  V++ SNK+DD +RYLSL DNKYIR +PGH+ +V +LSMSP ++ F+S SLDKTIR+WDLRT +CQ L    G+ + + DP+GLIF   + S   KLYDLR F++GPF  F         NRV D + L+FS DGK +L+   G  I +L++F+G  LH       NST + + ACFTPDS+++M GS +GR+++W   +  ++A+L     G                P+N   L+ NP+F   A      + W+P
Sbjct:    1 MKITDSVLRSFRVARTYRCNSEKVNCLDYSPNGESVISSSNDDCIVLYDMQEGKPSRTLFSKKYGVDLIRYTYGDSNTVVYTSNKLDDTIRYLSLTDNKYIRYFPGHSARVTALSMSPVDEMFISSSLDKTIRIWDLRTPDCQGLTNPLGRPICSFDPDGLIFAAGVESRAIKLYDLRAFDKGPFANF-----ETRFNRVCDWTGLKFSNDGKQILIYTNGGAIRILNAFSGSVLHTFSGY-NNSTGMALEACFTPDSQFVMIGSEDGRVHVWSTESGMKVAVLDGKHPG----------------PIN--TLQFNPRFMTFASACTNMTFWLP 310          
BLAST of WD repeat domain 82 vs. Ensembl Medaka
Match: ENSORLT00000023503.2 (WD repeat-containing protein 82 [Source:NCBI gene;Acc:101173843])

HSP 1 Score: 271.552 bits (693), Expect = 1.582e-87
Identity = 140/329 (42.55%), Postives = 205/329 (62.31%), Query Frame = 1
Query:   46 DSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHC-STAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRV-DVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMP 1026
            +S R    ++C   NS+KVN ++++ NGE +ISSS DD I +YD+  GK  +T++SKKYGV++I++T+  S  V++ SNK+DD +RYLSL DNKYIR +PGH+ +V +LSMSP ++ F+S SLDKTIR+WDLRT +CQ L    G+ + + DP+GLIF   + S   KLYDLR F++GPF  F         NRV D + L+FS DGK +L+   G  I +L++F+G  LH       NST + + ACFTPDS+++M GS +GR+++W   +  ++A+L     G                P+N   L+ NP+F   A      + W+P
Sbjct:    3 ESFRVARTYRC---NSEKVNCLDYSPNGESVISSSNDDCIVLYDMQEGKPSRTLFSKKYGVDLIRYTYGDSNTVVYTSNKLDDTIRYLSLTDNKYIRYFPGHSARVTALSMSPVDEMFISSSLDKTIRIWDLRTPDCQGLTNPLGRPICSFDPDGLIFAAGVESRAIKLYDLRAFDKGPFANF-----ETRFNRVCDWTGLKFSNDGKQILIYTNGGAIRILNAFSGSVLHTFSGY-NNSTGMALEACFTPDSQFVMIGSEDGRVHVWSTESGMKVAVLDGKHPG----------------PIN--TLQFNPRFMTFASACTNMTFWLP 304          
BLAST of WD repeat domain 82 vs. Ensembl Medaka
Match: wdr5 (WD repeat domain 5 [Source:NCBI gene;Acc:101166483])

HSP 1 Score: 93.9745 bits (232), Expect = 8.595e-21
Identity = 66/263 (25.10%), Postives = 131/263 (49.81%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAI--DPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFT-PDSRYIMAGSPEGRLYIWRVSNAQRIALLQ 879
            V+++ F+ +GE L SSS D  I ++   +GK  +TI   K G+  + ++  S  ++ AS+  D  L+   ++  K ++   GH+  V   + +P ++  +SGS D+++R+WD++T  C   +      ++A+  + +G +         C+++D  + +        L  L  + N   VS ++FSP+GK +L +     + L D   G+ L      G  + +  I A F+    ++I++GS +  +YIW +   + +  LQ
Sbjct:   48 VSSVKFSPSGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASD--DKTLKIWDVNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQ-------CLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYT--GHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQ 298          

HSP 2 Score: 51.2174 bits (121), Expect = 1.169e-6
Identity = 37/129 (28.68%), Postives = 67/129 (51.94%), Query Frame = 1
Query:   58 SYECFKCF-KDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYL-SLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSL--DKTIRLW 432
            S +C K    D++  V+ + F+ NG+ +++++ D+++ ++D   GK L+T    K     I      T      +  +DN+ Y+ +L   + ++   GHT  VIS +  PT +   S +L  DKTI+LW
Sbjct:  202 SGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330          

HSP 3 Score: 50.447 bits (119), Expect = 1.907e-6
Identity = 35/135 (25.93%), Postives = 61/135 (45.19%), Query Frame = 1
Query:   52 LRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIR-LYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANC 453
            + S +C K  K +S+ V   NF      ++S S D+S+ ++DV  GK L+T+ +    V  + F    + ++ +S   D   R       + ++ L       V  +  SP     L+ +LD T++LWD     C
Sbjct:  116 VNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSS--YDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKC 248          
BLAST of WD repeat domain 82 vs. Planmine SMEST
Match: SMESG000059185.1 (SMESG000059185.1)

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 347/348 (99.71%), Postives = 347/348 (99.71%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQINIDVPMEIPVDNAE 1074
            MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLS AGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQINIDVPMEIPVDNAE
Sbjct:    1 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSGAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQINIDVPMEIPVDNAE 348          
BLAST of WD repeat domain 82 vs. Planmine SMEST
Match: SMESG000044331.1 (SMESG000044331.1)

HSP 1 Score: 317.005 bits (811), Expect = 2.887e-105
Identity = 153/335 (45.67%), Postives = 228/335 (68.06%), Query Frame = 1
Query:   31 MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKAGTISPLNIGALECNPQFSQIAVGQIQTSIWMPQIN 1035
            MKLND++++ +   K FKDN+DK+N+++F+SNGE LISSS DD + +YD I G   + + SKKYGV +++FTH S   IHAS K+DD +RYLSLHDNKYIR + GH+K+V++LSMSP +D FLSGSLDKTIRLWDL+T N    +   G+ + A DPEG IF   ++S++ KLYDLR++++GPF+TF +     +    + ++L+FSP+G+M+ +   G+QI ++D+F G+ L    ILG N  ++ I+ CF+PDS+Y++ G+P+G+L IW   N  R+AL+          GF+ +  + T  P+N  A   NP+F+ I+      + W PQI+
Sbjct:    1 MKLNDNNIKKFVPSKYFKDNTDKINSLSFSSNGENLISSSYDDQMIIYDCITGVAKRHLNSKKYGVNLMQFTHSSNTAIHASTKLDDTIRYLSLHDNKYIRYFVGHSKRVVTLSMSPVSDMFLSGSLDKTIRLWDLKTHNSLGFIHTTGRPVGAFDPEGQIFVAGVNSESMKLYDLRSYDKGPFVTFEVVQEAED----EWNALKFSPNGRMIAICSNGSQIKVIDAFDGKLLSNFMILGANPQRVPIDVCFSPDSQYLVCGAPDGQLCIWNTENKNRVALIP---------GFDHTPNS-TSQPINCVAF--NPKFAMISSAVTNLTFWSPQID 319          
BLAST of WD repeat domain 82 vs. Planmine SMEST
Match: SMESG000010494.1 (SMESG000010494.1)

HSP 1 Score: 74.7146 bits (182), Expect = 3.691e-14
Identity = 68/263 (25.86%), Postives = 113/263 (42.97%), Query Frame = 1
Query:  100 VNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPE-GLIFCVCISSD-TCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQS 882
            V  I+F+ + E  I+ S D  + +++V NGK   ++     GV  +K +H    V       D  ++   L  NK IR Y GHT  V  L M P  D  ++G  D  +R+WD+RT     ++      +A++  +  L   +  S D T +L+DLR  +    LT          ++  V S+   P      +S +   I       G+ +  ++  G N+    INA    ++   ++G  +G LY W   +      LQS
Sbjct:  140 VRCISFSPDNEYFITGSDDRMLKIWNVDNGKLRLSLTGHVSGVRGVKISHRHPYVFSCGE--DKTVKCWDLEQNKVIRHYHGHTSAVYCLDMHPDLDLLMTGGRDSVVRVWDMRTKINVHILSGHRDAVASVRCQSNLPEVISGSHDATVRLWDLRAAKTQSVLT---------NHKKAVRSVFIHPITDH-FMSGSADGIKQFSLPEGQFMQNMK--GHNTI---INAVTVNENNVAVSGGNDGTLYFWDWKSGYNFQKLQS 385          
BLAST of WD repeat domain 82 vs. Planmine SMEST
Match: SMESG000018712.1 (SMESG000018712.1)

HSP 1 Score: 66.2402 bits (160), Expect = 1.216e-11
Identity = 58/237 (24.47%), Postives = 100/237 (42.19%), Query Frame = 1
Query:   97 KVNAINFTSNGEKLISSSQDDSINVYD--VINGKH----------------------------LQTIYS---KKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHD----------NKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAID--PEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLL 672
            K+ A++++S+   L+S+SQD  + V+D    N  H                            + +IYS   ++  V + +     T  +     +DDN    S  D           + +  + GHT  V+SLS++P   TF+SG+ D + +LWDLR   C+         + AI   P G  F       TC+L+D+R  ++       +    H+     ++S+ FS  G++LL
Sbjct:   57 KIYAMHWSSDSRNLVSASQDGKLIVWDGYSTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFIDDNQIVTSSGDVTCGLWDIETGQQVATFTGHTGDVMSLSLAPDMRTFVSGACDASAKLWDLRDGQCKQTFPGHESDINAITFFPNGQAFATGSDDATCRLFDIRADQE-------IGMFSHDNIICGITSVAFSKSGRLLL 286          
BLAST of WD repeat domain 82 vs. Planmine SMEST
Match: SMESG000008519.1 (SMESG000008519.1)

HSP 1 Score: 63.929 bits (154), Expect = 4.594e-11
Identity = 59/273 (21.61%), Postives = 116/273 (42.49%), Query Frame = 1
Query:   40 NDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDVINGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYIRLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGKGLAAIDPE----GLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVDVSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINACFTPDSRYIMAGSPEGRLYIWR 846
            ND SL     +  FK ++ +V  + F  +   + +   D    ++DV +GK +  +      V  ++F          +   D  +    +H+ + +    GH  ++ +   +       + S+DK+I++WDLR    + L  L G     +D      G       + +T +L+D++         FS P    +G+  +VS + F+P G +LL + A       ++ TG+    +Q+L  ++ +I  +  F  D   I+ GS +    IW+
Sbjct:   43 NDGSL-----YHTFKGHTAEVVCVQFNPSSTLVGTGGMDTLAMLWDVESGKCVSNLQGHTAEVISLQFGQAHNGKHLITGSFDHTVILWDVHNGRRVSQLIGHDAEISAAVFNFDGTYVATASMDKSIKIWDLRMG-ARDLFTLAGHTDEVLDVTFDNVGKQVASAGADNTVRLWDVK--------DFSKPSFIFKGHEAEVSKVTFNPQGTVLLSASADKSARTWNTTTGKV---IQVLEGHTDEI-FSCAFNYDGSKIITGSKDNTCRIWQ 297          
The following BLAST results are available for this feature:
BLAST of WD repeat domain 82 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR824.109e-10646.27WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR822.453e-2865.75WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:2... [more]
WDR56.401e-2125.48WD repeat domain 5 [Source:HGNC Symbol;Acc:HGNC:12... [more]
WDR5B6.160e-2024.34WD repeat domain 5B [Source:HGNC Symbol;Acc:HGNC:1... [more]
WDR824.552e-1772.34WD repeat domain 82 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
swd-2.22.363e-6741.49Set1 WD40 repeat protein [Source:UniProtKB/TrEMBL... [more]
swd-2.11.816e-3528.84Set1 WD40 repeat protein [Source:UniProtKB/TrEMBL... [more]
wdr-5.11.170e-1523.05WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.11.170e-1523.05WD repeat-containing protein wdr-5.1 [Source:UniP... [more]
wdr-5.33.356e-1422.38WD repeat-containing protein wdr-5.3 [Source:UniP... [more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr821.836e-10346.25gene:FBgn0032030 transcript:FBtr0079650[more]
CG35151.930e-3224.50gene:FBgn0031431 transcript:FBtr0077750[more]
wds4.012e-2226.24gene:FBgn0040066 transcript:FBtr0308566[more]
wds4.012e-2226.24gene:FBgn0040066 transcript:FBtr0070438[more]
CG109316.301e-1424.15gene:FBgn0034274 transcript:FBtr0089545[more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr822.435e-10747.16WD repeat domain 82 [Source:NCBI gene;Acc:321614][more]
wdr51.490e-2025.10WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
wdr53.184e-1430.16WD repeat domain 5 [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
daw13.794e-1321.36dynein assembly factor with WDR repeat domains 1 [... [more]
daw14.165e-1321.36dynein assembly factor with WDR repeat domains 1 [... [more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agxt26.437e-10545.37alanine--glyoxylate aminotransferase 2 [Source:Xen... [more]
agxt23.237e-9950.00alanine--glyoxylate aminotransferase 2 [Source:Xen... [more]
ppp4r1l3.460e-2125.19protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l3.860e-2125.19protein phosphatase 4 regulatory subunit 1 like (p... [more]
ppp4r1l5.694e-2125.19protein phosphatase 4 regulatory subunit 1 like (p... [more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr822.821e-10646.27WD repeat domain containing 82 [Source:MGI Symbol;... [more]
Wdr54.395e-2125.48WD repeat domain 5 [Source:MGI Symbol;Acc:MGI:2155... [more]
Wdr5b2.447e-1923.60WD repeat domain 5B [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr389.295e-1828.40WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:192... [more]
Wdr389.295e-1828.40WD repeat domain 38 [Source:MGI Symbol;Acc:MGI:192... [more]
back to top
BLAST of WD repeat domain 82 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NV31|WDR82_DANRE1.838e-10647.16WD repeat-containing protein 82 OS=Danio rerio OX=... [more]
sp|Q5ZMV7|WDR82_CHICK2.463e-10646.87WD repeat-containing protein 82 OS=Gallus gallus O... [more]
sp|Q58E77|WD82B_XENLA1.238e-10546.57WD repeat-containing protein 82-B OS=Xenopus laevi... [more]
sp|Q8BFQ4|WDR82_MOUSE1.973e-10546.27WD repeat-containing protein 82 OS=Mus musculus OX... [more]
sp|Q6UXN9|WDR82_HUMAN1.973e-10546.27WD repeat-containing protein 82 OS=Homo sapiens OX... [more]
back to top
BLAST of WD repeat domain 82 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A120H2D80.000e+0100.00WDR82 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A1S3H4D95.992e-10647.16WD repeat-containing protein 82 OS=Lingula unguis ... [more]
A0A3B3ST121.891e-10547.46WD repeat domain 82 OS=Paramormyrops kingsleyae OX... [more]
A0A183JDQ03.494e-10548.50WD_REPEATS_REGION domain-containing protein OS=Sch... [more]
A0A2C9JUK33.996e-10546.57WD_REPEATS_REGION domain-containing protein OS=Bio... [more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr821.137e-10747.16WD repeat domain 82 [Source:NCBI gene;Acc:10302331... [more]
wdr51.216e-2025.10WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
wdr54.560e-2026.89WD repeat domain 5 [Source:NCBI gene;Acc:103033424... [more]
ENSAMXT00000007963.21.593e-1923.95WD repeat-containing protein 5-like [Source:NCBI g... [more]
ENSAMXT00000007962.22.033e-1622.30WD repeat-containing protein 5-like [Source:NCBI g... [more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr821.105e-10645.37WD repeat domain 82 [Source:NCBI gene;Acc:321614][more]
POC1A1.151e-1422.39POC1 centriolar protein A [Source:HGNC Symbol;Acc:... [more]
ENSPMAT00000004902.11.494e-1423.23pep scaffold:Pmarinus_7.0:GL478254:5937:33805:1 ge... [more]
GNB38.803e-1125.15G protein subunit beta 3 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000008862.16.488e-1024.10pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SWD23.437e-4632.98Subunit of the COMPASS (Set1C) histone H3K4 methyl... [more]
TAF51.758e-1229.10Subunit (90 kDa) of TFIID and SAGA complexes; invo... [more]
CDC401.466e-1122.70Pre-mRNA splicing factor; important for catalytic ... [more]
PWP25.266e-928.68Conserved 90S pre-ribosomal component; essential f... [more]
CAF47.268e-925.39WD40 repeat-containing protein associated with the... [more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO405341.990e-10044.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332972.930e-2125.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453467.157e-1623.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358212.773e-1524.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418965.939e-1423.91Lissencephaly-1 homolog [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of WD repeat domain 82 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr823.739e-10847.76WD repeat domain 82 [Source:NCBI gene;Acc:11001510... [more]
wdr822.050e-10148.91WD repeat domain 82 [Source:NCBI gene;Acc:11001510... [more]
ENSORLT00000042356.14.555e-9142.81WD repeat-containing protein 82 [Source:NCBI gene;... [more]
ENSORLT00000023503.21.582e-8742.55WD repeat-containing protein 82 [Source:NCBI gene;... [more]
wdr58.595e-2125.10WD repeat domain 5 [Source:NCBI gene;Acc:101166483... [more]
back to top
BLAST of WD repeat domain 82 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059185.10.000e+099.71SMESG000059185.1[more]
SMESG000044331.12.887e-10545.67SMESG000044331.1[more]
SMESG000010494.13.691e-1425.86SMESG000010494.1[more]
SMESG000018712.11.216e-1124.47SMESG000018712.1[more]
SMESG000008519.14.594e-1121.61SMESG000008519.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026151 ID=SMED30026151|Name=WD repeat domain 82|organism=Schmidtea mediterranea sexual|type=transcript|length=1462bp
CTGTTTTAATATTCAGTAAATTTCTTTAAAATGAAATTAAATGATGATAG
TTTAAGAAGTTATGAATGTTTTAAGTGTTTTAAAGATAACTCCGACAAAG
TTAATGCAATTAATTTTACTTCAAATGGAGAAAAATTAATTTCTTCTAGT
CAGGATGATTCAATAAATGTTTATGATGTTATAAATGGAAAGCATTTACA
AACAATTTACAGTAAAAAGTATGGAGTTGAAATGATAAAATTTACACATT
GTTCAACAGCTGTTATTCATGCGTCAAATAAAGTCGACGATAATTTGAGG
TATCTTTCGTTGCATGATAATAAATATATCCGGCTCTATCCTGGTCACAC
AAAGAAAGTTATTAGTTTATCAATGTCTCCTACGAATGATACATTTTTGT
CAGGTTCCCTCGACAAAACTATCCGGCTGTGGGATTTGCGTACTGCAAAT
TGTCAAGCTCTCATGCAGTTACCTGGCAAGGGATTGGCTGCTATCGATCC
AGAGGGATTGATATTCTGCGTATGCATAAGCTCTGATACCTGTAAATTAT
ACGATTTAAGAACCTTTGAACAAGGCCCATTTTTAACGTTTTCTCTACCT
CCTCTGCACCACGAAGGAAACCGAGTCGACGTTTCATCTTTAAGATTTTC
TCCAGACGGAAAAATGTTACTTTTGAGTTGGGCAGGCACGCAAATCGCGC
TTTTAGACTCATTCACAGGGCGATCTTTGCATCAACTTCAAATTCTCGGC
ACCAACTCCACCCAGATTGACATCAACGCCTGTTTCACTCCCGACAGCCG
CTATATCATGGCCGGCAGTCCCGAGGGTCGGCTGTACATTTGGCGTGTAT
CCAATGCCCAACGCATTGCTTTATTGCAGTCGAGTGAGGGCGGAACATCT
GCCGGTGGCTTTAACGCGTCTGGTAAAGCTGGGACTATCTCACCTCTCAA
TATCGGTGCACTGGAATGCAATCCACAATTCTCCCAGATCGCTGTCGGTC
AGATTCAGACCAGCATCTGGATGCCGCAAATCAATATCGATGTTCCCATG
GAGATCCCTGTTGATAATGCCGAATGAGATTTGATTGGTCAATAGATTTT
ATCCGTTGCTATTATTTATGTTTTTAAATGTTCGCAATTTTATTTATTTG
TATTCATTACTGTTATTGTTAATCCGCTGTCATTCACATAGTGATGATAA
TCATTTAAATAGCCCACCTTAGATTGGTTGTAATAGTCGCAGTTAGTTGT
GAGCTTTCCACTGAACCCCCAATCCCTGGCGACCCTAAATGACCCGGATT
CGAGATTATCATAAAGGCGAGCTCCATCAAACTAGATATAAATATGAAGC
GCGATCACCAAGGAGACAGACTAATATCGAGAATCATCGTTGCATGTTCT
TCATTGCTGTGATAACGGGACGGGACTTCATTTCAGCAAGTTCAAGAAGA
TCTGACTTCCAG
back to top

protein sequence of SMED30026151-orf-1

>SMED30026151-orf-1 ID=SMED30026151-orf-1|Name=SMED30026151-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=349bp
MKLNDDSLRSYECFKCFKDNSDKVNAINFTSNGEKLISSSQDDSINVYDV
INGKHLQTIYSKKYGVEMIKFTHCSTAVIHASNKVDDNLRYLSLHDNKYI
RLYPGHTKKVISLSMSPTNDTFLSGSLDKTIRLWDLRTANCQALMQLPGK
GLAAIDPEGLIFCVCISSDTCKLYDLRTFEQGPFLTFSLPPLHHEGNRVD
VSSLRFSPDGKMLLLSWAGTQIALLDSFTGRSLHQLQILGTNSTQIDINA
CFTPDSRYIMAGSPEGRLYIWRVSNAQRIALLQSSEGGTSAGGFNASGKA
GTISPLNIGALECNPQFSQIAVGQIQTSIWMPQINIDVPMEIPVDNAE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR020472G-protein_beta_WD-40_rep
IPR001680WD40_repeat
IPR024977Apc4_WD40_dom
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003682chromatin binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0048188Set1C/COMPASS complex
Vocabulary: biological process
TermDefinition
GO:0080182histone H3-K4 trimethylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020472G-protein beta WD-40 repeatPRINTSPR00320GPROTEINBRPTcoord: 122..136
score: 43.95
coord: 259..273
score: 21.23
coord: 36..50
score: 31.82
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 10..49
e-value: 1.3E-4
score: 31.3
coord: 140..175
e-value: 310.0
score: 1.2
coord: 182..226
e-value: 9.4
score: 10.9
coord: 229..272
e-value: 2.3
score: 14.7
coord: 96..135
e-value: 1.0E-8
score: 44.9
IPR001680WD40 repeatPFAMPF00400WD40coord: 12..49
e-value: 0.09
score: 13.7
coord: 99..135
e-value: 3.0E-6
score: 27.9
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 103..144
score: 16.156
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 17..58
score: 11.879
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 252..281
score: 9.038
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 5..303
e-value: 4.0E-48
score: 165.8
NoneNo IPR availablePANTHERPTHR19861WD40 REPEAT PROTEIN SWD2coord: 1..333
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 17..281
score: 23.519
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 9..291