REST corepressor 1

Overview
NameREST corepressor 1
Smed IDSMED30026147
Length (bp)1916
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of REST corepressor 1 (SMED30026147) t-SNE clustered cells

Violin plots show distribution of expression levels for REST corepressor 1 (SMED30026147) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of REST corepressor 1 (SMED30026147) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for REST corepressor 1 (SMED30026147) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026147

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026147h1SMcG0007000 SmedASXL_014708SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of REST corepressor 1 vs. Ensembl Fly
Match: CoRest (gene:FBgn0261573 transcript:FBtr0307903)

HSP 1 Score: 54.299 bits (129), Expect = 1.443e-7
Identity = 22/53 (41.51%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1186 QLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNL 1344
            ++S  W   +  + LLA+ E+G+NF  I+  V TK+E+ +R+FYLNN+   NL
Sbjct:   48 RISARWLPDEIQVALLAIREYGKNFPTIAKVVATKTEAHVRTFYLNNRRRYNL 100          
BLAST of REST corepressor 1 vs. Ensembl Fly
Match: CoRest (gene:FBgn0261573 transcript:FBtr0302864)

HSP 1 Score: 53.9138 bits (128), Expect = 3.757e-7
Identity = 22/53 (41.51%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1186 QLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNL 1344
            ++S  W   +  + LLA+ E+G+NF  I+  V TK+E+ +R+FYLNN+   NL
Sbjct:  302 RISARWLPDEIQVALLAIREYGKNFPTIAKVVATKTEAHVRTFYLNNRRRYNL 354          
BLAST of REST corepressor 1 vs. Ensembl Fly
Match: CoRest (gene:FBgn0261573 transcript:FBtr0302862)

HSP 1 Score: 53.9138 bits (128), Expect = 3.915e-7
Identity = 22/53 (41.51%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1186 QLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNL 1344
            ++S  W   +  + LLA+ E+G+NF  I+  V TK+E+ +R+FYLNN+   NL
Sbjct:  300 RISARWLPDEIQVALLAIREYGKNFPTIAKVVATKTEAHVRTFYLNNRRRYNL 352          
BLAST of REST corepressor 1 vs. Ensembl Fly
Match: CoRest (gene:FBgn0261573 transcript:FBtr0302863)

HSP 1 Score: 53.5286 bits (127), Expect = 4.962e-7
Identity = 22/53 (41.51%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1186 QLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNL 1344
            ++S  W   +  + LLA+ E+G+NF  I+  V TK+E+ +R+FYLNN+   NL
Sbjct:  536 RISARWLPDEIQVALLAIREYGKNFPTIAKVVATKTEAHVRTFYLNNRRRYNL 588          
BLAST of REST corepressor 1 vs. Ensembl Fly
Match: CoRest (gene:FBgn0261573 transcript:FBtr0307902)

HSP 1 Score: 53.5286 bits (127), Expect = 4.962e-7
Identity = 22/53 (41.51%), Postives = 35/53 (66.04%), Query Frame = 1
Query: 1186 QLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNL 1344
            ++S  W   +  + LLA+ E+G+NF  I+  V TK+E+ +R+FYLNN+   NL
Sbjct:  536 RISARWLPDEIQVALLAIREYGKNFPTIAKVVATKTEAHVRTFYLNNRRRYNL 588          
BLAST of REST corepressor 1 vs. TrEMBL
Match: A0A0X3P091 (SANT domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR147500 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.149e-6
Identity = 32/86 (37.21%), Postives = 53/86 (61.63%), Query Frame = 1
Query: 1087 DVQISDSLNALLEQHESVLNGFKTFLPSPNEFQQLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNL 1344
            D ++  +L A+  Q ++VL+G + +LP    F ++++ W  M+ A+ L ALS+ G +F+ IS  + TKSES IR FY   K ++ L
Sbjct:  202 DKELQFALQAVDLQGQTVLDGLENYLPK-GGFPKVAYRWTKMELALFLTALSKLGDDFAAISRTLGTKSESFIRDFYEEFKEKVGL 286          
BLAST of REST corepressor 1 vs. TrEMBL
Match: A0A0X3PF11 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR147500 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 1.777e-6
Identity = 32/86 (37.21%), Postives = 53/86 (61.63%), Query Frame = 1
Query: 1087 DVQISDSLNALLEQHESVLNGFKTFLPSPNEFQQLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNL 1344
            D ++  +L A+  Q ++VL+G + +LP    F ++++ W  M+ A+ L ALS+ G +F+ IS  + TKSES IR FY   K ++ L
Sbjct:  347 DKELQFALQAVDLQGQTVLDGLENYLPK-GGFPKVAYRWTKMELALFLTALSKLGDDFAAISRTLGTKSESFIRDFYEEFKEKVGL 431          
BLAST of REST corepressor 1 vs. Planmine SMEST
Match: SMESG000044341.1 (SMESG000044341.1)

HSP 1 Score: 1008.05 bits (2605), Expect = 0.000e+0
Identity = 576/578 (99.65%), Postives = 577/578 (99.83%), Query Frame = 1
Query:   58 MNPVIVNSLEQPFALLPTQINIDPNRYYKTTRDICYWNSEIGHDEYLINQFVEKAKEFNYTEEQALAVLTFNNYDYEKSQCDLHIYRPIKGLDKVDAKQVIKVISDGIAKTVKTREHRDFDDILLMFPGFTIGDVLGAYSKHRFLIKKQTYRVKKSIKKSICKPLVTNGNLKDNDSSWNESCLDTQFQLVYQKHFQLISNYSSIQEIISRDLSTMKQSNKNGIKLGELNSYVEADGXXXXXXXXXXXXXXXGSALDKTQLLAILNSFYSEKIPKPYDEQLIKEDMNYINPSPCLSTSSNSPNADVISISSKEQIDDNHFEEKFHDYIKGSIHRSMLTEDMDFDDVQISDSLNALLEQHESVLNGFKTFLPSPNEFQQLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNLTXXXXXXXXXXXXXXLQKDDSEEFLTTMHIKTEETLENDPTAPNSSSDNIKTKKSAKNISSNKTKATCXXXXXXXXXXXXXXXXXXCAREEIDDNIGVTRILRSRPETKEIMKTLIDEEXXXXXXXXXXXXXXXXXHLDEDDSHQLQCK 1791
            MNPVIVNSLEQPFALLPTQINIDPNRYYKTTRDICYWNSEIGHDEYLINQFVEKAKEFNYTEEQALAVLTFNNYDYEKSQCDLHIYRPIKGLDKVDAKQVIKVISDGIAKTVKTREHRDFDDILLMFPGFTIGDVLGAYSKHRFLIKKQTYRVKKSIKKSICKPLVTNGNLKDNDSSWNESCLDTQFQLVYQKHFQLISNYSSIQEIISRDLSTMKQSNKNGIKLGELNSYVEADGMLNLLRKMNRKKNKLGSALDKTQLLAILNSFYSEKIPKPYDEQLIKEDMNYINPSPCLSTSSNSPNADVISISSKEQIDDNHFEEKFHDYIKGSIHRSMLTEDMDFDDVQISDSLNALLEQHESVLNGFKTFLPSPNEFQQLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNLTEIFPQPFFEREPEPLQKDDSEEFLTTMHIKTEETLENDPTAPNSSSDNIKTKKSAKNISSNKTKATCKKQKNQSSSSSNNNNNN+CAREEID NIGVTRILRSRPETKEIMKTLIDEEKKSYKRKSKKTNKRKSKHLDEDDSHQLQCK
Sbjct:    1 MNPVIVNSLEQPFALLPTQINIDPNRYYKTTRDICYWNSEIGHDEYLINQFVEKAKEFNYTEEQALAVLTFNNYDYEKSQCDLHIYRPIKGLDKVDAKQVIKVISDGIAKTVKTREHRDFDDILLMFPGFTIGDVLGAYSKHRFLIKKQTYRVKKSIKKSICKPLVTNGNLKDNDSSWNESCLDTQFQLVYQKHFQLISNYSSIQEIISRDLSTMKQSNKNGIKLGELNSYVEADGMLNLLRKMNRKKNKLGSALDKTQLLAILNSFYSEKIPKPYDEQLIKEDMNYINPSPCLSTSSNSPNADVISISSKEQIDDNHFEEKFHDYIKGSIHRSMLTEDMDFDDVQISDSLNALLEQHESVLNGFKTFLPSPNEFQQLSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYLNNKTELNLTEIFPQPFFEREPEPLQKDDSEEFLTTMHIKTEETLENDPTAPNSSSDNIKTKKSAKNISSNKTKATCKKQKNQSSSSSNNNNNNECAREEIDGNIGVTRILRSRPETKEIMKTLIDEEKKSYKRKSKKTNKRKSKHLDEDDSHQLQCK 578          
BLAST of REST corepressor 1 vs. Planmine SMEST
Match: SMESG000015035.1 (SMESG000015035.1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.069e-20
Identity = 57/161 (35.40%), Postives = 87/161 (54.04%), Query Frame = 1
Query:  127 PNRYYKTTRDICYWNSEIGHDEYL---INQFVEKAKEFNYTEEQALAVLTFNNYDYEKSQCDLHIYRPIKGLDKVDAKQVIKVISDGIAKTVKTREHRDFDDILLMFPGFTIGDVLGAYSKHRFLIKKQTYRVK---KSIKK-------SICKPLVTNGNL 570
            P   Y+  R+   W      DEYL    ++F++ A E  +TEEQAL ++ FNN+D   S+CDL IY+P+ G+     + +IK+I + I      R +RD + IL  FP  T+G++L  Y+ +R  IK++T + K   K IK+       S   PL+   NL
Sbjct:   44 PLENYQNCRETLIWK----EDEYLSDKTSEFIKFAIEKGFTEEQALHIIKFNNFDLTLSECDLEIYKPLNGMRTNQNRDIIKMIIETIKARKSNRFNRDLNLILSEFPAHTMGELLDFYANNRMSIKRKTVKCKSESKGIKRKNVVDYLSQINPLLCGWNL 200          

HSP 2 Score: 58.5362 bits (140), Expect = 7.362e-9
Identity = 26/63 (41.27%), Postives = 41/63 (65.08%), Query Frame = 1
Query: 1135 SVLNGFKTFLPSPNEFQQ-LSHSWDNMDFAILLLALSEHGQNFSEISDAVFTKSESMIRSFYL 1320
            S L+  +T++    E +Q + H WDN D  +LLL L E G NF  ++DA+ TK+ +M++SF+L
Sbjct:  284 SELDKLETWMKPIGEIEQNIRHKWDNADIGLLLLGLQEFGPNFDLLADAIATKTSAMVKSFFL 346          
BLAST of REST corepressor 1 vs. Planmine SMEST
Match: SMESG000066939.1 (SMESG000066939.1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.446e-7
Identity = 52/194 (26.80%), Postives = 88/194 (45.36%), Query Frame = 1
Query:  151 RDICYWNSEIGHDEYLINQFVEKAKEFNYTEEQALAVLTFNNYDYEKSQCDLHIYRPIKGLDKVDAKQVIKVISDGIAKTVKTREHRD--FDDILLMFPGFTIGDVLGAYSKHRFLIKKQTYRVKKSIKK------------SICKPLVTNGNLKDNDSS--------WNESCLDTQFQLV--YQKHFQLISNY 660
            R+IC W          I  +V   K+  Y E+QAL  L  NNY+   +  D+  YRP  GL +++  +    IS  +    K  ++R   F  I   FP +T+G++L  Y  ++  +K++  + KK  +K             I K    + NL D+DSS        W+   + + FQ +  + ++F +IS +
Sbjct:   48 REICLWKMPNNLRNSEITNYVTNLKKKGYREDQALLALQCNNYNVTSAIGDICQYRPKIGLFELNVIETADKISKIMINNRKNNQNRKRCFRQIHNKFPNYTMGELLHFYMSNKLKVKRRLAKYKKQFEKLSKIPSEEEYERIINKLKCADENLLDSDSSMKSESDEIWSRQEVYSFFQALGMFGENFVMISQF 241          
BLAST of REST corepressor 1 vs. Planmine SMEST
Match: SMESG000066939.1 (SMESG000066939.1)

HSP 1 Score: 53.1434 bits (126), Expect = 1.453e-7
Identity = 38/130 (29.23%), Postives = 63/130 (48.46%), Query Frame = 1
Query:  151 RDICYWNSEIGHDEYLINQFVEKAKEFNYTEEQALAVLTFNNYDYEKSQCDLHIYRPIKGLDKVDAKQVIKVISDGIAKTVKTREHRD--FDDILLMFPGFTIGDVLGAYSKHRFLIKKQTYRVKKSIKK 534
            R+IC W          I  +V   K+  Y E+QAL  L  NNY+   +  D+  YRP  GL +++  +    IS  +    K  ++R   F  I   FP +T+G++L  Y  ++  +K++  + KK  +K
Sbjct:   48 REICLWKMPNNLRNSEITNYVTNLKKKGYREDQALLALQCNNYNVTSAIGDICQYRPKIGLFELNVIETADKISKIMINNRKNNQNRKRCFRQIHNKFPNYTMGELLHFYMSNKLKVKRRLAKYKKQFEK 177          
The following BLAST results are available for this feature:
BLAST of REST corepressor 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CoRest1.443e-741.51gene:FBgn0261573 transcript:FBtr0307903[more]
CoRest3.757e-741.51gene:FBgn0261573 transcript:FBtr0302864[more]
CoRest3.915e-741.51gene:FBgn0261573 transcript:FBtr0302862[more]
CoRest4.962e-741.51gene:FBgn0261573 transcript:FBtr0302863[more]
CoRest4.962e-741.51gene:FBgn0261573 transcript:FBtr0307902[more]
back to top
BLAST of REST corepressor 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A0X3P0911.149e-637.21SANT domain-containing protein OS=Schistocephalus ... [more]
A0A0X3PF111.777e-637.21Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of REST corepressor 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of REST corepressor 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000044341.10.000e+099.65SMESG000044341.1[more]
SMESG000015035.14.069e-2035.40SMESG000015035.1[more]
SMESG000066939.11.446e-726.80SMESG000066939.1[more]
SMESG000066939.11.453e-729.23SMESG000066939.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026147 ID=SMED30026147|Name=REST corepressor 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1916bp
TATATAAATCTTATATGATTTAGTTTTTATATTTATATTATAAATTATTT
TTTGAAAATGAACCCAGTCATTGTTAATTCACTCGAGCAACCGTTTGCTC
TTCTACCAACCCAAATAAACATTGATCCAAATCGTTATTATAAAACCACT
CGTGATATCTGCTATTGGAATAGTGAAATCGGCCATGATGAATATTTAAT
AAATCAGTTTGTGGAAAAAGCCAAAGAATTTAACTACACGGAAGAACAAG
CGCTAGCAGTTCTGACGTTTAACAACTATGATTATGAGAAATCTCAATGC
GACTTGCACATTTATCGGCCAATCAAAGGCCTGGATAAAGTCGACGCGAA
ACAAGTCATCAAAGTTATTAGCGATGGAATCGCCAAAACTGTCAAAACTC
GCGAACATCGAGATTTCGATGATATCCTTTTAATGTTTCCCGGTTTCACG
ATTGGCGATGTCCTTGGAGCTTATTCCAAGCATAGATTTTTAATTAAAAA
ACAAACTTATCGAGTGAAAAAATCCATTAAAAAATCGATTTGTAAGCCTC
TAGTGACGAATGGTAACCTGAAGGATAACGATTCCTCTTGGAATGAGTCT
TGCTTGGATACCCAGTTCCAACTGGTCTATCAGAAACATTTCCAACTCAT
CTCTAACTATAGCAGCATTCAAGAAATAATTTCTCGAGATTTATCCACAA
TGAAACAGTCAAACAAAAACGGAATAAAACTGGGAGAGCTCAATTCATAC
GTGGAAGCCGACGGAATGTTGAATTTGTTGAGAAAAATGAATAGGAAAAA
AAATAAACTCGGCTCAGCACTTGATAAAACACAACTGCTTGCTATTCTGA
ATTCGTTCTATTCAGAGAAAATCCCTAAACCATATGATGAACAATTAATA
AAGGAAGACATGAATTATATTAATCCCTCTCCCTGCCTGTCGACTTCATC
CAATTCCCCAAATGCTGACGTCATTTCAATAAGCAGCAAAGAACAAATAG
ATGATAATCATTTCGAGGAGAAATTCCATGATTATATTAAGGGAAGTATT
CATCGCTCTATGTTAACAGAGGACATGGACTTTGATGATGTCCAAATTTC
CGATTCTCTCAATGCTCTACTAGAACAGCACGAATCCGTTCTGAATGGGT
TTAAAACTTTTCTACCCAGTCCAAATGAATTTCAACAACTGAGTCACAGT
TGGGATAATATGGATTTTGCAATACTACTTCTTGCTCTATCTGAACACGG
ACAGAATTTCAGTGAAATATCTGATGCAGTCTTCACAAAGTCTGAATCGA
TGATACGGTCGTTCTATCTCAACAATAAAACTGAATTGAATCTCACTGAA
ATTTTTCCTCAACCTTTCTTTGAACGAGAGCCTGAACCTTTACAGAAAGA
TGATAGCGAAGAATTCCTCACAACAATGCATATTAAAACCGAAGAAACAT
TAGAAAACGACCCAACTGCACCCAACTCTAGTTCTGACAACATCAAGACG
AAAAAAAGTGCAAAGAATATTTCTTCCAATAAAACAAAAGCTACTTGTAA
AAAACAGAAAAATCAATCCTCTTCATCATCAAATAATAATAACAATAACA
AATGTGCACGAGAAGAAATTGATGACAACATCGGTGTTACTCGAATCCTT
CGAAGTCGACCAGAAACCAAAGAGATAATGAAAACACTGATTGATGAGGA
AAAAAAATCCTACAAAAGAAAATCAAAGAAAACAAACAAGAGAAAATCGA
AACATCTTGATGAGGATGATTCACATCAACTACAATGTAAAAGAAATCGA
AATATATAAATATATATTTAAAGAAACCAATTGTGTGCGGTTACGCGTGT
GTGTGTACGATTGTGTGTGTTTTCAACCGATTGTCCAATGAAATTCGGAT
TTGTGCCCGACCAGTA
back to top

protein sequence of SMED30026147-orf-1

>SMED30026147-orf-1 ID=SMED30026147-orf-1|Name=SMED30026147-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=584bp
MNPVIVNSLEQPFALLPTQINIDPNRYYKTTRDICYWNSEIGHDEYLINQ
FVEKAKEFNYTEEQALAVLTFNNYDYEKSQCDLHIYRPIKGLDKVDAKQV
IKVISDGIAKTVKTREHRDFDDILLMFPGFTIGDVLGAYSKHRFLIKKQT
YRVKKSIKKSICKPLVTNGNLKDNDSSWNESCLDTQFQLVYQKHFQLISN
YSSIQEIISRDLSTMKQSNKNGIKLGELNSYVEADGMLNLLRKMNRKKNK
LGSALDKTQLLAILNSFYSEKIPKPYDEQLIKEDMNYINPSPCLSTSSNS
PNADVISISSKEQIDDNHFEEKFHDYIKGSIHRSMLTEDMDFDDVQISDS
LNALLEQHESVLNGFKTFLPSPNEFQQLSHSWDNMDFAILLLALSEHGQN
FSEISDAVFTKSESMIRSFYLNNKTELNLTEIFPQPFFEREPEPLQKDDS
EEFLTTMHIKTEETLENDPTAPNSSSDNIKTKKSAKNISSNKTKATCKKQ
KNQSSSSSNNNNNNKCAREEIDDNIGVTRILRSRPETKEIMKTLIDEEKK
SYKRKSKKTNKRKSKHLDEDDSHQLQCKRNRNI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR001005SANT/Myb
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001005SANT/Myb domainSMARTSM00717santcoord: 391..439
e-value: 3.1E-4
score: 30.1
IPR001005SANT/Myb domainCDDcd00167SANTcoord: 394..437
e-value: 6.48379E-5
score: 38.7106
NoneNo IPR availableGENE3DG3DSA:1.20.58.1880coord: 343..449
e-value: 4.0E-14
score: 54.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 576..596
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 479..530
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 559..596
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 473..530
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 393..444