BTB domain-containing protein

Overview
NameBTB domain-containing protein
Smed IDSMED30026133
Length (bp)4123
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of BTB domain-containing protein (SMED30026133) t-SNE clustered cells

Violin plots show distribution of expression levels for BTB domain-containing protein (SMED30026133) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of BTB domain-containing protein (SMED30026133) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for BTB domain-containing protein (SMED30026133) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026133

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30026133SMESG000001053.1 Contig525uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30026133SMESG000001053.1 Contig525uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30026133SMESG000001053.1 Contig525uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30026133SMESG000001053.1 Contig525newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30026133SMESG000001053.1 Contig525newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30026133SMESG000001053.1 Contig525newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026133SMESG000001053.1 Contig529uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026133SMESG000001053.1 Contig529newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026133SMESG000016734.1 Contig529uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30026133SMESG000016734.1 Contig529newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30026133SMESG000033211.1 Contig525uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30026133SMESG000033211.1 Contig525uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30026133SMESG000033211.1 Contig525uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30026133SMESG000033211.1 Contig525newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30026133SMESG000033211.1 Contig525newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30026133SMESG000033211.1 Contig525newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X2 cellSMED30026133SMESG000001053.1 SmedASXL_017285SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30026133SMESG000001053.1 dd_Smed_v4_3856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026133SMESG000001053.1 dd_Smed_v4_3856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30026133SMESG000001053.1 dd_Smed_v4_3856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30026133SMESG000001053.1 dd_Smed_v4_3856_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026133SMESG000073620.1 dd_Smed_v4_6327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026133SMESG000073620.1 dd_Smed_v4_6327_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026133SMESG000001053.1 dd_Smed_v4_3856_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: KCTD3 (potassium channel tetramerization domain containing 3 [Source:HGNC Symbol;Acc:HGNC:21305])

HSP 1 Score: 287.73 bits (735), Expect = 2.187e-81
Identity = 198/655 (30.23%), Postives = 310/655 (47.33%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVD-LSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            +++RD+    FIDRDP  F+ ILN+LRT +L      +    L++EA FY I PLV ++ L      + CG++LF G   +        + ++N++         R++ + NG    NS +  +R        + T   + RL  P+  R                                        +V I+  H  W+   Y      Y   + +GW+ V+ S        I + AL +K              D            + +VA+AS   + L+SV                 Q      ++  FS    +D L F+G  L+A S +    G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TGKR+C I +     I++F V + +    +       L TGH +GS++MW+LTT++D +   E
Sbjct:   53 STLRDETGAIFIDRDPAAFAPILNFLRTKEL--DLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSCGSVLFHG---YLPPPGIPSRKINNTV---------RSADSRNG---LNSTEGEARGNGTQPVLSGTGEETVRLGFPVDPR----------------------------------------KVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQVFTSP--YLDWTIERVALNAK-------VVGGPHGDK-----------DKMVAVASESSIILWSV-----------------QDGGSGSEIGVFSLGVPVDALFFIGNQLVATSHTG-KVGVWNAVTQHWQVQDV-VPITSYDTAG-SFLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPK--TSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------ETESHGSYSS-------GNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGKRICEIQAVDCTTISSFTVRECEGSSRMGSRPRRYLFTGHTNGSIQMWDLTTAMDMVNKSE 580          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: SHKBP1 (SH3KBP1 binding protein 1 [Source:HGNC Symbol;Acc:HGNC:19214])

HSP 1 Score: 249.21 bits (635), Expect = 3.754e-69
Identity = 156/470 (33.19%), Postives = 242/470 (51.49%), Query Frame = 3
Query: 2367 GHPVNSQVTIIKC-HQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGN 3740
            G P    +  + C H  W+AV Y   +  Y   + +GW+ V+ S   +    I + AL +     R +  +L               H+ +VA A+G  + L++                 LQ+     ++  F     ++ L F+G  L+A S +    G W   ++ W    V   I  Y   +  F++LGC NG IY ++ QKFPLRM DN +L +E++RDP+ D VTAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  LASF +++L+               D     +                  D+GPY    D  +FIQK++P   +LFVRL+ TG+RVC + S   +  TAF V + +    +       L+TG  +GSL MW+LTT++D +G 
Sbjct:  188 GQPEEPGMVRLVCGHHNWIAVAYTQFLVCYRLKEASGWQLVFSSP--RLDWPIERLALTA-----RVHGGALGE-------------HDKMVAAATGSEILLWA-----------------LQAEGGGSEIGVFHLGVPVEALFFVGNQLIATSHTG-RIGVWNAVTKHWQVQEVQP-ITSYDA-AGSFLLLGCNNGSIYYVDVQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDS--GNWIEIAYGTSSGGVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALE-------------SADGHGGCS---------------AGNDIGPYGERDDQQVFIQKVVPSASQLFVRLSSTGQRVCSVRSVDGSPTTAFTVLECEGSRRLGSRPRRYLLTGQANGSLAMWDLTTAMDGLGQ 587          

HSP 2 Score: 66.2402 bits (160), Expect = 3.412e-10
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            ++++D+    FIDRDP +F+ ILN+LRT +L      +  ++L +EA FY + PLV ++ L      + CGN+LF G
Sbjct:   54 STLKDETGAIFIDRDPTVFAPILNFLRTKEL--DPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRSSCGNVLFNG 128          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: SHKBP1 (SH3KBP1 binding protein 1 [Source:HGNC Symbol;Acc:HGNC:19214])

HSP 1 Score: 231.491 bits (589), Expect = 2.167e-63
Identity = 123/311 (39.55%), Postives = 181/311 (58.20%), Query Frame = 3
Query: 2841 FGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGN 3740
             G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L +E++RDP+ D VTAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  LASF +++L+               D     +                  D+GPY    D  +FIQK++P   +LFVRL+ TG+RVC + S   +  TAF V + +    +       L+TG  +GSL MW+LTT++D +G 
Sbjct:  284 IGVWNAVTKHWQVQEVQP-ITSYDAAGS-FLLLGCNNGSIYYVDVQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDS--GNWIEIAYGTSSGGVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALE-------------SADGHGGCS---------------AGNDIGPYGERDDQQVFIQKVVPSASQLFVRLSSTGQRVCSVRSVDGSPTTAFTVLECEGSRRLGSRPRRYLLTGQANGSLAMWDLTTAMDGLGQ 562          

HSP 2 Score: 66.6254 bits (161), Expect = 2.739e-10
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            ++++D+    FIDRDP +F+ ILN+LRT +L      +  ++L +EA FY + PLV ++ L      + CGN+LF G
Sbjct:   54 STLKDETGAIFIDRDPTVFAPILNFLRTKEL--DPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRSSCGNVLFNG 128          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: SHKBP1 (SH3KBP1 binding protein 1 [Source:HGNC Symbol;Acc:HGNC:19214])

HSP 1 Score: 202.986 bits (515), Expect = 2.376e-54
Identity = 117/338 (34.62%), Postives = 183/338 (54.14%), Query Frame = 3
Query: 2367 GHPVNSQVTIIKC-HQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLD 3374
            G P    +  + C H  W+AV Y   +  Y   + +GW+ V+ S   +    I + AL +     R +  +L               H+ +VA A+G  + L++                 LQ+     ++  F     ++ L F+G  L+A S +    G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L +E++RDP+ D VTAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  LASF +++L+
Sbjct:  183 GQPEEPGMVRLVCGHHNWIAVAYTQFLVCYRLKEASGWQLVFSSP--RLDWPIERLALTA-----RVHGGALGE-------------HDKMVAAATGSEILLWA-----------------LQAEGGGSEIGVFHLGVPVEALFFVGNQLIATSHTG-RIGVWNAVTKHWQVQEVQP-ITSYDAAGS-FLLLGCNNGSIYYVDVQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDS--GNWIEIAYGTSSGGVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALE 478          

HSP 2 Score: 66.2402 bits (160), Expect = 3.405e-10
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            ++++D+    FIDRDP +F+ ILN+LRT +L      +  ++L +EA FY + PLV ++ L      + CGN+LF G
Sbjct:   49 STLKDETGAIFIDRDPTVFAPILNFLRTKEL--DPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRSSCGNVLFNG 123          
BLAST of BTB domain-containing protein vs. Ensembl Human
Match: SHKBP1 (SH3KBP1 binding protein 1 [Source:HGNC Symbol;Acc:HGNC:19214])

HSP 1 Score: 158.688 bits (400), Expect = 1.066e-42
Identity = 69/133 (51.88%), Postives = 102/133 (76.69%), Query Frame = 3
Query: 2979 KFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLD 3374
            KFPLRM DN +L +E++RDP+ D VTAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  LASF +++L+
Sbjct:    1 KFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDS--GNWIEIAYGTSSGGVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALE 131          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: T23B12.6 (pep chromosome:WBcel235:V:8457616:8460419:-1 gene:WBGene00020721.1 transcript:T23B12.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T23B12.6)

HSP 1 Score: 285.419 bits (729), Expect = 2.479e-82
Identity = 233/751 (31.03%), Postives = 351/751 (46.74%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTN--DLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGI--------NF-SESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYTDH---MLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQSD---IGGTVN--LITGHEDGSLEMWNLTTSIDQIGNFETHHP------PTAAASVLSGHGTHCSREDGDNNEQTRVLMGFRFYPSLDEPSENGPTPRELFCMLRDYDIALDDTSERSIKLTQCIS 3989
            NS++D     FIDRDP +F VILNYLRT   DL      I    LK+EA+F+ + PL+ ++ L        CG++ F G I        N  +E     M + S+   + + +  S  S    GH    S D+SR                                   +KNE ++    L KSKS     TD  P+  +V +I+ H   + V Y + V +Y   + N +  +W+S                  P+ R   + +A     V     + + E LVA+         S Q + +    ID          K EK   FS + SID L F+G  ++A+S+S    G W   ++ W    V   I+CY       +ILGC NG +  ++ QKFPLRM DN +L TE+FRDP+ +++T+L VF   +   S   N +EIAYGT++G + +++QH    G  P +FQ+  +H + + RV ++  +LIS+C   NH+RSW ++RFRG INTQPGT  LASF +++                LDS++E T+     YN            GPY D     + IQ+L+P   +LFVRLA TG+R+C + S +++ ITAF VH+ D   +G  +   L  G+ +GS+++W+LT+++DQ       HP      P AAA+         +       +  R L+    Y         GPTP+EL  ++ D DI     S     L++C S
Sbjct:   54 NSVKDPSGAIFIDRDPDLFRVILNYLRTKQVDLCG----IKVDTLKHEALFFGLTPLIRRLTLCEELSSTSCGSVYFCGMIPPPDMPLENLPNEKSRSPMYSNSSETSTNNSKNKSNGSPRHRGHSKKQSTDMSRY----------------------------------IKNELSE----LAKSKSQPDRDTD--PM--KVRMIRAHICSIVVAYSYFVCVYRVTEWNTYVLLWKS------------------PRARTYVSHIA-----VNTKIAATVAERLVAV---------SFQDDTIGLWHID-------DEGKTEKKGLFSMNVSIDNLFFVGTQMVALSKSG-KVGIWHSATQNWQAQDVQP-ISCYDTAGSS-LILGCANGSMNHIDMQKFPLRMKDNDLLVTELFRDPNGETITSLSVFLTPKT--SACGNWIEIAYGTSNGVVNLILQHPETAGHQPVLFQSYNIHNSPVQRVSLNTSHLISVCSEYNHVRSWNVTRFRGMINTQPGTVPLASFKVLT----------------LDSIDETTDRQ---YNHP----------GPYGDQDSEQVLIQRLIPNAQKLFVRLASTGERICTVDSVEDSPITAFCVHELDGQKLGSRLRKYLFCGNGNGSVQVWDLTSALDQFHLKNGSHPQQQQVNPPAAANQSELIKPQLA-------QSPRSLINLSNY-------SGGPTPQELLDVIDDNDICCSTPS-----LSRCPS 666          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: adpr-1 (ADiPose (Drosophila obesity gene) Related [Source:UniProtKB/TrEMBL;Acc:Q4W5Q8])

HSP 1 Score: 57.7658 bits (138), Expect = 4.816e-9
Identity = 38/117 (32.48%), Postives = 63/117 (53.85%), Query Frame = 3
Query: 1239 IKDSKFWGTK--YILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQN----ERRTENAKGCQSMSML-DLLR 1568
            IK++ F+G++  YI++GS+CGH+ +W +D+         D+ + N  +PHP   +IAT GID ++ +     QPI   E   A++ + V       E+R +   G   + ML DL R
Sbjct:   65 IKEANFFGSRDQYIIAGSDCGHMYIWNRDTSKIQGIFEADDHILNICQPHPDQFMIATAGIDDDILL----WQPIL--ERPDAFLSRRVEDPYEFMEKRADGMGGRIHLHMLRDLAR 175          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: adpr-1 (ADiPose (Drosophila obesity gene) Related [Source:UniProtKB/TrEMBL;Acc:Q4W5Q8])

HSP 1 Score: 58.5362 bits (140), Expect = 1.239e-8
Identity = 38/117 (32.48%), Postives = 63/117 (53.85%), Query Frame = 3
Query: 1239 IKDSKFWGTK--YILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQN----ERRTENAKGCQSMSML-DLLR 1568
            IK++ F+G++  YI++GS+CGH+ +W +D+         D+ + N  +PHP   +IAT GID ++ +     QPI   E   A++ + V       E+R +   G   + ML DL R
Sbjct:  181 IKEANFFGSRDQYIIAGSDCGHMYIWNRDTSKIQGIFEADDHILNICQPHPDQFMIATAGIDDDILL----WQPIL--ERPDAFLSRRVEDPYEFMEKRADGMGGRIHLHMLRDLAR 291          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: adpr-1 (ADiPose (Drosophila obesity gene) Related [Source:UniProtKB/TrEMBL;Acc:Q4W5Q8])

HSP 1 Score: 58.5362 bits (140), Expect = 1.412e-8
Identity = 38/117 (32.48%), Postives = 63/117 (53.85%), Query Frame = 3
Query: 1239 IKDSKFWGTK--YILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQN----ERRTENAKGCQSMSML-DLLR 1568
            IK++ F+G++  YI++GS+CGH+ +W +D+         D+ + N  +PHP   +IAT GID ++ +     QPI   E   A++ + V       E+R +   G   + ML DL R
Sbjct:  232 IKEANFFGSRDQYIIAGSDCGHMYIWNRDTSKIQGIFEADDHILNICQPHPDQFMIATAGIDDDILL----WQPIL--ERPDAFLSRRVEDPYEFMEKRADGMGGRIHLHMLRDLAR 342          
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Match: adpr-1 (ADiPose (Drosophila obesity gene) Related [Source:UniProtKB/TrEMBL;Acc:Q4W5Q8])

HSP 1 Score: 59.3066 bits (142), Expect = 1.617e-8
Identity = 38/117 (32.48%), Postives = 63/117 (53.85%), Query Frame = 3
Query: 1239 IKDSKFWGTK--YILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQ----NERRTENAKGCQSMSML-DLLR 1568
            IK++ F+G++  YI++GS+CGH+ +W +D+         D+ + N  +PHP   +IAT GID ++ +     QPI   E   A++ + V       E+R +   G   + ML DL R
Sbjct:  440 IKEANFFGSRDQYIIAGSDCGHMYIWNRDTSKIQGIFEADDHILNICQPHPDQFMIATAGIDDDILL----WQPIL--ERPDAFLSRRVEDPYEFMEKRADGMGGRIHLHMLRDLAR 550          

HSP 2 Score: 58.151 bits (139), Expect = 3.212e-8
Identity = 49/192 (25.52%), Postives = 87/192 (45.31%), Query Frame = 3
Query:  105 TENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVN-STNKELNVFYKHSGPTLNIATFE-DEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSL---SAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN 662
             ++L+ F  LEGH GCVNT+ W+K+G  + SG DD  ++I      W        ++ +   +  N+ + +F+    +Q +V+ +    + L D+  ST K+    ++  G    I T E D    +A    D     FD R  N    ++           ++A+       I +G  ++ VR++D+R LN
Sbjct:   28 VDSLESFHMLEGHSGCVNTLRWNKTGALLASGSDDRNVKI------WKS---GREIHNLVTGHEGNVFAVEFLQNSGDQKLVTGAADRVVALHDIEASTCKK----WELDGRVKRICTVEHDPTLFWAAVECDNGVQQFDTRTENPEVIIRHTADREFHDAKSVAVSEARPNLIVVGFDETAVRLYDRRNLN 206          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: CG9467 (gene:FBgn0037758 transcript:FBtr0082156)

HSP 1 Score: 310.071 bits (793), Expect = 2.743e-90
Identity = 212/658 (32.22%), Postives = 336/658 (51.06%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVD------------------LSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYTDH--MLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQSDIGGTVNLITGHEDGSLEMWNLTTSI 3725
            +S+RD+ N  FIDRDP +FS+ILNYLRT D+  ++ +I   AL++EA +Y I PL  ++ L    + + CG++LF G +      +    N + +  S  E LPS TS +  G R  + V                   L R  S  +  N  + +    +  I     +    S +  N+  + E  L+ S + +  + D  P+  +V IIK HQ W+AV Y   VT Y   D NGW+ V+ S                  P I      +A  +S V       +   +VAI+ G  + L+S+Q                    +   +  F+ +  ++YL F+G  L+A+S S    G W   ++ W    +   ++  S  S  F++LGC NG IY ++ QKFPLR+ DN +L TE+++D + D +TA+ V Y + K  S+  N +EIAYGT SG +RI+VQH    G GP +F+T  VH++ + +V++SEKYL+S+C   +H+R+W ++RFRG ++TQPG+   ASF ++SL                    E T+    +            D GPY D+  M+F+QK++P+ D+L+VRLA  G RVC I S   + I+AF V + ++     ++TGH +G+++MW+LTT++
Sbjct:   46 SSLRDEHNAIFIDRDPTLFSIILNYLRTKDIDIKNCEI--RALRHEAEYYGITPLTKRLALCEDLNHSSCGDLLFYGFLAAPPMPS----NEAVAATSVDESLPS-TSASAIGSRPGSMVRVPEPSRSSHSRNSSWDLRLGRTGSTGNGANPPAPMLHSRNPSIDFMRHSR--NSSADLNKVFRNEVGLVFSPTQNSNWVD--PL--RVQIIKAHQNWIAVAYAHFVTCYRVKDSNGWQQVFTS------------------PHIDATIERIAI-NSKVNTSAAEPLPSKMVAISYGSQIRLWSIQ-----------------EGGQKTDVGTFNLNVRVEYLFFIGSQLVALSSSG-KIGVWHAMTQHWQIQDLVPVLSFDSAGS--FLLLGCNNGSIYYIDMQKFPLRIKDNDLLVTELYKDVTLDPITAISV-YLTPKTSSISGNWIEIAYGTKSGAVRIIVQHPETAGHGPHLFETFFVHQSPVTKVMLSEKYLVSVCSEYHHVRTWRLTRFRGMLSTQPGSTPEASFKIVSL--------------------EATDTSYSY--------AAGNDFGPYGDYDDMIFVQKVVPETDQLYVRLASNGDRVCVIRSVDSSTISAFCVLECEVSSRF-ILTGHCNGAIQMWDLTTAL 621          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: adp (gene:FBgn0000057 transcript:FBtr0340288)

HSP 1 Score: 84.7297 bits (208), Expect = 3.044e-16
Identity = 78/276 (28.26%), Postives = 120/276 (43.48%), Query Frame = 3
Query:   93 SASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGS-IFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESN------NIPFLKMNLPCSL-----SAIAIHPLCSYKIAIGGSDSCVRVFDKRYL-NKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQE 881
            S +Y + L+    L GH GCVN + W   G  + SG DD  + I      WD P+ K  V+ I   +  N+ S KF+P  NN IV+       I++ D+N  N+ L     H      +AT +D    F +A  D      DIRE +       I    +NL   L       +AI+P  +  +A+G +D   RV+D+R L + + N +   + Y      P Q      + N S    +  R +  ++F    G  +LV+   + +Y FD    E
Sbjct:   50 SPAYVDRLEQEAVLVGHEGCVNCLEWTTDGMWLASGSDDYRVMI------WD-PFRKKLVHVIRTKHLGNVFSVKFLPKTNNSIVATCAADKFIYVYDINDPNETLFSCICHFSRAKRLATAQDSPHVFWSAGEDGCILQLDIREPHRCRPEEGIGVRLLNLHDQLENTEAKCLAINPRRTEYLAVGTNDPFARVYDRRKLPSTNGNGLSACVAYYA----PGQI-----VKNISRNIVHEPRGITYLTFNGN-GTELLVNIGCEHVYRFDLNHAE 308          

HSP 2 Score: 52.7582 bits (125), Expect = 2.036e-6
Identity = 27/95 (28.42%), Postives = 51/95 (53.68%), Query Frame = 3
Query: 1239 IKDSKFWGTK--YILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERR 1517
            IK++ + G++  +I +GS+ G++ +WE D+         D  + N ++PHP + ++AT GID+N+KI        +      A V + V  N+ +
Sbjct:  516 IKEANYLGSQGEFIAAGSDDGNMYIWEGDTGKIRAVYRADSAIVNCVQPHPSICMLATSGIDHNIKIWSPCAASAEERPNLVADVTRFVEDNQEK 610          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: adp (gene:FBgn0000057 transcript:FBtr0086744)

HSP 1 Score: 84.7297 bits (208), Expect = 3.044e-16
Identity = 78/276 (28.26%), Postives = 120/276 (43.48%), Query Frame = 3
Query:   93 SASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGS-IFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESN------NIPFLKMNLPCSL-----SAIAIHPLCSYKIAIGGSDSCVRVFDKRYL-NKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQE 881
            S +Y + L+    L GH GCVN + W   G  + SG DD  + I      WD P+ K  V+ I   +  N+ S KF+P  NN IV+       I++ D+N  N+ L     H      +AT +D    F +A  D      DIRE +       I    +NL   L       +AI+P  +  +A+G +D   RV+D+R L + + N +   + Y      P Q      + N S    +  R +  ++F    G  +LV+   + +Y FD    E
Sbjct:   50 SPAYVDRLEQEAVLVGHEGCVNCLEWTTDGMWLASGSDDYRVMI------WD-PFRKKLVHVIRTKHLGNVFSVKFLPKTNNSIVATCAADKFIYVYDINDPNETLFSCICHFSRAKRLATAQDSPHVFWSAGEDGCILQLDIREPHRCRPEEGIGVRLLNLHDQLENTEAKCLAINPRRTEYLAVGTNDPFARVYDRRKLPSTNGNGLSACVAYYA----PGQI-----VKNISRNIVHEPRGITYLTFNGN-GTELLVNIGCEHVYRFDLNHAE 308          

HSP 2 Score: 52.7582 bits (125), Expect = 2.036e-6
Identity = 27/95 (28.42%), Postives = 51/95 (53.68%), Query Frame = 3
Query: 1239 IKDSKFWGTK--YILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERR 1517
            IK++ + G++  +I +GS+ G++ +WE D+         D  + N ++PHP + ++AT GID+N+KI        +      A V + V  N+ +
Sbjct:  516 IKEANYLGSQGEFIAAGSDDGNMYIWEGDTGKIRAVYRADSAIVNCVQPHPSICMLATSGIDHNIKIWSPCAASAEERPNLVADVTRFVEDNQEK 610          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: CG8001 (gene:FBgn0035268 transcript:FBtr0072774)

HSP 1 Score: 70.4774 bits (171), Expect = 1.007e-11
Identity = 74/290 (25.52%), Postives = 117/290 (40.34%), Query Frame = 3
Query:   48 WRFMNSRSKSSF---YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKD-HVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNSTNKELN--VFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNL--------PCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTR 872
            WR  ++ S SSF   Y+ S    E + +   L  H GCVN++ ++++G  I SG DD  + +      WD  W K+  ++     ++ NI   KF+       IVS+S+ G +    +  +   +     Y HS     I           +A  D     FD+R SN    +   +           L +IA HP    +  + GSD  +RV+DKR L K+ + +        +I +               +YN+              G+ IL SY    IYLFD+R
Sbjct:  292 WRGGHT-SASSFGQGYYGSRQVVEQMTLLSSLNVHHGCVNSLNFNRAGDLICSGSDDLTIVV------WD--WAKEKQLHRFRSGHNMNIFQTKFIDSAGCLDIVSSSRDGQVRRSVIPPSGGVIKPIRLYTHSESVHKIIVVPHSRHELMSAGEDAAVKHFDLRASNAATTMMRCVYNDENERGRVRLFSIAHHPYAP-EFCVSGSDDILRVYDKRNLAKAIHQMAPRNLLEAQITQIT-----------CAVYNHS-------------GSEILASYSDAGIYLFDSR 547          

HSP 2 Score: 62.003 bits (149), Expect = 3.477e-9
Identity = 31/81 (38.27%), Postives = 53/81 (65.43%), Query Frame = 3
Query: 1239 IKDSKFWG--TKYILSGSECGHVLVWEKDSKYPIMAIPTDE-RVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEE 1472
            IK   F+G  ++YI+SGS+CG++  W+K+++  I  +  D   V N +EPHP++P++AT G++++VKI        K PE+
Sbjct:  567 IKGVNFFGPRSEYIVSGSDCGNIFFWDKNTEAIINYMKGDHVGVVNCLEPHPWMPVLATSGLEHDVKIWTPQGPERKLPED 647          
BLAST of BTB domain-containing protein vs. Ensembl Fly
Match: CG8001 (gene:FBgn0035268 transcript:FBtr0334073)

HSP 1 Score: 70.4774 bits (171), Expect = 1.007e-11
Identity = 74/290 (25.52%), Postives = 117/290 (40.34%), Query Frame = 3
Query:   48 WRFMNSRSKSSF---YHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKD-HVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNSTNKELN--VFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNL--------PCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTR 872
            WR  ++ S SSF   Y+ S    E + +   L  H GCVN++ ++++G  I SG DD  + +      WD  W K+  ++     ++ NI   KF+       IVS+S+ G +    +  +   +     Y HS     I           +A  D     FD+R SN    +   +           L +IA HP    +  + GSD  +RV+DKR L K+ + +        +I +               +YN+              G+ IL SY    IYLFD+R
Sbjct:  292 WRGGHT-SASSFGQGYYGSRQVVEQMTLLSSLNVHHGCVNSLNFNRAGDLICSGSDDLTIVV------WD--WAKEKQLHRFRSGHNMNIFQTKFIDSAGCLDIVSSSRDGQVRRSVIPPSGGVIKPIRLYTHSESVHKIIVVPHSRHELMSAGEDAAVKHFDLRASNAATTMMRCVYNDENERGRVRLFSIAHHPYAP-EFCVSGSDDILRVYDKRNLAKAIHQMAPRNLLEAQITQIT-----------CAVYNHS-------------GSEILASYSDAGIYLFDSR 547          

HSP 2 Score: 62.003 bits (149), Expect = 3.477e-9
Identity = 31/81 (38.27%), Postives = 53/81 (65.43%), Query Frame = 3
Query: 1239 IKDSKFWG--TKYILSGSECGHVLVWEKDSKYPIMAIPTDE-RVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEE 1472
            IK   F+G  ++YI+SGS+CG++  W+K+++  I  +  D   V N +EPHP++P++AT G++++VKI        K PE+
Sbjct:  567 IKGVNFFGPRSEYIVSGSDCGNIFFWDKNTEAIINYMKGDHVGVVNCLEPHPWMPVLATSGLEHDVKIWTPQGPERKLPED 647          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd3 (potassium channel tetramerization domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060503-169])

HSP 1 Score: 290.812 bits (743), Expect = 1.182e-82
Identity = 195/649 (30.05%), Postives = 312/649 (48.07%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSY-KENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSID 3728
            +++RD+    FIDRDP  F+ ILN+LRT +L      ++ + L++EA FY I PLV ++ L      + CG++LF G +                       LP+R+S            + S  A  +  +  +                                + +L      D  +  G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S   + +  I + AL +K              D            + +VA +S   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V    +C +  S  F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+             + +S N  ++                 D+GP+    D  +FIQK++P  ++LFVRL+ TG+R+C + S     IT F V + +    +       L TGH +GS++MW+LTT++D
Sbjct:   49 STLRDETGAIFIDRDPTAFAPILNFLRTKEL--DLRGVNISILRHEAEFYGITPLVRRLLLCEELERSSCGSVLFHGYL-------------------PPPALPARSSAVGQASAVIGPEERSGPAGAEGGYPRSC------------------------------PQSSLPGPSGADGPHRLGSPVDPRKVLIVAGHHNWIVAAYAHFVICYRIKESSGWQQVFSSPYLEWA--IERVALNAK-------VVGGPHGD-----------KDKMVAASSENRIILWSIQ-----------------DGGNGSEIGVFSLGVPVDSLFFIGSQLVATSHTG-KVGVWNAVTQHWQVQDVVPITSCDTAGS--FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPK--TSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKIISLE-------------ETESHNSYSS---------------GNDIGPFGERDDQQVFIQKVIPITNKLFVRLSSTGRRICEVQSVDGTTITCFTVRECEGSSRMGSRPRRYLFTGHANGSIQMWDLTTAMD 576          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: SHKBP1 (SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:562395])

HSP 1 Score: 262.692 bits (670), Expect = 6.874e-73
Identity = 166/464 (35.78%), Postives = 249/464 (53.66%), Query Frame = 3
Query: 2388 VTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSY-KENITAFAVHQ----SDIGGTVN--LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            V II  H  W+AV Y   V  Y   +  GW+ V+ S   +   +I + AL +K         SL   D              +VA+ASG  + L+++        P D N           ++  FS +  ++ L F+G  L+A S +    G W   ++ W N  V   IN Y   +  F+ILGC NG IY ++ QKFPLRM DN +L TE++RDPS D++TAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT +VHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  L SF ++SLD              +D                       T++GPY    +  +FIQ+++P  D+L+VRL+  GKRVC + S    +ITAF VH+    S IG      L +GH +GS++MW+LTT+++  G  +
Sbjct:  185 VRIICGHHNWIAVAYAQFVVCYRVKESTGWQQVFTSP--RLDWVIDRVALNAK-----VMGGSLGDNDK-------------MVAVASGTEIILWAI-------CP-DGN---------GNEIGVFSLNVPVEALFFVGNQLIATSHTG-KVGVWNAVTKHWQNQDV-VPINSYDT-AGSFLILGCNNGSIYYIDVQKFPLRMKDNDLLVTELYRDPSEDAITALSVYLTPKTSDS--GNWIEIAYGTSSGTVRVIVQHPETVGSGPQLFQTFSVHRSPVTKIMLSEKHLISVCADNNHVRTWTVTRFRGMISTQPGSTPLTSFKILSLD-------------DIDG---------------HAGCAAGTEIGPYGERDEQQVFIQRVVPDTDKLYVRLSSNGKRVCEVRSVDGTSITAFVVHECEGSSRIGSRPRRYLFSGHSNGSIQMWDLTTAMEIAGKVD 578          

HSP 2 Score: 70.4774 bits (171), Expect = 1.271e-11
Identity = 35/77 (45.45%), Postives = 49/77 (63.64%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            ++++D+    FIDRDP +F+ ILN+LRT +L  +S  ID   L +EA FY I PLV K+ L      + CGN+LF G
Sbjct:   41 STLKDETGAIFIDRDPSLFAPILNFLRTKELHPRS--IDVHLLIHEAEFYGITPLVRKLQLCDELDRSSCGNVLFNG 115          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd3 (potassium channel tetramerization domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060503-169])

HSP 1 Score: 251.906 bits (642), Expect = 7.272e-70
Identity = 157/471 (33.33%), Postives = 245/471 (52.02%), Query Frame = 3
Query: 2352 FTYTDGHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSID 3728
            F    G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S        I + AL +K              D            + +VA +S   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V    +C +  S  F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+             + +S N  ++                 D+GP+    D  +FIQK++P  ++LFVRL+ TG+R+C + S     IT F V + +    +       L TGH +GS++MW+LTT++D
Sbjct:  143 FNAITGSPVDPRKVLIVAGHHNWIVAAYAHFVICYRIKESSGWQQVFSSP--YLEWAIERVALNAK-------VVGGPHGDK-----------DKMVAASSENRIILWSIQ-----------------DGGNGSEIGVFSLGVPVDSLFFIGSQLVATSHTG-KVGVWNAVTQHWQVQDVVPITSCDTAGS--FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPKT--SVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKIISLE-------------ETESHNSYSS---------------GNDIGPFGERDDQQVFIQKVIPITNKLFVRLSSTGRRICEVQSVDGTTITCFTVRECEGSSRMGSRPRRYLFTGHANGSIQMWDLTTAMD 543          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd3 (potassium channel tetramerization domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060503-169])

HSP 1 Score: 251.521 bits (641), Expect = 1.306e-69
Identity = 157/471 (33.33%), Postives = 247/471 (52.44%), Query Frame = 3
Query: 2352 FTYTDGHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSID 3728
            F    G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S   + +  I + AL +K              D            + +VA +S   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V    +C +  S  F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+             + +S N  ++                 D+GP+    D  +FIQK++P  ++LFVRL+ TG+R+C + S     IT F V + +    +       L TGH +GS++MW+LTT++D
Sbjct:  143 FNAITGSPVDPRKVLIVAGHHNWIVAAYAHFVICYRIKESSGWQQVFSSPYLEWA--IERVALNAK-------VVGGPHGDK-----------DKMVAASSENRIILWSIQ-----------------DGGNGSEIGVFSLGVPVDSLFFIGSQLVATSHTG-KVGVWNAVTQHWQVQDVVPITSCDTAGS--FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPKT--SVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKIISLE-------------ETESHNSYSS---------------GNDIGPFGERDDQQVFIQKVIPITNKLFVRLSSTGRRICEVQSVDGTTITCFTVRECEGSSRMGSRPRRYLFTGHANGSIQMWDLTTAMD 543          
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Match: kctd3 (potassium channel tetramerization domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060503-169])

HSP 1 Score: 251.136 bits (640), Expect = 2.977e-69
Identity = 157/471 (33.33%), Postives = 247/471 (52.44%), Query Frame = 3
Query: 2352 FTYTDGHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSID 3728
            F    G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S   + +  I + AL +K              D            + +VA +S   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V    +C +  S  F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+             + +S N  ++                 D+GP+    D  +FIQK++P  ++LFVRL+ TG+R+C + S     IT F V + +    +       L TGH +GS++MW+LTT++D
Sbjct:  169 FNAITGSPVDPRKVLIVAGHHNWIVAAYAHFVICYRIKESSGWQQVFSSPYLEWA--IERVALNAK-------VVGGPHGDK-----------DKMVAASSENRIILWSIQ-----------------DGGNGSEIGVFSLGVPVDSLFFIGSQLVATSHTG-KVGVWNAVTQHWQVQDVVPITSCDTAGS--FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPKT--SVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKIISLE-------------ETESHNSYSS---------------GNDIGPFGERDDQQVFIQKVIPITNKLFVRLSSTGRRICEVQSVDGTTITCFTVRECEGSSRMGSRPRRYLFTGHANGSIQMWDLTTAMD 569          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: KCTD3 (potassium channel tetramerization domain containing 3 [Source:NCBI gene;Acc:100487520])

HSP 1 Score: 251.521 bits (641), Expect = 1.234e-69
Identity = 161/484 (33.26%), Postives = 246/484 (50.83%), Query Frame = 3
Query: 2331 IKSKSLDFTYTDGHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            I S  + F    G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S        I + AL +K              D            + +VA+AS   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TG+R+C I +     IT F V + +    +       L TGH +GS++MW+LTT++D +   E
Sbjct:  107 ITSAIVVFLCFAGFPVDPRKVLIVAGHHNWIVTAYAHFVVCYRIKESSGWQQVFSSP--FLDWTIERVALNAK-------VVGGPHGDK-----------DKMVAVASESSIILWSIQ-----------------DGSSGSEIGVFSLGVPVDALFFIGNQLVATSHTG-KVGVWNAVTQHWQVQDV-VPITSYDTAGS-FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPKT--SVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSSVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------EAESHGSYSS-------GNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGRRICEIQAVDCTTITCFTVRECEGSSRMGSRPRRYLFTGHSNGSIQMWDLTTAMDMVTKTE 520          

HSP 2 Score: 62.003 bits (149), Expect = 7.112e-9
Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 3
Query: 1848 FIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            FIDRDP  F+ ILN+LRT +L     D+    L++EA FY I PLV ++ L      + CG++LF G
Sbjct:   27 FIDRDPTAFAPILNFLRTKEL-----DLSLNVLRHEAEFYGITPLVKRLLLCEELERSSCGSVLFHG 88          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: KCTD3 (potassium channel tetramerization domain containing 3 [Source:NCBI gene;Acc:100487520])

HSP 1 Score: 251.906 bits (642), Expect = 1.746e-69
Identity = 158/472 (33.47%), Postives = 242/472 (51.27%), Query Frame = 3
Query: 2367 GHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S        I + AL +K              D +            +VA+AS   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TG+R+C I +     IT F V + +    +       L TGH +GS++MW+LTT++D +   E
Sbjct:  155 GFPVDPRKVLIVAGHHNWIVTAYAHFVVCYRIKESSGWQQVFSSP--FLDWTIERVALNAK-------VVGGPHGDKD-----------KMVAVASESSIILWSIQ-----------------DGSSGSEIGVFSLGVPVDALFFIGNQLVATSHTG-KVGVWNAVTQHWQVQDV-VPITSYDTAGS-FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPKT--SVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSSVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------EAESHGSYSS-------GNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGRRICEIQAVDCTTITCFTVRECEGSSRMGSRPRRYLFTGHSNGSIQMWDLTTAMDMVTKTE 556          

HSP 2 Score: 56.225 bits (134), Expect = 4.729e-7
Identity = 27/67 (40.30%), Postives = 38/67 (56.72%), Query Frame = 3
Query: 1848 FIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            F  RDP  F+ ILN+LRT +L      +    L++EA FY I PLV ++ L      + CG++LF G
Sbjct:   39 FFSRDPTAFAPILNFLRTKEL--DLRGVSLNVLRHEAEFYGITPLVKRLLLCEELERSSCGSVLFHG 103          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: KCTD3 (potassium channel tetramerization domain containing 3 [Source:NCBI gene;Acc:100487520])

HSP 1 Score: 251.906 bits (642), Expect = 2.280e-69
Identity = 158/472 (33.47%), Postives = 242/472 (51.27%), Query Frame = 3
Query: 2367 GHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S        I + AL +K              D +            +VA+AS   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TG+R+C I +     IT F V + +    +       L TGH +GS++MW+LTT++D +   E
Sbjct:  169 GFPVDPRKVLIVAGHHNWIVTAYAHFVVCYRIKESSGWQQVFSSP--FLDWTIERVALNAK-------VVGGPHGDKD-----------KMVAVASESSIILWSIQ-----------------DGSSGSEIGVFSLGVPVDALFFIGNQLVATSHTG-KVGVWNAVTQHWQVQDV-VPITSYDTAGS-FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPKT--SVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSSVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------EAESHGSYSS-------GNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGRRICEIQAVDCTTITCFTVRECEGSSRMGSRPRRYLFTGHSNGSIQMWDLTTAMDMVTKTE 570          

HSP 2 Score: 65.4698 bits (158), Expect = 5.968e-10
Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            +++RD+    FIDRDP  F+ ILN+LRT +L      +    L++EA FY I PLV ++ L      + CG++LF G
Sbjct:   43 STLRDETAAIFIDRDPTAFAPILNFLRTKEL--DLRGVSLNVLRHEAEFYGITPLVKRLLLCEELERSSCGSVLFHG 117          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: KCTD3 (potassium channel tetramerization domain containing 3 [Source:NCBI gene;Acc:100487520])

HSP 1 Score: 251.136 bits (640), Expect = 8.860e-69
Identity = 158/472 (33.47%), Postives = 242/472 (51.27%), Query Frame = 3
Query: 2367 GHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S        I + AL +K              D            + +VA+AS   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TG+R+C I +     IT F V + +    +       L TGH +GS++MW+LTT++D +   E
Sbjct:  231 GFPVDPRKVLIVAGHHNWIVTAYAHFVVCYRIKESSGWQQVFSSP--FLDWTIERVALNAK-------VVGGPHGD-----------KDKMVAVASESSIILWSIQ-----------------DGSSGSEIGVFSLGVPVDALFFIGNQLVATSHTG-KVGVWNAVTQHWQVQDV-VPITSYDTAGS-FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPKT--SVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSSVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------EAESHGSYSS-------GNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGRRICEIQAVDCTTITCFTVRECEGSSRMGSRPRRYLFTGHSNGSIQMWDLTTAMDMVTKTE 632          

HSP 2 Score: 65.855 bits (159), Expect = 5.087e-10
Identity = 31/77 (40.26%), Postives = 46/77 (59.74%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            +++RD+    FIDRDP  F+ ILN+LRT +L      +    L++EA FY I PLV ++ L      + CG++LF G
Sbjct:  105 STLRDETAAIFIDRDPTAFAPILNFLRTKEL--DLRGVSLNVLRHEAEFYGITPLVKRLLLCEELERSSCGSVLFHG 179          
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Match: SHKBP1 (SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:100486587])

HSP 1 Score: 241.506 bits (615), Expect = 2.281e-66
Identity = 154/459 (33.55%), Postives = 241/459 (52.51%), Query Frame = 3
Query: 2388 VTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNS-LIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSID 3728
            V II  H  W+AV Y   +  Y   + +GW+ V+ S       +I + AL +K         +L   D  +   + S +I  A+   +SG  + +FS+ + V                               + L F+G  L+A S +    G W   ++ W    V   IN Y   +  F++LGC NG IY ++ QKFPLRM DN +L TE++RDPS D++TAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SE++LIS+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+        +  +A   + N                     D+GP+    D  +FIQ+++P  + ++VRL+ TGKR+C I S     IT+F VH+ +    +       L TGH  G ++MW+LTT+++
Sbjct:  119 VRIICGHHNWIAVAYAQFIVCYRMKETSGWQLVFTSP--CLDWVIERVALNAK-----AMVGTLGDNDKMLAVSSCSEIILWAISGDSSGSEIGVFSLGVPV-------------------------------EALFFVGNQLIATSHTG-KIGVWNAVTKHWQIQDV-VPINSYDT-AGSFLLLGCNNGSIYYVDVQKFPLRMKDNDLLVTELYRDPSEDAITALSVYLTPKTSDS--GNWIEIAYGTSSGVVRVIVQHPETVGSGPQLFQTFTVHRSSVTKIMLSERHLISVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE-------DVDGHAGSSAGN---------------------DIGPFGERDDQQVFIQRVVPDSNIVYVRLSSTGKRICEIRSVDCTPITSFTVHECEGSSRIGSRPRRYLFTGHASGCIQMWDLTTAME 506          

HSP 2 Score: 60.077 bits (144), Expect = 2.668e-8
Identity = 29/67 (43.28%), Postives = 41/67 (61.19%), Query Frame = 3
Query: 1848 FIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            FIDRDP +F  ILN+LRT +L   +  +  + L +EA FY I PLV ++ L      + CG++LF G
Sbjct:   18 FIDRDPTVFGPILNFLRTKEL--DNRGVKSSVLLHEAEFYGITPLVRRLQLCEELERSSCGSVLFNG 82          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd3 (potassium channel tetramerisation domain containing 3 [Source:MGI Symbol;Acc:MGI:2444629])

HSP 1 Score: 288.115 bits (736), Expect = 1.045e-81
Identity = 198/655 (30.23%), Postives = 308/655 (47.02%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSV-TLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            +++RD+    FIDRDP  F+ ILN+LRT +L      +    L++EA FY I PLV ++ L      + CG++LF G   +        + V+N+ +S    + +R  + ++ G    N        + +D          RL  P+  R                                        +V I+  H  W+   Y      Y   + +GW+ V+ S        I + AL +K              D +            +VA+AS   + L+SV                 Q      ++  FS    +D L F+G  L+A S +    G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND+VTAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TGKR+C I +     I++F V + +    +       L TGH +GS++MW+LTT++D +   E
Sbjct:   53 STLRDETGAIFIDRDPAAFAPILNFLRTKEL--DLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSCGSVLFHG---YLPPPGIPSRKVTNTARSS---VDARNGLNSMEGEARGNGTQPVLAGNGEDTI--------RLGVPVDPR----------------------------------------KVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQVFTSP--YLDWTIERVALNAK-------VVGGPHGDKD-----------KMVAVASESSIILWSV-----------------QDGGSGSEIGVFSLGVPVDALFFIGNQLVATSHTG-KVGVWNAVTQHWQVQDV-VPITSYDTAG-SFLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAVTALSVYLTPK--TSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------ETESHGSYSS-------GNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGKRICEIQAVDCTTISSFTVRECEGSSRMGSRPRRYLFTGHTNGSIQMWDLTTAMDMVNKTE 581          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Kctd3 (potassium channel tetramerisation domain containing 3 [Source:MGI Symbol;Acc:MGI:2444629])

HSP 1 Score: 257.299 bits (656), Expect = 6.287e-74
Identity = 180/596 (30.20%), Postives = 277/596 (46.48%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSV-TLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKR 3590
            +++RD+    FIDRDP  F+ ILN+LRT +L      +    L++EA FY I PLV ++ L      + CG++LF G   +        + V+N+ +S    + +R  + ++ G    N        + +D        + RL  P+  R                                        +V I+  H  W+   Y      Y   + +GW+ V+ S        I + AL +K              D            + +VA+AS   + L+SV                 Q      ++  FS    +D L F+G  L+A S +    G W   ++ W    V   I  Y   +  F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND+VTAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TGKR
Sbjct:   53 STLRDETGAIFIDRDPAAFAPILNFLRTKEL--DLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSCGSVLFHG---YLPPPGIPSRKVTNTARS---SVDARNGLNSMEGEARGNGTQPVLAGNGED--------TIRLGVPVDPR----------------------------------------KVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQVFTSP--YLDWTIERVALNAK-------VVGGPHGDK-----------DKMVAVASESSIILWSV-----------------QDGGSGSEIGVFSLGVPVDALFFIGNQLVATSHT-GKVGVWNAVTQHWQVQDV-VPITSYDT-AGSFLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAVTALSVYLTPKTSVS--GNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------ETESHGSYSS-------GNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGKR 522          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Shkbp1 (Sh3kbp1 binding protein 1 [Source:MGI Symbol;Acc:MGI:2385803])

HSP 1 Score: 248.054 bits (632), Expect = 5.835e-69
Identity = 154/470 (32.77%), Postives = 241/470 (51.28%), Query Frame = 3
Query: 2367 GHPVNSQVTIIKC-HQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGN 3740
            G P    +  + C H  W+AV Y   +  Y   + +GW+  + S   +    I + AL              AR       +     H+ +VA A+G  + L++                 LQ+     ++  F     ++ L F+G  L+A S +    G W   ++ W    V   I  Y   +  F++LGC NG IY ++ QKFPLRM DN +L +E++RDP+ D VTAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT +VHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  LASF +++L+              +D +   +                  D+GPY    D  +FIQK++P   +LFVRL+ TG+RVC + S   +  TAF V + +    +       L+TG  +GSL MW+LTT++D +G 
Sbjct:  188 GQPEEPGMVRLVCGHHNWIAVAYTHFLVCYRLKEASGWQLAFSSP--RLDWPIERLALA-------------ARVLGGAPGE-----HDKMVAAATGSEILLWA-----------------LQAQGGGSEIGVFHLGVPVEALFFVGNQLIATSHTG-RIGVWNAVTKHWQVQEVQP-ITSYDA-AGSFLLLGCSNGSIYYVDVQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDS--GNWIEIAYGTSSGVVRVIVQHPETVGSGPQLFQTFSVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALE-------------SVDGLGGCS---------------AGNDIGPYGERDDQQVFIQKVVPNASQLFVRLSSTGQRVCSVRSVDGSPTTAFTVLECEGSRRLGSRPRRYLLTGQANGSLAMWDLTTAMDGLGQ 587          

HSP 2 Score: 65.0846 bits (157), Expect = 5.972e-10
Identity = 29/77 (37.66%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            ++++D+    FIDRDP +F+ ILN+LRT +L      +  ++L +EA FY + PLV ++ +      + CGN+LF G
Sbjct:   54 STLKDETGAIFIDRDPTVFAPILNFLRTKEL--DPRGVHGSSLLHEAQFYGLTPLVRRLQVREELDRSSCGNVLFNG 128          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Dcaf6 (DDB1 and CUL4 associated factor 6 [Source:MGI Symbol;Acc:MGI:1921356])

HSP 1 Score: 117.857 bits (294), Expect = 3.967e-26
Identity = 103/329 (31.31%), Postives = 149/329 (45.29%), Query Frame = 3
Query:   78 SFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNS---TNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRC-VNSVSFEPRLGNHILVSYMYDSIYLFDTR-----------QQENRQSDFQPERLPLDTSSFRIHYNWENTGP-PRPEGEQER 995
            S Y     + + LK+   L  H GCVNT+ W+ +G  ILSG DD  L I         P+ +  +  I   +  NI SAKF+P  ++ QIVS S  G IF  ++     TN++   F  H G T  I T  ++ + F +   D T   FD R   +         + +N   + +++AI P   Y +A+G SDS VR++D+R L                + R   F I + +SN+S        C V S+ +    G  ILVSY  D IYLFD +            +E R+   QP          R+  +W +TGP  RPE E+ER
Sbjct:   29 SRYLGRREFIQRLKLEATLNVHDGCVNTICWNDTGEYILSGSDDTKLVI-------SNPYSRKVLTTIRSGHRANIFSAKFLPCTDDKQIVSCSGDGVIFYTNIEQDAETNRQCQ-FTCHYGTTYEIMTVPNDPYTFLSCGEDGTVRWFDTRIKTSCTKEDCKDDILINCRRAATSVAICPPVPYYLAVGCSDSSVRIYDRRMLGTRATGNYAGRGTTGMVAR---F-IPSHLSNKS--------CRVTSLCYS-EDGQEILVSYSSDYIYLFDPKDDTARELKTPSAEERREELRQPP-----VKRLRLRGDWSDTGPRARPESERER 331          

HSP 2 Score: 87.0409 bits (214), Expect = 1.135e-16
Identity = 50/171 (29.24%), Postives = 85/171 (49.71%), Query Frame = 3
Query: 1107 VKRYKEVQIYVGHQNCRTME*DVSHPAHLGITHQ*RDWSCIS*KIKDSKFWGTKYILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAY----VEKIVNQNERRTENAKGCQS------MSMLDLLRVIRAQRM 1589
            ++R     +Y GH+N RTM                         IK++ FWG  +++SGS+CGH+ +W++ +   +M +  D  V N ++PHPF PI+A+ GIDY++KI      P+   EE + +     ++++ +NE   E  +   +      + ML  L  IRA R+
Sbjct:  720 IRRPLVKMVYKGHRNSRTM-------------------------IKEANFWGANFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCLQPHPFDPILASSGIDYDIKI----WSPL---EESRIFNRKLADEVITRNELMLEETRNTITVPASFMLRMLASLNHIRADRL 858          
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Match: Dcaf8l (DDB1 and CUL4 associated factor 8 like [Source:MGI Symbol;Acc:MGI:101758])

HSP 1 Score: 86.6557 bits (213), Expect = 1.196e-16
Identity = 70/263 (26.62%), Postives = 114/263 (43.35%), Query Frame = 3
Query:  132 LEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDH-VYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNV-----FYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKM----NLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQ 890
             EGH GCVNTV +++ GT + SG DD  + +      WD  W+K   V      +  NIL AKF+P  N+ I++   CG    V V   +            KH G +  +    D  F F T+  D      D+R+++    L +    +    L  + ++P   Y+ A+GG D  +R++D+R ++++ NN       + + C       D      S +Y+Y              G  IL SY  + IY+F++   +  Q
Sbjct:  349 FEGHSGCVNTVHFNQHGTLLASGSDDLKVIV------WD--WLKKRSVLNFDSGHKNNILQAKFLPNCNDAILAM--CGRDGQVRVAQLSAVAGTHMTKRLVKHGGASHRLGLEPDSPFRFLTSGEDAVVFNIDLRQAHPASKLLVIKDGDKKVGLYTVFVNPANVYQFAVGGQDQFMRIYDQRKIDENVNN-----GVLKKFCPHHLLSSDYPAHITSLMYSYD-------------GTEILASYNDEDIYIFNSSDSDGAQ 583          

HSP 2 Score: 72.4034 bits (176), Expect = 3.242e-12
Identity = 35/99 (35.35%), Postives = 62/99 (62.63%), Query Frame = 3
Query: 1239 IKDSKFWG--TKYILSGSECGHVLVWEKDSKYPIMAIPTDERVT-NRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTEN 1526
            +K   F+G  +++++SGS+CGH+ +WEK S   +  +  DE  T N I+ HP+LP++A+ G+D+ VKI      PI  P +K A ++ ++  N+ + +N
Sbjct:  597 VKGVYFYGPRSEFVMSGSDCGHIFIWEKSSCQIVQFLEADEGGTINCIDSHPYLPVLASSGLDHEVKI----WSPIAEPSKKLAGLKNVIKINKLKRDN 691          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BFX3|KCTD3_MOUSE (BTB/POZ domain-containing protein KCTD3 OS=Mus musculus OX=10090 GN=Kctd3 PE=1 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 7.309e-81
Identity = 198/655 (30.23%), Postives = 308/655 (47.02%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSV-TLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            +++RD+    FIDRDP  F+ ILN+LRT +L      +    L++EA FY I PLV ++ L      + CG++LF G   +        + V+N+ +S    + +R  + ++ G    N        + +D          RL  P+  R                                        +V I+  H  W+   Y      Y   + +GW+ V+ S        I + AL +K              D +            +VA+AS   + L+SV                 Q      ++  FS    +D L F+G  L+A S +    G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND+VTAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TGKR+C I +     I++F V + +    +       L TGH +GS++MW+LTT++D +   E
Sbjct:   53 STLRDETGAIFIDRDPAAFAPILNFLRTKEL--DLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSCGSVLFHG---YLPPPGIPSRKVTNTARSS---VDARNGLNSMEGEARGNGTQPVLAGNGEDTI--------RLGVPVDPR----------------------------------------KVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQVFTSP--YLDWTIERVALNAK-------VVGGPHGDKD-----------KMVAVASESSIILWSV-----------------QDGGSGSEIGVFSLGVPVDALFFIGNQLVATSHTG-KVGVWNAVTQHWQVQDV-VPITSYDTAG-SFLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAVTALSVYLTPK--TSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------ETESHGSYSS-------GNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGKRICEIQAVDCTTISSFTVRECEGSSRMGSRPRRYLFTGHTNGSIQMWDLTTAMDMVNKTE 581          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y597|KCTD3_HUMAN (BTB/POZ domain-containing protein KCTD3 OS=Homo sapiens OX=9606 GN=KCTD3 PE=1 SV=2)

HSP 1 Score: 287.73 bits (735), Expect = 1.050e-80
Identity = 198/655 (30.23%), Postives = 310/655 (47.33%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVD-LSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            +++RD+    FIDRDP  F+ ILN+LRT +L      +    L++EA FY I PLV ++ L      + CG++LF G   +        + ++N++         R++ + NG    NS +  +R        + T   + RL  P+  R                                        +V I+  H  W+   Y      Y   + +GW+ V+ S        I + AL +K              D            + +VA+AS   + L+SV                 Q      ++  FS    +D L F+G  L+A S +    G W   ++ W    V   I  Y      F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TGKR+C I +     I++F V + +    +       L TGH +GS++MW+LTT++D +   E
Sbjct:   53 STLRDETGAIFIDRDPAAFAPILNFLRTKEL--DLRGVSINVLRHEAEFYGITPLVRRLLLCEELERSSCGSVLFHG---YLPPPGIPSRKINNTV---------RSADSRNG---LNSTEGEARGNGTQPVLSGTGEETVRLGFPVDPR----------------------------------------KVLIVAGHHNWIVAAYAHFAVCYRIKESSGWQQVFTSP--YLDWTIERVALNAK-------VVGGPHGDK-----------DKMVAVASESSIILWSV-----------------QDGGSGSEIGVFSLGVPVDALFFIGNQLVATSHTG-KVGVWNAVTQHWQVQDV-VPITSYDTAG-SFLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPK--TSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------ETESHGSYSS-------GNDIGPFGERDDQQVFIQKVVPITNKLFVRLSSTGKRICEIQAVDCTTISSFTVRECEGSSRMGSRPRRYLFTGHTNGSIQMWDLTTAMDMVNKSE 580          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C5J9|SHKB1_RAT (SH3KBP1-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Shkbp1 PE=1 SV=1)

HSP 1 Score: 262.307 bits (669), Expect = 5.856e-73
Identity = 191/660 (28.94%), Postives = 305/660 (46.21%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHE-ELPSRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTD-------GHPVNSQVTIIKC-HQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIG 3737
            ++++D+    FIDRDP +F+ ILN+LRT +L      +  ++L +EA F                                     +G+  +   +Q + E +  S  +V  NG+       + R        N  SL+      P Q+    + ++       +N    NL  +  L     D       G P    +  + C H  W+AV Y   +  Y   + +GW+  + S   +    I + AL              AR       +     H+ +VA A+G  + L++                 LQ+     ++  F     ++ L F+G  L+A S +    G W   ++ W    V   I  Y   +  F++LGC NG IY ++ QKFPLRM DN +L +E++RDP+ D VTAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT +VHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  LASF +++L+    +      N                            D+GPY    D  +FIQK++P   +LFVRL+ TG+RVC + S   +  TAF V + +    +       L+TG  +GSL MW+LTT++D +G
Sbjct:   54 STLKDETGAIFIDRDPTVFAPILNFLRTKEL--DPRGVHGSSLLHEAQF-------------------------------------YGLTPLVRRLQVREELDRSSCGNVLFNGYLPPPVFPVKRR-------NRHSLVG-----PQQIGGRPAPVR------RSNTMPPNLGNAGLLGRMLDDRAPPSPSGQPEEPGMVRLVCGHHNWIAVAYTHFLVCYRLKEASGWQLAFSSP--RLDWPIERLALT-------------ARVLGGAPGE-----HDKMVAAATGSEILLWA-----------------LQAQGGGSEIGVFHLGVPVEALFFVGNQLIATSHTG-RIGVWNAVTKHWQVQEVQP-ITSYDA-AGSFLLLGCSNGSIYYVDVQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDS--GNWIEIAYGTSSGVVRVIVQHPETVGSGPQLFQTFSVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALESADGLGGCSAGN----------------------------DIGPYGERDDQQVFIQKVVPNASQLFVRLSSTGQRVCSVRSVDGSATTAFTVLECEGSRRLGSRPRRYLLTGQANGSLAMWDLTTAMDGLG 586          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8TBC3|SHKB1_HUMAN (SH3KBP1-binding protein 1 OS=Homo sapiens OX=9606 GN=SHKBP1 PE=1 SV=2)

HSP 1 Score: 249.21 bits (635), Expect = 1.803e-68
Identity = 156/470 (33.19%), Postives = 242/470 (51.49%), Query Frame = 3
Query: 2367 GHPVNSQVTIIKC-HQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGN 3740
            G P    +  + C H  W+AV Y   +  Y   + +GW+ V+ S   +    I + AL +     R +  +L               H+ +VA A+G  + L++                 LQ+     ++  F     ++ L F+G  L+A S +    G W   ++ W    V   I  Y   +  F++LGC NG IY ++ QKFPLRM DN +L +E++RDP+ D VTAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  LASF +++L+               D     +                  D+GPY    D  +FIQK++P   +LFVRL+ TG+RVC + S   +  TAF V + +    +       L+TG  +GSL MW+LTT++D +G 
Sbjct:  188 GQPEEPGMVRLVCGHHNWIAVAYTQFLVCYRLKEASGWQLVFSSP--RLDWPIERLALTA-----RVHGGALGE-------------HDKMVAAATGSEILLWA-----------------LQAEGGGSEIGVFHLGVPVEALFFVGNQLIATSHTG-RIGVWNAVTKHWQVQEVQP-ITSYDA-AGSFLLLGCNNGSIYYVDVQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDS--GNWIEIAYGTSSGGVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLISVCADNNHVRTWSVTRFRGMISTQPGSTPLASFKILALE-------------SADGHGGCS---------------AGNDIGPYGERDDQQVFIQKVVPSASQLFVRLSSTGQRVCSVRSVDGSPTTAFTVLECEGSRRLGSRPRRYLLTGQANGSLAMWDLTTAMDGLGQ 587          

HSP 2 Score: 66.2402 bits (160), Expect = 1.639e-9
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            ++++D+    FIDRDP +F+ ILN+LRT +L      +  ++L +EA FY + PLV ++ L      + CGN+LF G
Sbjct:   54 STLKDETGAIFIDRDPTVFAPILNFLRTKEL--DPRGVHGSSLLHEAQFYGLTPLVRRLQLREELDRSSCGNVLFNG 128          
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Match: sp|A3KMV1|SHKB1_BOVIN (SH3KBP1-binding protein 1 OS=Bos taurus OX=9913 GN=SHKBP1 PE=2 SV=1)

HSP 1 Score: 248.825 bits (634), Expect = 2.216e-68
Identity = 154/462 (33.33%), Postives = 239/462 (51.73%), Query Frame = 3
Query: 2388 VTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGN 3740
            V ++  H  W+AV Y   +  Y   + +GW+ V+ S   +    I + AL +     R    +L               H+ +VA+A+G  + L++                 LQ      ++  F     ++ L F+G  L+A S +    G W   ++ W    V   I  Y   +  F++LGC NG IY ++ QKFPLRM DN +L +E++RDP+ D VTAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  LASF +++L+               D     +                  D+GPY    D  +FIQK++P   +LFVRL+ TG+RVC + S   +  TAF V + +    +       L+TG  +GSL MW+LTT++D +G 
Sbjct:  196 VRLVCGHHNWIAVAYTQFLVCYRLKEASGWQLVFSSP--RLDWPIERLALTA-----RVLGGALGE-------------HDKMVAVATGSEILLWA-----------------LQPEGGGSEIGVFHLGVPVEALFFVGNQLIATSHTG-RIGVWNAVTKHWQVQEVQP-ITSYDA-AGSFLLLGCNNGSIYYVDVQKFPLRMKDNDLLVSELYRDPAEDGVTALSVYLTPKTSDS--GNWIEIAYGTSSGGVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLISVCADSNHVRTWSVTRFRGMISTQPGSTPLASFKILALE-------------SADGHGGCS---------------AGNDIGPYGERDDQQVFIQKVVPSASQLFVRLSSTGQRVCSVRSVDGSPTTAFTVLECEGSRRLGSRPRRYLLTGQANGSLAMWDLTTAMDGLGQ 587          

HSP 2 Score: 68.1662 bits (165), Expect = 4.865e-10
Identity = 30/77 (38.96%), Postives = 49/77 (63.64%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            ++++D+    FIDRDP +F+ ILN+LRT +L      +  ++L +EA FY + PLV ++ L+     + CGN+LF G
Sbjct:   54 STLKDETGAIFIDRDPTVFAPILNFLRTKEL--DPRGVHGSSLLHEAQFYGLTPLVRRLQLLEELDRSSCGNVLFTG 128          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: K1QXL7 (BTB/POZ domain-containing protein KCTD3 OS=Crassostrea gigas OX=29159 GN=CGI_10022035 PE=4 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 1.501e-94
Identity = 212/650 (32.62%), Postives = 336/650 (51.69%), Query Frame = 3
Query: 1830 DDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLD---FTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSL-DIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKE-NITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQI 3734
            D+    FIDRDP +FSVILN++RT ++     ++D +AL++EA F+ I PLV ++ L        CG++LF G +N  E          ++ + +H            G  AC     S    D +        S R S P+     T  ++S   +      E  L  S  LD     ++  H    +VT+++ H  W+ V YP  V  +   D  GW+  W S   +   ++ + A+         N   L   + N            +VA A G ++ L+SV  +   +                 ++ +FS + S+D L F+G  L+A+S++    G W   S+ W    V   ++ Y   +  F++LGCENG IY ++ QKFPLRM DN +L TE+++DPS D VTAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ +I+V++SEK+L+S+C   NH+R+W ++RFRG I+TQPG+  LASF ++SL D++P +S +                              + D+GPY    D  +FIQK++P+ ++LF+RL+  G+RVC I S    N++AF VH+ +    +       L TGH +G+++MW+LTT++D++
Sbjct:   43 DETGAIFIDRDPVIFSVILNFMRTKEV--DFGNVDISALRHEAEFFGITPLVSRLTLCEDLEHASCGDVLFHGYLNPPEP----PLPPPSAEKKRHSTSVVDLVGATGGQGACARSPGSVSRHDAE--------SARSSRPVSEMCVT--VQSGEHRPVRPASEALLCHSTVLDKMLIHHSTCHDEPLKVTMVRGHHNWLCVAYPHFVCCFRMKDTAGWQLRWTSPYMED--VVERVAI---------NAKVLNPENPN-----------KMVAAAMGNMIQLWSVADDGTSR-----------------EIGKFSLNVSVDSLFFIGSQLVALSQT-GKVGVWHAMSQHWQIQDV-VPVSSYDT-AGSFLLLGCENGSIYYIDMQKFPLRMKDNDLLVTELYKDPSGDVVTALSVYLTPKT--SISGNWIEIAYGTSSGTVRVIVQHPETVGSGPQLFQTFTVHRSPVIKVMLSEKHLVSVCSEYNHVRTWSVTRFRGMISTQPGSTPLASFKIVSLEDVDPIVSYS-----------------------------ASNDIGPYGEQDDQQVFIQKVVPETNQLFIRLSSNGQRVCVIKSVDSFNVSAFCVHECEGSNRMGSRPRRYLFTGHSNGAIQMWDLTTALDKM 603          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A224Z6E2 (Protein containing BTB2 domain OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.798e-92
Identity = 225/705 (31.91%), Postives = 338/705 (47.94%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFS-----ESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFN--------------------------------DTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSK--SLDFTY----TD-------------GHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSL-DIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSY-KENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSID 3728
            +S RD+    FIDRDPK+FSVILN++RT D+     D+D + L++EA FY I PLV ++ L    H + CG++LF G +  +     E  + G     + +       P R        R   +VD S LA+     +                                D    S  +  P QL  ++S +++  V+  +     +L  S+  S DF+     TD               P N +V ++K HQ W+AV Y   V+ Y   D  GW+  + S   +   +I + AL +K       TAS    +S             ++A+A G  V L+S+                 Q      ++  F     +D L F+G  L+A+S      G W   ++ W    V   I  +       ++LGC NG IY ++ QKFPLRM DN +L TE++RDPS D +TA+ V+   +   SL  N +EIAYGT++G +R++VQH   VG GP++FQT TVHR+ + RVV+SEKYLIS+C   +H+R+W ++RFRG I+TQPG+  LASF ++SL D+EP  S                                  D GPY    D  +FIQK++P+ D+L+VR A +GKR+C I S     +T+F VH+ +    +       + TGH  G+++MW+LTT++D
Sbjct:   71 SSHRDETGAIFIDRDPKLFSVILNFMRTKDI--DLRDLDMSVLRHEAEFYGITPLVKRLILCEDLHQSSCGDVLFHGYLPMAAVPPYEVASGGRNMPPSGLLPTPAGGPDRRP-DHGAPRPPFAVDPSCLAALPGMVDARPGSVFRVMPEVGGSRPPPTSSCGHSRNPSLDARQASSSMVPPPQLSRSSSDLRAGGVRGHSRASSLDLRHSRNSSADFSRRIRDTDSGWASAALPQGVSAWPDNLRVCMVKGHQNWIAVAYAHFVSCYRLKDSTGWQLAFTSPYLEP--VIERIALNAK----VVTTASAQAPESGAK----------MLAVAYGSQVRLWSIA----------------QEGNGRAEIGVFHLSVPVDSLFFIGSQLVALSH-LGKVGVWHAMTQHWQIQDV-VPITSFDTAGSCILLLGCSNGSIYYIDMQKFPLRMKDNDLLVTELYRDPSADPITAISVYLTPKT--SLCGNWIEIAYGTSAGTVRVIVQHPETVGHGPQLFQTFTVHRSPVTRVVLSEKYLISVCSEYSHVRTWSVTRFRGMISTQPGSTPLASFKVVSLEDLEPSASYP-----------------------------AGNDCGPYGEQDDEQVFIQKVVPETDQLYVRFASSGKRICVIKSVDGTTVTSFCVHECEGSNRMGSRPRRYIFTGHSSGAIQMWDLTTALD 707          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A131Z364 (BTB domain-containing protein OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 327.791 bits (839), Expect = 1.798e-92
Identity = 225/705 (31.91%), Postives = 338/705 (47.94%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFS-----ESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFN--------------------------------DTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSK--SLDFTY----TD-------------GHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSL-DIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSY-KENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSID 3728
            +S RD+    FIDRDPK+FSVILN++RT D+     D+D + L++EA FY I PLV ++ L    H + CG++LF G +  +     E  + G     + +       P R        R   +VD S LA+     +                                D    S  +  P QL  ++S +++  V+  +     +L  S+  S DF+     TD               P N +V ++K HQ W+AV Y   V+ Y   D  GW+  + S   +   +I + AL +K       TAS    +S             ++A+A G  V L+S+                 Q      ++  F     +D L F+G  L+A+S      G W   ++ W    V   I  +       ++LGC NG IY ++ QKFPLRM DN +L TE++RDPS D +TA+ V+   +   SL  N +EIAYGT++G +R++VQH   VG GP++FQT TVHR+ + RVV+SEKYLIS+C   +H+R+W ++RFRG I+TQPG+  LASF ++SL D+EP  S                                  D GPY    D  +FIQK++P+ D+L+VR A +GKR+C I S     +T+F VH+ +    +       + TGH  G+++MW+LTT++D
Sbjct:   71 SSHRDETGAIFIDRDPKLFSVILNFMRTKDI--DLRDLDMSVLRHEAEFYGITPLVKRLILCEDLHQSSCGDVLFHGYLPMAAVPPYEVASGGRNMPPSGLLPTPAGGPDRRP-DHGAPRPPFAVDPSCLAALPGMVDARPGSVFRVMPEVGGSRPPPTSSCGHSRNPSLDARQASSSMVPPPQLSRSSSDLRAGGVRGHSRASSLDLRHSRNSSADFSRRIRDTDSGWASAALPQGVSAWPDNLRVCMVKGHQNWIAVAYAHFVSCYRLKDSTGWQLAFTSPYLEP--VIERIALNAK----VVTTASAQAPESGAK----------MLAVAYGSQVRLWSIA----------------QEGNGRAEIGVFHLSVPVDSLFFIGSQLVALSH-LGKVGVWHAMTQHWQIQDV-VPITSFDTAGSCILLLGCSNGSIYYIDMQKFPLRMKDNDLLVTELYRDPSADPITAISVYLTPKT--SLCGNWIEIAYGTSAGTVRVIVQHPETVGHGPQLFQTFTVHRSPVTRVVLSEKYLISVCSEYSHVRTWSVTRFRGMISTQPGSTPLASFKVVSLEDLEPSASYP-----------------------------AGNDCGPYGEQDDEQVFIQKVVPETDQLYVRFASSGKRICVIKSVDGTTVTSFCVHECEGSNRMGSRPRRYIFTGHSSGAIQMWDLTTALD 707          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: V3ZYI6 (BTB domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_179235 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.009e-91
Identity = 204/651 (31.34%), Postives = 335/651 (51.46%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSL-DIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQI 3734
            +S++D+    FIDRDPK+F+V+LN+LRT ++     +++ ++L++EA FY I+PLV ++ L        CG++LF G +                        P R    + G+   N    +R              S   +S +  RA+ S   SV +++  +  + + +K      T   G     +VT+++ H  W+ + YP  V  Y   D  GW  +W S   ++              QI R   ++  +  N  +D ++     +VA +   ++ L+++                     +Y ++  F+ + S+D L F+G  L+A+S++    G W   ++ W    V   I  Y   +  F++LGC NG IY ++ QKFPLRM DN +L TE+++DPSND VTAL V+   +   SL  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + +V++SEK+L+S+C   NH+R+W ++RFRG I+TQPG+  LASF ++SL D +P+ S +                                D GP+    D  +F+QK++P+ D+LF+R + +G+RVC I S   + I+AF VH+ +    +       L TGH +GS++MW+LTT++DQ+
Sbjct:   39 SSLQDETGAIFIDRDPKIFAVVLNFLRTKEI--DLKNVEVSSLRHEAEFYGISPLVRRLVLCEDLDDASCGDVLFHGYLQ-----------------------PPRA---VGGNIRANDTSSNR-------------PSHSRNSSVDTRASHSHQGSVDLRSRGSHSDFSRVKGLDCPSTSPGGFVEPLRVTMVRGHHNWICMAYPHFVCCYRMKDSTGWHLIWLSPYMET--------------QIER--IAINAKVLNPNQDHSN----KMVAASFSNMIRLWNIT-----------------DDGEYREIGIFNLNVSVDSLFFIGSQLVALSQT-GKVGVWHSMTQHWQIQDV-VPITSYDT-AGSFLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYKDPSNDMVTALSVYLTPKT--SLSGNWIEIAYGTSSGTVRVIVQHPETVGHGPQLFQTFTVHRSPVTKVMLSEKHLVSVCSEYNHVRTWSVTRFRGMISTQPGSTPLASFKVISLEDQDPQASYS-----------------------------AGNDFGPFGEQDDQQVFVQKVVPETDQLFIRFSSSGQRVCVIKSVDSSTISAFCVHECEGSNRMGSRPRRYLFTGHANGSIQMWDLTTAMDQL 577          
BLAST of BTB domain-containing protein vs. TrEMBL
Match: A0A2C9JEX1 (BTB domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106055397 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 5.167e-91
Identity = 220/660 (33.33%), Postives = 339/660 (51.36%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSID--QIGNFETHHP 3758
            +S +D+    FIDRDPK+FSVILNYLRT ++  Q   +D +AL++EA FY IN LV ++ L      + CG++LF G   + +     +++VSN  QS          V+++   +     L R  S             R    I  RA    + +  +KN+        +++ S    Y D  P+  +VT+++ HQ W+   YP  V  Y   D  GW  +W S   +               Q+ R  A  A+  S+  E++NS     ++A +SG  V L++V                        ++  F    S+D L F+G  L+A+S +    G W   ++ W    V   I  Y   +  F++LGCE+G IY ++ QKFPLRM DN +L T+++ DP+ D VTAL V+   +   SL  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + +V++SEK+L+S+C   NH+R+W ++RFRG I+TQPG+  LASF ++SLD              LDS        ++ Y+          D GP+    D  LF+QK++   D+LF+R + TGKR+C I +     I++F VH+ +    +       L TGH +GS++MW+LTT++D  + GN +   P
Sbjct:   39 SSDKDETGAIFIDRDPKLFSVILNYLRTKEI--QLRKVDLSALRHEAEFYGINALVGRLALCEDLEHSSCGDVLFHG---YFQPPTPPLRSVSNLRQS---------VVSVDSGDSNRGSSLPRSTS-------------RERQSIAGRAGA--VTAGHLKNDIGHNSRKSVETVSAHGGYVD--PM--RVTMLRGHQNWICAAYPHFVCCYKMKDSTGWHLLWMSQHMEY--------------QVER-VALNAKVISSSQENSNS----KMIAASSGSTVWLWAVW-----------------DDGDSRQIGIFDLHVSVDNLFFIGSQLVALSRT-GKVGVWHSMTQHWQIQDV-VPITSYDT-AGSFLLLGCEDGSIYYIDMQKFPLRMKDNDLLVTQLYSDPACDMVTALSVYLTPKT--SLSGNWIEIAYGTSSGTVRVIVQHPETVGHGPQLFQTFTVHRSPVTKVMLSEKHLVSVCSEYNHVRTWNVTRFRGMISTQPGSTPLASFKIVSLD-------------DLDS--------LVSYSA-------GNDFGPFGEQDDQQLFVQKVVSNTDQLFIRQSATGKRICLIKAVDGSTISSFCVHECEGSNRMGSCPRRYLFTGHNNGSVQMWDLTTALDLYKQGNKDESGP 596          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: SHKBP1 (SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:103033845])

HSP 1 Score: 265.388 bits (677), Expect = 6.086e-74
Identity = 176/518 (33.98%), Postives = 272/518 (52.51%), Query Frame = 3
Query: 2241 LSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTD----GH-PVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSY-KENITAFAVHQ----SDIGGTVN--LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            ++ P  +   ++Q++   V+  +N    NL  S  L    T+    GH P    V I+  H  W+AV Y   V  Y   +  GW+ V+ S   +   +I + AL +K         SL   D              +VA+ASG  + L+++        P D N           ++  FS +  ++ L F+G  L+A S +    G W   ++ W N  V   IN Y   +  F+ILGC NG IY ++ QKFPLRM DN +L TE++RDPS D++TAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT +VHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  L SF ++SLD                        D+  +          T++GPY    +  +FIQ+++P  D+L+VRL+  GKRVC + S    +IT+F VH+    S IG      L +GH +GS++MW+LTT+++  G  +
Sbjct:  133 VAGPQYMGGRSAQLERAPVR-RSNTMPPNLGNSGILGKAVTEERVTGHGPDPGMVRIVCGHHNWIAVAYAQFVVCYRVKESTGWQQVFTSP--RLDWVIDRVALNAK-----VMGGSLGDNDK-------------MVAVASGTEIILWAI-------CP-DGN---------GNEIGVFSLNVPVEALFFVGNQLIATSHTG-KVGVWNAVTKHWQNQDV-VPINSYDT-AGSFLILGCNNGSIYYIDVQKFPLRMKDNDLLVTELYRDPSEDAITALSVYLTPKTSDS--GNWIEIAYGTSSGTVRVIVQHPETVGSGPQLFQTFSVHRSPVTKIMLSEKHLISVCADNNHVRTWTVTRFRGMISTQPGSTPLTSFKILSLD------------------------DIDGHGGCAA----GTEIGPYGERDEQQVFIQRVVPDTDKLYVRLSSNGKRVCEVRSVDGTSITSFVVHECEGSSRIGSRPRRYLFSGHSNGSIQMWDLTTAMEIAGKVD 579          

HSP 2 Score: 71.2478 bits (173), Expect = 6.822e-12
Identity = 35/77 (45.45%), Postives = 49/77 (63.64%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            ++++D+    FIDRDP +F+ ILN+LRT +L  +S  ID   L +EA FY I PLV K+ L      + CGN+LF G
Sbjct:   42 STLKDETGAIFIDRDPSLFAPILNFLRTKELHPRS--IDVHLLMHEAEFYGITPLVRKLQLCDELDRSSCGNVLFNG 116          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd3 (potassium channel tetramerization domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060503-169])

HSP 1 Score: 251.521 bits (641), Expect = 1.401e-70
Identity = 155/468 (33.12%), Postives = 243/468 (51.92%), Query Frame = 3
Query: 2367 GHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQI 3734
            G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S        I + AL +K              D            + +VA++S   + L+S+Q                       ++  F+    +D L F+G  L+A S +    G W   ++ W    V    +C +  S  F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TGKR+C + +     IT F V + +    +       L TGH +GS++MW+LTT++D +
Sbjct:   26 GSPVDPRKVLIVAGHHNWIVAAYAHFVICYRIKESSGWQQVFSSP--YLDWAIERVALNAK-------VVGGPHGD-----------KDKMVAVSSESRIILWSIQ-----------------DGGSGNEIGVFNLGVPVDSLFFIGSQLVATSHTG-KVGVWNAVTQHWQVQDVVPITSCDTAGS--FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPK--TSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKIISLE---------------------ETESHSSYSS-------GNDIGPFGERDDQQVFIQKVIPITNKLFVRLSSTGKRICEVQAVDCTTITCFTVRECEGSSRMGSRPRRYLFTGHANGSIQMWDLTTAMDTV 423          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: kctd3 (potassium channel tetramerization domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-060503-169])

HSP 1 Score: 251.906 bits (642), Expect = 4.594e-70
Identity = 155/468 (33.12%), Postives = 243/468 (51.92%), Query Frame = 3
Query: 2367 GHPVNS-QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQI 3734
            G PV+  +V I+  H  W+   Y   V  Y   + +GW+ V+ S        I + AL +K              D            + +VA++S   + L+S+Q                       ++  F+    +D L F+G  L+A S +    G W   ++ W    V    +C +  S  F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y+          D+GP+    D  +FIQK++P  ++LFVRL+ TGKR+C + +     IT F V + +    +       L TGH +GS++MW+LTT++D +
Sbjct:   94 GSPVDPRKVLIVAGHHNWIVAAYAHFVICYRIKESSGWQQVFSSP--YLDWAIERVALNAK-------VVGGPHGD-----------KDKMVAVSSESRIILWSIQ-----------------DGGSGNEIGVFNLGVPVDSLFFIGSQLVATSHTG-KVGVWNAVTQHWQVQDVVPITSCDTAGS--FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPK--TSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKIISLE---------------------ETESHSSYSS-------GNDIGPFGERDDQQVFIQKVIPITNKLFVRLSSTGKRICEVQAVDCTTITCFTVRECEGSSRMGSRPRRYLFTGHANGSIQMWDLTTAMDTV 491          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:103030561])

HSP 1 Score: 117.857 bits (294), Expect = 3.337e-26
Identity = 102/318 (32.08%), Postives = 157/318 (49.37%), Query Frame = 3
Query:  102 YTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN-KSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRC-VNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQ----SDFQPERL---PLDTSSFRIHYNWENTGP-PRPEGEQER 995
            + + LK+   L  H GCVNT++W+ +G  ILSG DD  L I         P+ +     I   +  NI SAKFMP+ N+ QIVS S  G I+      +   N++   F  H G    I T  ++ + F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L  ++  N     +  T +C  ++F +   +SN+S        C V S+ +    G  +LVSY  D IYLFD +  + R+    S+ + E L   P+     R+  +W +TGP  RPE E+ER
Sbjct:   34 FVQRLKLEAILNVHDGCVNTISWNDTGEYILSGSDDTNLVI-------TNPYNRKVKTTIRSGHRANIFSAKFMPLTNDQQIVSCSGDGIIYYTHTEKSADINRQCQ-FTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLGTRATGNYMG--RGTTGMC--VRF-VPAHLSNKS--------CRVTSLCYSGD-GQEVLVSYSSDYIYLFDPKDDQARELKGPSEERREELRQPPV--KRLRLRGDWSDTGPRARPESERER 327          

HSP 2 Score: 86.6557 bits (213), Expect = 1.426e-16
Identity = 45/158 (28.48%), Postives = 82/158 (51.90%), Query Frame = 3
Query: 1101 KSVKRYKEVQIYVGHQNCRTME*DVSHPAHLGITHQ*RDWSCIS*KIKDSKFWGTKYILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTENAKGCQSMSMLDLLRVI 1574
            ++++R     +Y GH+N RTM                         IK+S FWG  +++SGS+CGH+ +W++ +   +M +  D  V N ++PHP+ PI+A+ GIDY++K+     Q   SP   +   E+++ +NE   E  +   ++    +LR++
Sbjct:  783 QNIRRPLVKMMYKGHRNSRTM-------------------------IKESCFWGNNFVMSGSDCGHIFIWDRHTGEHLMLLEADNHVVNCLQPHPYDPILASSGIDYDIKLWSPLEQ---SPSFNRDLAEEVIARNELMLEETRNTITVPASFMLRML 912          
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:103030561])

HSP 1 Score: 117.472 bits (293), Expect = 3.754e-26
Identity = 102/318 (32.08%), Postives = 157/318 (49.37%), Query Frame = 3
Query:  102 YTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNN-QIVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN-KSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRC-VNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQ----SDFQPERL---PLDTSSFRIHYNWENTGP-PRPEGEQER 995
            + + LK+   L  H GCVNT++W+ +G  ILSG DD  L I         P+ +     I   +  NI SAKFMP+ N+ QIVS S  G I+      +   N++   F  H G    I T  ++ + F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L  ++  N     +  T +C  ++F +   +SN+S        C V S+ +    G  +LVSY  D IYLFD +  + R+    S+ + E L   P+     R+  +W +TGP  RPE E+ER
Sbjct:   34 FVQRLKLEAILNVHDGCVNTISWNDTGEYILSGSDDTNLVI-------TNPYNRKVKTTIRSGHRANIFSAKFMPLTNDQQIVSCSGDGIIYYTHTEKSADINRQCQ-FTCHYGTAYEIMTVPNDPYTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLGTRATGNYMG--RGTTGMC--VRF-VPAHLSNKS--------CRVTSLCYSGD-GQEVLVSYSSDYIYLFDPKDDQARELKGPSEERREELRQPPVK--RLRLRGDWSDTGPRARPESERER 327          

HSP 2 Score: 86.2705 bits (212), Expect = 1.430e-16
Identity = 46/158 (29.11%), Postives = 85/158 (53.80%), Query Frame = 3
Query: 1101 KSVKRYKEVQIYVGHQNCRTME*DVSHPAHLGITHQ*RDWSCIS*KIKDSKFWGTKYILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTENAKGCQSMSMLDLLRVI 1574
            ++++R     +Y GH+N RTM                         IK+S FWG  +++SGS+CGH+ +W++ +   +M +  D  V N ++PHP+ PI+A+ GIDY++K+  S L+  +SP   +   E+++ +NE   E  +   ++    +LR++
Sbjct:  763 QNIRRPLVKMMYKGHRNSRTM-------------------------IKESCFWGNNFVMSGSDCGHIFIWDRHTGEHLMLLEADNHVVNCLQPHPYDPILASSGIDYDIKLW-SPLE--QSPSFNRDLAEEVIARNELMLEETRNTITVPASFMLRML 892          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO48579 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIW2])

HSP 1 Score: 251.136 bits (640), Expect = 1.874e-71
Identity = 135/341 (39.59%), Postives = 205/341 (60.12%), Query Frame = 3
Query: 2742 KYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYK-ENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQ 3731
            K+E +  F     +D L F+G  L+  S +    G W   S+ W    V   I+ Y   +  F++LGC NG IY ++ QKFPLRM DN +L TE+++DP+ D VTAL ++   + C  L  N +EIAYGT++G +R++VQH   VG+GP++FQT TVHR+ +IRV++SE++L+S+C   NH+R+W ++RFRG I+TQPG+  LASF+++SL+             + DS    T  +                +GP+    D  +FIQK++P  D + VRL+ TGKR+C I S    NI+ + VH+ D    +       L+TGHE+GS++MW+LTT+++Q
Sbjct:  189 KFE-IGTFDLTVPVDTLFFIGSQLVGTSHT-GKVGVWNSMSQHWQIQDV-VPISSYD-KAGSFLLLGCSNGSIYYIDMQKFPLRMKDNDLLVTELYKDPNGDMVTALSMYLTPKTC--LSGNWIEIAYGTSAGTVRVIVQHPETVGQGPQLFQTFTVHRSPVIRVMLSERHLVSVCSEYNHVRTWNVTRFRGMISTQPGSTPLASFNVVSLE-------------ETDSHPSYTAGNA---------------LGPFGDRDDQQVFIQKIVPDTDHVHVRLSSTGKRICTIRSVDGSNISCYFVHECDGSSRMGSRPRRYLVTGHENGSIQMWDLTTALEQ 495          

HSP 2 Score: 69.707 bits (169), Expect = 5.418e-12
Identity = 33/77 (42.86%), Postives = 46/77 (59.74%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            +S+RD+    FIDRDP  F  ILN++RT +L      +D   +K+EA FY I PLV +I L      + CG++LF G
Sbjct:   42 SSLRDETGAIFIDRDPDAFVPILNFMRTKEL--DPRGLDLRVIKHEAEFYGITPLVKRITLCEEVSSSKCGDVLFHG 116          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO29936 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T282])

HSP 1 Score: 77.0258 bits (188), Expect = 3.217e-14
Identity = 76/287 (26.48%), Postives = 123/287 (42.86%), Query Frame = 3
Query:   87 HDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIP---------FLKMNLPCSLSA----IAIHPLCSYKIAIGGSDSCVRVFDKRYLNK--------------SFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFD 866
            H    + E L + ++LEGH GCVN +   +SG  + SG DD    I + LS + K  V      I+  ++ NI S KF+P   ++I++ +   +   +     N+   V++ H G    +A   +      +AS D T   FD+R+ +             + +N+  S  A    IAI+PL    +AIG +D  VR++D R L K               F   E  + Y      P +   D     R+ +  Y       V+F P  G+ +L +   + +YLFD
Sbjct:   28 HVYPPFVERLGLEKELEGHTGCVNCLELTESGELLASGSDDLNAIIWEPLS-YKKKCV------IATGHTGNIFSIKFLPCTGDRIIATAAADTKVRIHSVEKNETTQVYHCHIGRVKRLAVAPNMPSLVWSASEDGTIRQFDLRQPHCCNSNSKNCNNVLINLNVHSSALAEPKCIAINPLRPNMMAIGCNDPFVRIYDHRMLAKYNLDIRTSGAQNPEDFTLPEGCVTYFAPGHLPPRLTRDFPKKFRTYVATY-------VTFSPD-GSEVLTNMGGEQVYLFD 299          

HSP 2 Score: 52.373 bits (124), Expect = 1.252e-6
Identity = 31/107 (28.97%), Postives = 56/107 (52.34%), Query Frame = 3
Query: 1239 IKDSKFWG--TKYILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTENAKGCQSMSM 1553
            IK++ F+G   +YI++GS+ G   +W++++   I  +  D+ + N ++PHP + I+AT GID  +++             K   +E     N+RR  NA   + M M
Sbjct:  547 IKEANFFGDNGQYIVAGSDDGSFFMWDRNTTNLIRVLKGDDSIVNCLQPHPSVCILATSGIDPVIRLWSPRPVDGSGDTRKVDELEAAARANQRRM-NADPLEVMLM 652          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO39961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8L6])

HSP 1 Score: 71.2478 bits (173), Expect = 1.153e-12
Identity = 68/274 (24.82%), Postives = 111/274 (40.51%), Query Frame = 3
Query:   93 SASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYN-NQIVSASKCGSIFL--VDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFL----KMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRL--------GNHILVSYMYDSIYLFDT 869
            S    + LK+   L+ H GCVNT+ +  +G  + SG DD  + I     DW K   K  V      ++ N+  AKFMP  + + +VS ++ G + +  +    T+K      +H G    ++      + F T   D      D+RE             +    L  I ++P    + A+GG D   R++D+R L                       P D+K+ N  P+  Y    ++   F   +        G+ +LVSY  + IYLFD+
Sbjct:   73 STGLVQRLKLHSNLKYHDGCVNTLHYSPTGELLASGSDDLDIVIW----DWAK---KKKVLHYESGHASNVFQAKFMPFSSESTLVSCARDGQVRVGFLSSTGTSKGTKKLSQHRGAAHKLSIEPGSPWTFFTCGEDGVVFQVDLREDKAQKLFCCRASEHKKVPLYTIYVNPSNINEFAVGGRDQFARIYDRRKL-----------------------PEDSKV-NAEPVKQYCPHHLDGNDFFANITCLVYSHDGSELLVSYNDEDIYLFDS 315          

HSP 2 Score: 61.6178 bits (148), Expect = 1.282e-9
Identity = 27/68 (39.71%), Postives = 47/68 (69.12%), Query Frame = 3
Query: 1239 IKDSKFWG--TKYILSGSECGHVLVWEKDSKYPIMAIPTDER-VTNRIEPHPFLPIIATCGIDYNVKI 1433
            +K   F+G  +++++SGS+CGHV +W+K ++  +  +  D   V N +EPHP  P++AT G+D++VKI
Sbjct:  336 VKGVNFYGPESEFVVSGSDCGHVFLWDKQTEEIVNFLDADATGVVNCLEPHPSAPVLATSGLDHDVKI 403          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO28293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWN2])

HSP 1 Score: 62.7734 bits (151), Expect = 1.204e-11
Identity = 42/115 (36.52%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  108 ENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVNSTNKELNVFYK-HSGPTLNI 446
            + LK    L GH GCVNT+AW + G  +LSG DD  L I+       +P     V  I   +  NI SAKFMP  NN+ IVS +  G +   +++        FY  H+G T  +
Sbjct:    7 QCLKRSGTLSGHDGCVNTIAWSECGELLLSGSDDCRLNIY-------RPCENKLVQCIRSGHRANIFSAKFMPCSNNKWIVSCAGDGMLQFTNLDRPEMIGTCFYNCHTGTTYEV 114          
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Match: EDO31891 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWN2])

HSP 1 Score: 62.7734 bits (151), Expect = 1.204e-11
Identity = 42/115 (36.52%), Postives = 57/115 (49.57%), Query Frame = 3
Query:  108 ENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVNSTNKELNVFYK-HSGPTLNI 446
            + LK    L GH GCVNT+AW + G  +LSG DD  L I+       +P     V  I   +  NI SAKFMP  NN+ IVS +  G +   +++        FY  H+G T  +
Sbjct:    7 QCLKRSGTLSGHDGCVNTIAWSECGELLLSGSDDCRLNIY-------RPCENKLVQCIRSGHRANIFSAKFMPCSNNKWIVSCAGDGMLQFTNLDRPEMIGTCFYNCHTGTTYEV 114          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: SHKBP1 (SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:101169052])

HSP 1 Score: 293.893 bits (751), Expect = 1.256e-83
Identity = 210/658 (31.91%), Postives = 323/658 (49.09%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKS---KSLDFTYTDGHPVNSQVTIIKC-HQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKEN-ITAFAVHQ----SDIGGTVN--LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            ++++D+    FIDRDP +F+ ILN+LRT +L  +S  I+   L +EA FY I PLV K+ L      + CGN+LF G                         LP   S     +R  +SV      +   F    ++ ++R  +P++                +N    NL  +   +S +     G   ++ +  I C H  W+AV Y   V  Y   +  GW+ V+ S   +   +I + AL       R    SL   D              +VA+AS              V   I + + P  +     ++  FS +   + L F+G  L+A S +    G W   ++ W N  V   I+ Y   +  F+ILGC NG IY ++ QKFPLRM DN +L TE++RDP+ D++TAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT +VHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  L SF ++SLD              +D     +                 T++GPY    D  +FIQ+++P  D+L+VRL+  GKRVC + S     ITAF VH+    S IG      L +GH +GS++MW+LTT+++  G  +
Sbjct:   44 STLKDETGAIFIDRDPSLFAPILNFLRTKELYPRS--INVHLLVHEAEFYGITPLVRKLQLCDELDRSSCGNVLFNG------------------------YLPPPVSPAKRRNR--HSV------AGPQFMMGRAVAAER--APVR---------------RSNTMPPNLGGAGILRSCEERAPTGGSADAGMVRIICGHYNWIAVAYAQFVVCYRMKESTGWQQVFTSP--RLDWMIDRVAL-----NARVMGGSLGDNDK-------------MVAVAS--------------VTEIILWAICPDGNG---NEIGVFSLNVPAEALFFVGNQLIATSHTG-KIGVWNAVTKHWQNQDV-VPISSYDT-AGSFLILGCNNGSIYYIDVQKFPLRMKDNDLLVTELYRDPTEDAITALSVYLTPKTSDS--GNWIEIAYGTSSGTVRVIVQHPETVGSGPQLFQTFSVHRSPVTKIMLSEKHLISVCADNNHVRTWTVTRFRGMISTQPGSTPLTSFKILSLD-------------DVDGHGGCST---------------GTEIGPYGERDDQQVFIQRVVPDTDKLYVRLSSNGKRVCEVRSVDGTPITAFVVHECEGSSRIGSRPRRYLFSGHGNGSIQMWDLTTAMEIAGKVD 580          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: kctd3 (potassium channel tetramerization domain containing 3 [Source:NCBI gene;Acc:101170829])

HSP 1 Score: 246.514 bits (628), Expect = 1.387e-67
Identity = 154/465 (33.12%), Postives = 233/465 (50.11%), Query Frame = 3
Query: 2385 QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSY-KENITAFAVHQSDIGGTVN------LITGHEDGSLEMWNLTTSIDQIGNFE 3746
            +V II  H  W+   Y   V  Y   +  GW+ V+ S                  P +      +A     V         + +VA AS   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V    +C +  S  F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S+  N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y           D+GP+    D  +FIQK++P  ++LFVRL+ TGKR+C + S     IT F V + +    +       L TG  +GS++MW+LTT++D     E
Sbjct:  177 KVLIIAGHHNWIVAAYAHFVICYRIKESTGWQQVFSS------------------PYLDWTIERIALNAKVVGGPHGD--KDKMVAAASDSRIILWSIQ-----------------DGGSGNEIGIFSLGVPVDDLFFIGNQLVATSHTG-KVGVWNAVTQHWQVQDVVPITSCDTAGS--FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPK--TSVSGNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------ETESHGSYCS-------GNDIGPFGERDDQQVFIQKVIPITNKLFVRLSSTGKRICEVQSVDGTTITCFMVRECEGSSRMGSRPRRYLFTGQGNGSIQMWDLTTAMDTANKGE 571          

HSP 2 Score: 67.0106 bits (162), Expect = 1.243e-10
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            +++RD+    FIDRDP  F+ ILN+LRT +L      ++ + L++EA FY I PLV ++ L      + CG++LF G
Sbjct:   49 STLRDETGAIFIDRDPTAFAPILNFLRTKEL--DLRGVNISVLRHEAEFYGITPLVRRLLLCEELDRSSCGSVLFHG 123          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: kctd3 (potassium channel tetramerization domain containing 3 [Source:NCBI gene;Acc:101170829])

HSP 1 Score: 219.55 bits (558), Expect = 2.354e-61
Identity = 136/406 (33.50%), Postives = 203/406 (50.00%), Query Frame = 3
Query: 2385 QVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYT---DHMLFIQKLLPQCDRLFVRLAPTGKR 3590
            +V II  H  W+   Y   V  Y   +  GW+ V+ S                  P +      +A     V         + +VA AS   + L+S+Q                       ++  FS    +D L F+G  L+A S +    G W   ++ W    V    +C +  S  F++LGC NG IY ++ QKFPLRM DN +L TE++ DPSND++TAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT TVHR+ + ++++SEK+L+S+C + NH+R+W ++RFRG I+TQPG+  LASF ++SL+                       E    Y           D+GP+    D  +FIQK++P  ++LFVRL+ TGKR
Sbjct:  150 KVLIIAGHHNWIVAAYAHFVICYRIKESTGWQQVFSS------------------PYLDWTIERIALNAKVVGGPHGD--KDKMVAAASDSRIILWSIQ-----------------DGGSGNEIGIFSLGVPVDDLFFIGNQLVATSHT-GKVGVWNAVTQHWQVQDVVPITSCDTAGS--FLLLGCNNGSIYYIDMQKFPLRMKDNDLLVTELYHDPSNDAITALSVYLTPKTSVS--GNWIEIAYGTSSGAVRVIVQHPETVGSGPQLFQTFTVHRSPVTKIMLSEKHLVSVCADNNHVRTWTVTRFRGMISTQPGSTPLASFKILSLE---------------------ETESHGSYCS-------GNDIGPFGERDDQQVFIQKVIPITNKLFVRLSSTGKR 485          

HSP 2 Score: 64.6994 bits (156), Expect = 3.690e-10
Identity = 31/77 (40.26%), Postives = 48/77 (62.34%), Query Frame = 3
Query: 1818 NSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQG 2048
            +++RD+    FIDRDP  F+ ILN+LRT +L      ++ + L++EA FY I PLV ++ L      + CG++LF G
Sbjct:   39 STLRDETGAIFIDRDPTAFAPILNFLRTKEL--DLRGVNISVLRHEAEFYGITPLVRRLLLCEELDRSSCGSVLFHG 113          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: SHKBP1 (SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:101169052])

HSP 1 Score: 203.371 bits (516), Expect = 1.397e-55
Identity = 122/330 (36.97%), Postives = 181/330 (54.85%), Query Frame = 3
Query: 2388 VTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHA-GVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLD 3374
            V II  H  W+AV Y   V  Y   +  GW+ V+ S   +   +I + AL       R    SL   D              +VA+AS              V   I + + P  +     ++  FS +   + L F+G  L+A S +    G W   ++ W N  V   I+ Y   +  F+ILGC NG IY ++ QKFPLRM DN +L TE++RDP+ D++TAL V+   +   S   N +EIAYGT+SG +R++VQH   VG GP++FQT +VHR+ + ++++SEK+LIS+C + NH+R+W ++RFRG I+TQPG+  L SF ++SLD
Sbjct:  155 VRIICGHYNWIAVAYAQFVVCYRMKESTGWQQVFTSP--RLDWMIDRVAL-----NARVMGGSLGDNDK-------------MVAVAS--------------VTEIILWAICPDGNG---NEIGVFSLNVPAEALFFVGNQLIATSHTG-KIGVWNAVTKHWQNQDV-VPISSYDT-AGSFLILGCNNGSIYYIDVQKFPLRMKDNDLLVTELYRDPTEDAITALSVYLTPKTSDS--GNWIEIAYGTSSGTVRVIVQHPETVGSGPQLFQTFSVHRSPVTKIMLSEKHLISVCADNNHVRTWTVTRFRGMISTQPGSTPLTSFKILSLD 442          
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Match: dcaf6 (DDB1 and CUL4 associated factor 6 [Source:NCBI gene;Acc:101156538])

HSP 1 Score: 127.872 bits (320), Expect = 1.911e-29
Identity = 105/330 (31.82%), Postives = 159/330 (48.18%), Query Frame = 3
Query:   60 NSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQ-IVSASKCGSIFLVDVNST---NKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPF------LKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLN-KSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRC-VNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQ-----SDFQPERLPLDTSSFRIHYNWENTGP-PRPEGEQER 995
            N R +S F  +   + + LK+   L  H GCVNT++W+++G  ILSG DD  L I         P+ K     I   +  NI SAKFMP  N+Q I+S S  G I+      +   N++   F  H G    I T  ++   F +   D T   FD+R   +         + +N   + ++I+I PL  Y +A+G SDS VR++D+R L  ++  N   T +  T +C  ++F +   +SN+S        C V S+ +    G  +LVSY  D IYLFD +  + R+      D + E         R+  +W +TGP  RPE E+ER
Sbjct:   21 NPRGRSVFLSERREFVQRLKLESTLNVHDGCVNTISWNETGEYILSGSDDTFLVI-------TNPYNKKVKTSIRSGHRANIFSAKFMPHTNDQEIISCSGDGIIYYTHTEKSPEHNRQCQ-FTCHYGTAYEIMTVPNDPCTFLSCGEDGTVRWFDLRMKTSCTKEDCKDDILINCRRAATSISISPLVPYYLAVGCSDSSVRIYDRRMLGTRATGNY--TGRGTTGMC--VRF-VPAHLSNKS--------CRVTSLCYS-EDGQEVLVSYSSDYIYLFDPKDDQARELKGPSEDRREELRQPPVKRLRLRGDWSDTGPRARPESERER 328          

HSP 2 Score: 87.4261 bits (215), Expect = 6.841e-17
Identity = 49/170 (28.82%), Postives = 86/170 (50.59%), Query Frame = 3
Query: 1101 KSVKRYKEVQIYVGHQNCRTME*DVSHPAHLGITHQ*RDWSCIS*KIKDSKFWGTKYILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPI-KSPEEKQAYVEKIVNQNERRTENAKGCQS------MSMLDLLRVIRAQRM 1589
            ++++R     +Y GH+N RTM                         IK+S FWG  +++SGS+CGH+ +W++ +   +M +  D  V N ++PHP+ PI+A+ GIDY++KI      P+ +SP   +    +++ +NE   E  +   +      + ML  L  IR+ R+
Sbjct:  640 QNIRRPSVKMVYKGHRNSRTM-------------------------IKESCFWGNNFVMSGSDCGHIFIWDRHTAEHLMLLEADNHVVNCLQPHPYDPILASSGIDYDIKI----WSPLEESPSFNRQLAVEVITRNELMLEETRNTITVPASFMLRMLASLNHIRSDRL 780          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000001053.1 (SMESG000001053.1)

HSP 1 Score: 1581.62 bits (4094), Expect = 0.000e+0
Identity = 787/791 (99.49%), Postives = 789/791 (99.75%), Query Frame = 3
Query: 1710 SKSSQIVKLNXXXXXXXXXXXXXXXXXXXXXXXXIHNSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHAGVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYTDHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKENITAFAVHQSDIGGTVNLITGHEDGSLEMWNLTTSIDQIGNFETHHPPTAAASVLSGHGTHCSREDGDNNEQTRVLMGFRFYPSLDEPSENGPTPRELFCMLRDYDIALDDTSERSIKLTQCISYQSLHSEVSSKNSTIQRLHRSSQVKCNQPSF 4082
            SKSSQIVKLNVGGQLFVTTQQTLLLHHSTFFSSLIHNSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEEL  RTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQI+SVSVKN+TNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHAGVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYTDHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKENITAFAVHQSDIGGTVNLITGHEDGSLEMWNLTTSIDQIGNFETHHPPTAAASVLSGHGTHCSREDGDNNEQTRVLMGFRFYPSLDEPSENGPTPRELFCMLRDYDIALDDTSERSIKLTQCISYQSLHSEVSSKNSTIQRLHRSSQVKCNQPSF
Sbjct:    3 SKSSQIVKLNVGGQLFVTTQQTLLLHHSTFFSSLIHNSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELLPRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIESVSVKNQTNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHAGVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYTDHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKENITAFAVHQSDIGGTVNLITGHEDGSLEMWNLTTSIDQIGNFETHHPPTAAASVLSGHGTHCSREDGDNNEQTRVLMGFRFYPSLDEPSENGPTPRELFCMLRDYDIALDDTSERSIKLTQCISYQSLHSEVSSKNSTIQRLHRSSQVKCNQPSF 793          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000001053.1 (SMESG000001053.1)

HSP 1 Score: 1236.09 bits (3197), Expect = 0.000e+0
Identity = 623/628 (99.20%), Postives = 626/628 (99.68%), Query Frame = 3
Query: 1710 SKSSQIVKLNXXXXXXXXXXXXXXXXXXXXXXXXIHNSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKNETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHAGVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYTDHMLFIQKLLPQCDRLFVRLAPTGKRV 3593
            SKSSQIVKLNVGGQLFVTTQQTLLLHHSTFFSSLIHNSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEEL  RTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQI+SVSVKN+TNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHAGVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYTDHMLFIQKLLPQCDRLFVRLAPTGKR+
Sbjct:    3 SKSSQIVKLNVGGQLFVTTQQTLLLHHSTFFSSLIHNSIRDDDNEFFIDRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLISFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELLPRTSVTLNGHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIESVSVKNQTNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLYWHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVTEDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEKLSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQINCYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSVTALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHAGVGEGPKIFQTLTVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLASFHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMGPYTDHMLFIQKLLPQCDRLFVRLAPTGKRL 630          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000073620.1 (SMESG000073620.1)

HSP 1 Score: 1017.68 bits (2630), Expect = 0.000e+0
Identity = 492/518 (94.98%), Postives = 493/518 (95.17%), Query Frame = 3
Query:   36 MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME*DVSHPAHLGITHQ*RDWSCIS*KIKDSKFWGTKYILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTENAKGCQSMSMLDLLRVIRAQRM 1589
            MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM                         IKDSKFWGTKYILSGSECGH+LVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTENAKGCQSMSMLDLLRVIRAQRM
Sbjct:    1 MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM-------------------------IKDSKFWGTKYILSGSECGHILVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTENAKGCQSMSMLDLLRVIRAQRM 493          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000073620.1 (SMESG000073620.1)

HSP 1 Score: 1000.73 bits (2586), Expect = 0.000e+0
Identity = 485/511 (94.91%), Postives = 486/511 (95.11%), Query Frame = 3
Query:   57 MNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME*DVSHPAHLGITHQ*RDWSCIS*KIKDSKFWGTKYILSGSECGHVLVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTENAKGCQSMSMLDLLRVIRAQRM 1589
            MNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM                         IKDSKFWGTKYILSGSECGH+LVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTENAKGCQSMSMLDLLRVIRAQRM
Sbjct:    1 MNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTM-------------------------IKDSKFWGTKYILSGSECGHILVWEKDSKYPIMAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAYVEKIVNQNERRTENAKGCQSMSMLDLLRVIRAQRM 486          
BLAST of BTB domain-containing protein vs. Planmine SMEST
Match: SMESG000073620.1 (SMESG000073620.1)

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 377/377 (100.00%), Postives = 377/377 (100.00%), Query Frame = 3
Query:   36 MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME 1166
            MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME
Sbjct:    1 MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGTKILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYNNQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATASNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCVRVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRCVNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSFRIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFTIESQLKSVKRYKEVQIYVGHQNCRTME 377          
The following BLAST results are available for this feature:
BLAST of BTB domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCTD32.187e-8130.23potassium channel tetramerization domain containin... [more]
SHKBP13.754e-6933.19SH3KBP1 binding protein 1 [Source:HGNC Symbol;Acc:... [more]
SHKBP12.167e-6339.55SH3KBP1 binding protein 1 [Source:HGNC Symbol;Acc:... [more]
SHKBP12.376e-5434.62SH3KBP1 binding protein 1 [Source:HGNC Symbol;Acc:... [more]
SHKBP11.066e-4251.88SH3KBP1 binding protein 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T23B12.62.479e-8231.03pep chromosome:WBcel235:V:8457616:8460419:-1 gene:... [more]
adpr-14.816e-932.48ADiPose (Drosophila obesity gene) Related [Source... [more]
adpr-11.239e-832.48ADiPose (Drosophila obesity gene) Related [Source... [more]
adpr-11.412e-832.48ADiPose (Drosophila obesity gene) Related [Source... [more]
adpr-11.617e-832.48ADiPose (Drosophila obesity gene) Related [Source... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG94672.743e-9032.22gene:FBgn0037758 transcript:FBtr0082156[more]
adp3.044e-1628.26gene:FBgn0000057 transcript:FBtr0340288[more]
adp3.044e-1628.26gene:FBgn0000057 transcript:FBtr0086744[more]
CG80011.007e-1125.52gene:FBgn0035268 transcript:FBtr0072774[more]
CG80011.007e-1125.52gene:FBgn0035268 transcript:FBtr0334073[more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kctd31.182e-8230.05potassium channel tetramerization domain containin... [more]
SHKBP16.874e-7335.78SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:56... [more]
kctd37.272e-7033.33potassium channel tetramerization domain containin... [more]
kctd31.306e-6933.33potassium channel tetramerization domain containin... [more]
kctd32.977e-6933.33potassium channel tetramerization domain containin... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCTD31.234e-6933.26potassium channel tetramerization domain containin... [more]
KCTD31.746e-6933.47potassium channel tetramerization domain containin... [more]
KCTD32.280e-6933.47potassium channel tetramerization domain containin... [more]
KCTD38.860e-6933.47potassium channel tetramerization domain containin... [more]
SHKBP12.281e-6633.55SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kctd31.045e-8130.23potassium channel tetramerisation domain containin... [more]
Kctd36.287e-7430.20potassium channel tetramerisation domain containin... [more]
Shkbp15.835e-6932.77Sh3kbp1 binding protein 1 [Source:MGI Symbol;Acc:M... [more]
Dcaf63.967e-2631.31DDB1 and CUL4 associated factor 6 [Source:MGI Symb... [more]
Dcaf8l1.196e-1626.62DDB1 and CUL4 associated factor 8 like [Source:MGI... [more]
back to top
BLAST of BTB domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BFX3|KCTD3_MOUSE7.309e-8130.23BTB/POZ domain-containing protein KCTD3 OS=Mus mus... [more]
sp|Q9Y597|KCTD3_HUMAN1.050e-8030.23BTB/POZ domain-containing protein KCTD3 OS=Homo sa... [more]
sp|P0C5J9|SHKB1_RAT5.856e-7328.94SH3KBP1-binding protein 1 OS=Rattus norvegicus OX=... [more]
sp|Q8TBC3|SHKB1_HUMAN1.803e-6833.19SH3KBP1-binding protein 1 OS=Homo sapiens OX=9606 ... [more]
sp|A3KMV1|SHKB1_BOVIN2.216e-6833.33SH3KBP1-binding protein 1 OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of BTB domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QXL71.501e-9432.62BTB/POZ domain-containing protein KCTD3 OS=Crassos... [more]
A0A224Z6E21.798e-9231.91Protein containing BTB2 domain OS=Rhipicephalus za... [more]
A0A131Z3641.798e-9231.91BTB domain-containing protein OS=Rhipicephalus app... [more]
V3ZYI61.009e-9131.34BTB domain-containing protein OS=Lottia gigantea O... [more]
A0A2C9JEX15.167e-9133.33BTB domain-containing protein OS=Biomphalaria glab... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SHKBP16.086e-7433.98SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:10... [more]
kctd31.401e-7033.12potassium channel tetramerization domain containin... [more]
kctd34.594e-7033.12potassium channel tetramerization domain containin... [more]
dcaf63.337e-2632.08DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
dcaf63.754e-2632.08DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of BTB domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO485791.874e-7139.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO299363.217e-1426.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399611.153e-1224.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282931.204e-1136.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318911.204e-1136.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of BTB domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SHKBP11.256e-8331.91SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:10... [more]
kctd31.387e-6733.12potassium channel tetramerization domain containin... [more]
kctd32.354e-6133.50potassium channel tetramerization domain containin... [more]
SHKBP11.397e-5536.97SH3KBP1 binding protein 1 [Source:NCBI gene;Acc:10... [more]
dcaf61.911e-2931.82DDB1 and CUL4 associated factor 6 [Source:NCBI gen... [more]
back to top
BLAST of BTB domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001053.10.000e+099.49SMESG000001053.1[more]
SMESG000001053.10.000e+099.20SMESG000001053.1[more]
SMESG000073620.10.000e+094.98SMESG000073620.1[more]
SMESG000073620.10.000e+094.91SMESG000073620.1[more]
SMESG000073620.10.000e+0100.00SMESG000073620.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026133 ID=SMED30026133|Name=BTB domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4123bp
TTTTTTTTAAAAGATTTAATGTTTAAAACTTCCGAATGTTAACACATTGG
CGTTTTATGAATTCTAGAAGTAAATCATCGTTTTATCATGATTCTGCATC
ATATACAGAAAATCTTAAAGTATTTGAAAAGTTAGAAGGTCACAGAGGCT
GTGTTAATACAGTGGCTTGGGATAAGAGTGGTACAAAGATTTTATCTGGT
GGAGATGATGCAATTTTACGCATTCATCAATTTTTATCTGATTGGGATAA
ACCATGGGTTAAAGACCATGTATATGAAATCTCTTTACCCAATTCACGAA
ATATATTGAGCGCTAAATTCATGCCAATTTATAACAATCAAATAGTTTCT
GCTTCAAAATGCGGTTCAATATTTCTCGTCGATGTCAATAGTACCAACAA
GGAATTAAATGTTTTTTATAAGCATTCTGGACCTACACTAAATATTGCTA
CATTTGAAGACGAAGCATTTAATTTTGCAACCGCGAGCAATGATAAAACC
TTTTGCATTTTCGATATTCGTGAATCGAATAATATACCATTTTTAAAAAT
GAATTTACCGTGCTCCTTATCCGCCATAGCAATTCATCCATTATGTTCTT
ATAAAATTGCAATTGGTGGAAGTGATAGTTGTGTCAGAGTTTTCGATAAA
AGATATTTAAACAAAAGCTTTAACAATGTTGAAAAAACATTAAAGTACGT
TACAGAAATTTGTAGGCCTCTTCAGTTTCCAATAGATAATAAGATATCGA
ATCGAAGCCCACTTTATAATTATGGAAGACGATGTGTAAATAGCGTGAGT
TTTGAACCGCGTTTAGGAAATCATATATTAGTTAGTTACATGTATGATTC
AATATATTTGTTTGATACAAGACAGCAAGAAAATCGTCAATCTGATTTTC
AACCAGAACGATTACCTTTAGATACAAGTTCATTTCGAATTCATTATAAT
TGGGAAAATACTGGACCACCTAGACCTGAGGGAGAGCAAGAACGAGGTGA
CATTATTTGCCCGCCATCTATTCAATCATTTTTAGATGATCTACAACTAA
ATGAATCCAGTTATGAATCAAAAATTGATTTTACAATCGAATCGCAGTTA
AAATCAGTTAAAAGGTATAAAGAAGTTCAGATATATGTTGGTCATCAGAA
CTGTCGAACAATGGAATAAGATGTGAGTCATCCAGCACATTTGGGTATTA
CTCACCAGTGAAGGGATTGGTCATGCATTAGTTAAAAAATTAAAGATTCT
AAATTTTGGGGAACTAAATACATACTCAGTGGTTCGGAATGTGGTCACGT
TTTAGTTTGGGAAAAAGACAGTAAATATCCAATAATGGCAATACCAACAG
ATGAAAGAGTTACTAATCGAATCGAACCTCATCCATTTTTACCAATAATA
GCAACATGCGGGATCGATTATAATGTAAAGATCGTTGGATCAACTCTTCA
ACCTATAAAATCACCCGAAGAAAAACAGGCATATGTTGAAAAAATTGTTA
ATCAAAATGAACGAAGAACTGAAAATGCCAAAGGCTGTCAGAGTATGTCG
ATGCTTGACTTACTAAGAGTTATTAGAGCTCAAAGAATGATTAACAGAAT
AAATAGTGGAATTTCTGGATCAGATATTAACATTAATTAAATTTATATAT
ATATATATATTGTTTTTATGAAGTTAATGAATAAATTAAATTTTTGATAA
AACATGCTTTCAAAATCTTCTCAAATCGTTAAACTTAATGTAGGTGGTCA
ATTGTTTGTTACTACACAACAAACGTTACTCCTTCATCATTCTACATTCT
TTTCAAGCTTAATTCATAATTCAATAAGAGATGATGACAATGAATTTTTT
ATTGACCGAGATCCAAAAATGTTTTCAGTGATTTTAAATTACTTGCGGAC
CAATGATCTCATTTCACAATCTCATGACATAGATTTTACGGCTCTTAAAT
ACGAAGCCATGTTTTATCAGATAAATCCTCTTGTTTTAAAAATTAATTTA
ATATCGTTCGGTCATTTTAATTATTGTGGAAATATTTTATTTCAAGGAGG
CATTAATTTCTCCGAATCAGGAAACTTTGGAATGAAAAATGTTTCAAATT
CAATTCAAAGTCAACATGAAGAACTACCATCGAGAACTAGTGTAACGTTG
AATGGTCACCGTGCATGCAATTCAGTTGATTTATCTAGATTGGCATCAGA
TGATGATTTCTTCAATGATACCTCATTGATTTCTCAACGCCTTTCATCTC
CAATACAATTACGTGCCGCCACATCACAAATCAAATCTGTGTCAGTAAAG
AATGAAACAAACAAACAAGAACATAATTTAATCAAAAGTAAAAGTCTGGA
TTTTACTTATACAGACGGCCATCCAGTCAATAGTCAAGTTACAATTATCA
AATGTCATCAGAAATGGATGGCTGTATGTTATCCGTTTAATGTGACTTTA
TATTGGCATTGTGATATAAATGGCTGGCGATCAGTTTGGCGTTCTGATCC
GAACAAGAGCTCTGGAATTATTCATAAAAGTGCTCTAATGAGTAAGCCTC
CTCAAATTCGTCGAAATACAGCGTCATTGGCGAGAAGAGATAGTAACGTA
ACCGAAGACACAAATAGTCTCATCCACGAAGCTTTGGTTGCTATTGCTAG
TGGCGGCTTAGTGTCACTGTTCAGTGTACAATTAAATGTAGTTGTCAAAA
CTCCTATTGATTATAATGTTATTCCTTTACAATCATCAATAAAATATGAA
AAACTAAGCCAGTTTTCATTTGATAGTTCTATCGATTATTTGGTGTTCCT
TGGAGGCCATCTTTTAGCAATTAGTGAGTCTTATCCAACATTTGGATTTT
GGCAATGTCAATCACGTCGTTGGCATAATTGTTCTGTCAATGCACAAATA
AATTGCTATTCAGTGATGAGTGAAGAATTCATTATTTTGGGATGTGAAAA
TGGAGGAATTTATCAGTTGAATGCTCAAAAGTTTCCCCTTCGAATGTCAG
ATAACGCAGTTTTATATACGGAAATGTTTAGAGATCCTTCTAATGATTCT
GTTACGGCGTTAGATGTATTTTACAATTCTCAAAAATGTTGCTCATTGGT
GGCAAATTGCTTAGAAATAGCATATGGAACAAATTCTGGAAAAATCAGGA
TAGTTGTCCAGCACGCCGGCGTAGGAGAGGGACCGAAAATATTTCAAACA
TTGACGGTTCATAGGGCCAAAATTATCCGAGTTGTTATATCTGAAAAATA
TTTGATTTCAATCTGCCAAAACATGAATCACATTCGTTCTTGGTTGATTA
GTCGATTTCGTGGTACTATAAATACACAACCTGGCACCCAATCACTGGCA
TCTTTCCATTTAATGTCATTGGATATTGAACCGAAAATTAGTCGAACTAT
TTTGGATAATGCACAATTAGATTCAGTAAATGAAATCACCAATGAAGATA
TGATGTTCTATAATCAGGTTCAGAAGGTCATTCGAATCAATACTGACATG
GGGCCCTATACGGATCATATGCTCTTTATTCAGAAACTACTTCCACAATG
CGATCGGCTGTTTGTGCGTTTAGCTCCGACGGGAAAACGGGTGTGCTGCA
TACTTTCTTATAAAGAAAATATAACTGCATTTGCCGTTCACCAGAGTGAT
ATTGGAGGTACGGTTAATTTGATAACCGGACATGAGGATGGATCCTTGGA
AATGTGGAATCTAACAACATCAATTGATCAAATCGGTAATTTTGAAACTC
ATCATCCTCCAACCGCAGCTGCTTCAGTTCTCAGTGGTCATGGCACTCAT
TGTTCTCGAGAAGACGGAGATAACAATGAGCAAACCCGAGTGCTAATGGG
TTTCAGATTTTATCCATCTTTGGATGAACCAAGTGAAAATGGACCTACTC
CTCGAGAATTATTTTGCATGCTACGTGATTATGATATAGCATTGGATGAT
ACATCTGAGAGGTCGATAAAACTGACTCAATGTATCTCATATCAATCACT
TCATTCTGAGGTTTCATCGAAGAATTCAACAATTCAGAGACTCCATCGAT
CGAGTCAAGTAAAATGTAATCAGCCGTCTTTTTGATATGTTTTGATTTAA
TACAAATGATTTAACATCAAAAA
back to top

protein sequence of SMED30026133-orf-1

>SMED30026133-orf-1 ID=SMED30026133-orf-1|Name=SMED30026133-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=794bp
MLSKSSQIVKLNVGGQLFVTTQQTLLLHHSTFFSSLIHNSIRDDDNEFFI
DRDPKMFSVILNYLRTNDLISQSHDIDFTALKYEAMFYQINPLVLKINLI
SFGHFNYCGNILFQGGINFSESGNFGMKNVSNSIQSQHEELPSRTSVTLN
GHRACNSVDLSRLASDDDFFNDTSLISQRLSSPIQLRAATSQIKSVSVKN
ETNKQEHNLIKSKSLDFTYTDGHPVNSQVTIIKCHQKWMAVCYPFNVTLY
WHCDINGWRSVWRSDPNKSSGIIHKSALMSKPPQIRRNTASLARRDSNVT
EDTNSLIHEALVAIASGGLVSLFSVQLNVVVKTPIDYNVIPLQSSIKYEK
LSQFSFDSSIDYLVFLGGHLLAISESYPTFGFWQCQSRRWHNCSVNAQIN
CYSVMSEEFIILGCENGGIYQLNAQKFPLRMSDNAVLYTEMFRDPSNDSV
TALDVFYNSQKCCSLVANCLEIAYGTNSGKIRIVVQHAGVGEGPKIFQTL
TVHRAKIIRVVISEKYLISICQNMNHIRSWLISRFRGTINTQPGTQSLAS
FHLMSLDIEPKISRTILDNAQLDSVNEITNEDMMFYNQVQKVIRINTDMG
PYTDHMLFIQKLLPQCDRLFVRLAPTGKRVCCILSYKENITAFAVHQSDI
GGTVNLITGHEDGSLEMWNLTTSIDQIGNFETHHPPTAAASVLSGHGTHC
SREDGDNNEQTRVLMGFRFYPSLDEPSENGPTPRELFCMLRDYDIALDDT
SERSIKLTQCISYQSLHSEVSSKNSTIQRLHRSSQVKCNQPSF*
back to top

protein sequence of SMED30026133-orf-2

>SMED30026133-orf-2 ID=SMED30026133-orf-2|Name=SMED30026133-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
MAIPTDERVTNRIEPHPFLPIIATCGIDYNVKIVGSTLQPIKSPEEKQAY
VEKIVNQNERRTENAKGCQSMSMLDLLRVIRAQRMINRINSGISGSDINI
N*
back to top

protein sequence of SMED30026133-orf-3

>SMED30026133-orf-3 ID=SMED30026133-orf-3|Name=SMED30026133-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=378bp
MLTHWRFMNSRSKSSFYHDSASYTENLKVFEKLEGHRGCVNTVAWDKSGT
KILSGGDDAILRIHQFLSDWDKPWVKDHVYEISLPNSRNILSAKFMPIYN
NQIVSASKCGSIFLVDVNSTNKELNVFYKHSGPTLNIATFEDEAFNFATA
SNDKTFCIFDIRESNNIPFLKMNLPCSLSAIAIHPLCSYKIAIGGSDSCV
RVFDKRYLNKSFNNVEKTLKYVTEICRPLQFPIDNKISNRSPLYNYGRRC
VNSVSFEPRLGNHILVSYMYDSIYLFDTRQQENRQSDFQPERLPLDTSSF
RIHYNWENTGPPRPEGEQERGDIICPPSIQSFLDDLQLNESSYESKIDFT
IESQLKSVKRYKEVQIYVGHQNCRTME*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR000210BTB/POZ_dom
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR003131T1-type_BTB
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR011333SKP1/BTB/POZ_sf
IPR001680WD40_repeat
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0051260protein homooligomerization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000210BTB/POZ domainSMARTSM00225BTB_4coord: 7..105
e-value: 3.5E-9
score: 46.5
IPR000210BTB/POZ domainPROSITEPS50097BTBcoord: 7..73
score: 9.703
NoneNo IPR availableGENE3DG3DSA:3.30.710.10coord: 1..101
e-value: 8.9E-27
score: 95.3
NoneNo IPR availablePANTHERPTHR15859:SF1coord: 4..779
NoneNo IPR availablePANTHERPTHR15859SETA BINDING PROTEIN 1coord: 4..779
NoneNo IPR availableCDDcd18316BTB_POZ_KCTD-likecoord: 9..88
e-value: 7.8515E-27
score: 102.251
IPR003131Potassium channel tetramerisation-type BTB domainPFAMPF02214BTB_2coord: 9..95
e-value: 3.4E-20
score: 72.2
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 656..670
IPR011333SKP1/BTB/POZ domain superfamilySUPERFAMILYSSF54695POZ domaincoord: 6..100
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 311..684